From 80a1b00f22e67e3935b5ae5e434e15af1c3faa25 Mon Sep 17 00:00:00 2001 From: =?UTF-8?q?Andreas=20Nie=C3=9F?= Date: Wed, 16 Nov 2022 11:19:36 +0100 Subject: [PATCH] fix: Some test case are not working correctly --- examples/main.tf | 6 +- go.mod | 40 +- go.sum | 43 + netbox/resource_netbox_ipam_aggregate_test.go | 5 +- .../resource_netbox_virtualization_vm_test.go | 13 +- .../go-openapi/runtime/client/response.go | 2 + .../go-openapi/runtime/client/runtime.go | 19 +- .../go-openapi/runtime/middleware/context.go | 4 +- .../runtime/middleware/parameter.go | 6 +- .../github.com/google/go-cmp/cmp/compare.go | 64 +- .../google/go-cmp/cmp/internal/diff/diff.go | 44 +- .../google/go-cmp/cmp/internal/value/zero.go | 48 - .../github.com/google/go-cmp/cmp/options.go | 10 +- vendor/github.com/google/go-cmp/cmp/path.go | 20 +- .../google/go-cmp/cmp/report_compare.go | 10 +- .../google/go-cmp/cmp/report_reflect.go | 11 +- .../google/go-cmp/cmp/report_slices.go | 25 +- .../google/go-cmp/cmp/report_text.go | 1 + .../hashicorp/go-hclog/intlogger.go | 169 +- .../github.com/hashicorp/go-hclog/logger.go | 4 + .../hashicorp/go-plugin/CHANGELOG.md | 6 + vendor/github.com/hashicorp/go-plugin/LICENSE | 2 + .../hashicorp/go-plugin/grpc_server.go | 16 +- .../hashicorp/go-plugin/rpc_server.go | 13 +- .../github.com/hashicorp/hcl/v2/CHANGELOG.md | 27 +- .../hashicorp/hcl/v2/hclsyntax/spec.md | 2 +- .../internal/version/version.go | 2 +- .../terraform-exec/tfexec/exit_errors.go | 13 + .../terraform-exec/tfexec/force_unlock.go | 16 +- .../hashicorp/terraform-exec/tfexec/init.go | 10 +- .../internal/cmd/generate.go | 5 +- .../internal/provider/generate.go | 31 +- .../internal/provider/template.go | 36 +- .../terraform-plugin-docs/schemamd/render.go | 53 +- .../hashicorp/terraform-plugin-go/LICENSE | 2 + .../internal/tfplugin5/tfplugin5.pb.go | 17 + .../internal/tfplugin5/tfplugin5.proto | 17 + .../terraform-plugin-go/tfprotov5/provider.go | 2 +- .../internal/tfplugin6/tfplugin6.pb.go | 17 + .../internal/tfplugin6/tfplugin6.proto | 17 + .../terraform-plugin-go/tfprotov6/provider.go | 2 +- .../hashicorp/terraform-plugin-sdk/v2/LICENSE | 2 + .../v2/helper/logging/logging.go | 7 +- .../v2/helper/resource/plugin.go | 29 +- .../v2/helper/resource/testcase_providers.go | 6 +- .../v2/helper/resource/testing.go | 32 + .../v2/helper/resource/testing_new.go | 49 +- .../v2/helper/resource/testing_new_config.go | 2 +- .../resource/testing_new_import_state.go | 70 +- .../resource/testing_new_refresh_state.go | 97 + .../v2/helper/resource/teststep_providers.go | 50 +- .../v2/helper/resource/teststep_validate.go | 33 +- .../v2/helper/schema/schema.go | 21 +- .../v2/internal/logging/keys.go | 6 + .../v2/internal/plugintest/config.go | 3 +- .../v2/internal/plugintest/helper.go | 5 +- .../v2/internal/plugintest/util.go | 75 +- .../v2/internal/plugintest/working_dir.go | 71 +- .../terraform-plugin-sdk/v2/plugin/serve.go | 11 +- .../terraform-registry-address/LICENSE | 2 + vendor/github.com/huandu/xstrings/.travis.yml | 7 - vendor/github.com/huandu/xstrings/README.md | 182 +- vendor/github.com/huandu/xstrings/convert.go | 2 +- .../zclconf/go-cty/cty/convert/conversion.go | 4 +- .../cty/convert/conversion_collection.go | 81 +- .../go-cty/cty/convert/conversion_dynamic.go | 104 + .../go-cty/cty/convert/conversion_object.go | 8 +- .../zclconf/go-cty/cty/convert/public.go | 2 +- .../zclconf/go-cty/cty/function/argument.go | 3 + .../zclconf/go-cty/cty/function/function.go | 62 + .../go-cty/cty/function/stdlib/bool.go | 3 + .../go-cty/cty/function/stdlib/bytes.go | 2 + .../go-cty/cty/function/stdlib/collection.go | 31 +- .../go-cty/cty/function/stdlib/conversion.go | 2 + .../zclconf/go-cty/cty/function/stdlib/csv.go | 1 + .../go-cty/cty/function/stdlib/datetime.go | 2 + .../go-cty/cty/function/stdlib/format.go | 2 + .../go-cty/cty/function/stdlib/general.go | 5 +- .../go-cty/cty/function/stdlib/json.go | 2 + .../go-cty/cty/function/stdlib/number.go | 24 +- .../go-cty/cty/function/stdlib/regexp.go | 2 + .../go-cty/cty/function/stdlib/sequence.go | 4 +- .../zclconf/go-cty/cty/function/stdlib/set.go | 5 + .../go-cty/cty/function/stdlib/string.go | 81 +- .../cty/function/stdlib/string_replace.go | 19 +- .../go.mongodb.org/mongo-driver/bson/bson.go | 6 +- .../mongo-driver/bson/bsoncodec/doc.go | 12 +- .../mongo-driver/bson/bsoncodec/registry.go | 1 + .../bson/bsoncodec/struct_tag_parser.go | 42 +- .../mongo-driver/bson/bsonoptions/doc.go | 8 + .../go.mongodb.org/mongo-driver/bson/doc.go | 109 +- .../mongo-driver/bson/primitive/decimal.go | 7 +- .../mongo-driver/bson/primitive/objectid.go | 4 +- .../mongo-driver/bson/primitive/primitive.go | 6 +- .../x/bsonx/bsoncore/document_sequence.go | 4 +- vendor/golang.org/x/crypto/AUTHORS | 3 - vendor/golang.org/x/crypto/CONTRIBUTORS | 3 - vendor/golang.org/x/crypto/cast5/cast5.go | 11 +- .../x/crypto/chacha20/chacha_generic.go | 4 +- .../{subtle/aliasing.go => alias/alias.go} | 5 +- .../alias_purego.go} | 5 +- .../x/crypto/openpgp/packet/opaque.go | 3 +- .../x/crypto/openpgp/packet/private_key.go | 3 +- .../openpgp/packet/symmetrically_encrypted.go | 2 +- .../x/crypto/openpgp/packet/userattribute.go | 3 +- .../x/crypto/openpgp/packet/userid.go | 3 +- vendor/golang.org/x/crypto/openpgp/s2k/s2k.go | 2 +- vendor/golang.org/x/crypto/openpgp/write.go | 2 +- vendor/golang.org/x/crypto/ssh/certs.go | 2 +- vendor/golang.org/x/crypto/ssh/cipher.go | 11 +- vendor/golang.org/x/crypto/ssh/common.go | 4 +- vendor/golang.org/x/crypto/ssh/connection.go | 2 +- vendor/golang.org/x/crypto/ssh/keys.go | 2 +- vendor/golang.org/x/crypto/ssh/messages.go | 2 +- vendor/golang.org/x/crypto/ssh/server.go | 14 +- vendor/golang.org/x/crypto/ssh/session.go | 7 +- vendor/golang.org/x/net/context/go17.go | 4 +- vendor/golang.org/x/net/http2/headermap.go | 18 + .../x/net/http2/hpack/static_table.go | 188 + vendor/golang.org/x/net/http2/hpack/tables.go | 78 +- vendor/golang.org/x/net/http2/server.go | 171 +- vendor/golang.org/x/net/http2/transport.go | 104 +- vendor/golang.org/x/net/trace/trace.go | 2 +- .../golang.org/x/sys/cpu/cpu_other_ppc64x.go | 15 + .../sys/internal/unsafeheader/unsafeheader.go | 30 - vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s | 31 + vendor/golang.org/x/sys/unix/dirent.go | 4 +- vendor/golang.org/x/sys/unix/ioctl_linux.go | 20 +- vendor/golang.org/x/sys/unix/mkall.sh | 23 +- vendor/golang.org/x/sys/unix/mkerrors.sh | 4 +- vendor/golang.org/x/sys/unix/sockcmsg_unix.go | 14 + vendor/golang.org/x/sys/unix/str.go | 27 - vendor/golang.org/x/sys/unix/syscall.go | 10 +- .../x/sys/unix/syscall_darwin.1_12.go | 32 - .../x/sys/unix/syscall_darwin.1_13.go | 108 - .../golang.org/x/sys/unix/syscall_darwin.go | 90 + .../x/sys/unix/syscall_freebsd_386.go | 2 +- .../x/sys/unix/syscall_freebsd_amd64.go | 2 +- .../x/sys/unix/syscall_freebsd_arm.go | 2 +- .../x/sys/unix/syscall_freebsd_arm64.go | 2 +- .../x/sys/unix/syscall_freebsd_riscv64.go | 2 +- .../golang.org/x/sys/unix/syscall_illumos.go | 106 - vendor/golang.org/x/sys/unix/syscall_linux.go | 44 +- .../x/sys/unix/syscall_linux_386.go | 4 - .../x/sys/unix/syscall_linux_amd64.go | 4 - .../x/sys/unix/syscall_linux_arm.go | 4 - .../x/sys/unix/syscall_linux_arm64.go | 4 - .../x/sys/unix/syscall_linux_loong64.go | 4 - .../x/sys/unix/syscall_linux_mips64x.go | 4 - .../x/sys/unix/syscall_linux_mipsx.go | 4 - .../x/sys/unix/syscall_linux_ppc.go | 4 - .../x/sys/unix/syscall_linux_ppc64x.go | 4 - .../x/sys/unix/syscall_linux_riscv64.go | 4 - .../x/sys/unix/syscall_linux_s390x.go | 4 - .../x/sys/unix/syscall_linux_sparc64.go | 4 - .../x/sys/unix/syscall_openbsd_libc.go | 4 +- .../x/sys/unix/syscall_openbsd_ppc64.go | 42 + .../x/sys/unix/syscall_openbsd_riscv64.go | 42 + .../golang.org/x/sys/unix/syscall_solaris.go | 217 +- vendor/golang.org/x/sys/unix/syscall_unix.go | 20 +- .../golang.org/x/sys/unix/syscall_unix_gc.go | 6 +- .../x/sys/unix/syscall_zos_s390x.go | 173 +- vendor/golang.org/x/sys/unix/sysvshm_unix.go | 13 +- vendor/golang.org/x/sys/unix/xattr_bsd.go | 95 +- .../x/sys/unix/zerrors_openbsd_ppc64.go | 1905 +++++++++ .../x/sys/unix/zerrors_openbsd_riscv64.go | 1904 +++++++++ .../x/sys/unix/zsyscall_darwin_amd64.1_13.go | 40 - .../x/sys/unix/zsyscall_darwin_amd64.1_13.s | 25 - .../x/sys/unix/zsyscall_darwin_amd64.go | 32 +- .../x/sys/unix/zsyscall_darwin_amd64.s | 21 +- .../x/sys/unix/zsyscall_darwin_arm64.1_13.go | 40 - .../x/sys/unix/zsyscall_darwin_arm64.1_13.s | 25 - .../x/sys/unix/zsyscall_darwin_arm64.go | 32 +- .../x/sys/unix/zsyscall_darwin_arm64.s | 21 +- .../x/sys/unix/zsyscall_illumos_amd64.go | 28 +- .../golang.org/x/sys/unix/zsyscall_linux.go | 10 + .../x/sys/unix/zsyscall_linux_386.go | 40 - .../x/sys/unix/zsyscall_linux_amd64.go | 40 - .../x/sys/unix/zsyscall_linux_arm.go | 40 - .../x/sys/unix/zsyscall_linux_arm64.go | 40 - .../x/sys/unix/zsyscall_linux_loong64.go | 40 - .../x/sys/unix/zsyscall_linux_mips.go | 40 - .../x/sys/unix/zsyscall_linux_mips64.go | 40 - .../x/sys/unix/zsyscall_linux_mips64le.go | 40 - .../x/sys/unix/zsyscall_linux_mipsle.go | 40 - .../x/sys/unix/zsyscall_linux_ppc.go | 40 - .../x/sys/unix/zsyscall_linux_ppc64.go | 40 - .../x/sys/unix/zsyscall_linux_ppc64le.go | 40 - .../x/sys/unix/zsyscall_linux_riscv64.go | 40 - .../x/sys/unix/zsyscall_linux_s390x.go | 40 - .../x/sys/unix/zsyscall_linux_sparc64.go | 40 - .../x/sys/unix/zsyscall_openbsd_ppc64.go | 2221 +++++++++++ .../x/sys/unix/zsyscall_openbsd_ppc64.s | 796 ++++ .../x/sys/unix/zsyscall_openbsd_riscv64.go | 2221 +++++++++++ .../x/sys/unix/zsyscall_openbsd_riscv64.s | 796 ++++ .../x/sys/unix/zsyscall_solaris_amd64.go | 28 +- .../x/sys/unix/zsysctl_openbsd_ppc64.go | 281 ++ .../x/sys/unix/zsysctl_openbsd_riscv64.go | 282 ++ .../x/sys/unix/zsysnum_openbsd_ppc64.go | 218 ++ .../x/sys/unix/zsysnum_openbsd_riscv64.go | 219 ++ .../x/sys/unix/ztypes_freebsd_386.go | 17 +- .../x/sys/unix/ztypes_freebsd_amd64.go | 18 +- .../x/sys/unix/ztypes_freebsd_arm.go | 18 +- .../x/sys/unix/ztypes_freebsd_arm64.go | 18 +- .../x/sys/unix/ztypes_freebsd_riscv64.go | 18 +- .../x/sys/unix/ztypes_illumos_amd64.go | 42 - .../golang.org/x/sys/unix/ztypes_linux_386.go | 6 + .../x/sys/unix/ztypes_linux_amd64.go | 6 + .../golang.org/x/sys/unix/ztypes_linux_arm.go | 6 + .../x/sys/unix/ztypes_linux_arm64.go | 6 + .../x/sys/unix/ztypes_linux_loong64.go | 6 + .../x/sys/unix/ztypes_linux_mips.go | 6 + .../x/sys/unix/ztypes_linux_mips64.go | 6 + .../x/sys/unix/ztypes_linux_mips64le.go | 6 + .../x/sys/unix/ztypes_linux_mipsle.go | 6 + .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 6 + .../x/sys/unix/ztypes_linux_ppc64.go | 6 + .../x/sys/unix/ztypes_linux_ppc64le.go | 6 + .../x/sys/unix/ztypes_linux_riscv64.go | 6 + .../x/sys/unix/ztypes_linux_s390x.go | 6 + .../x/sys/unix/ztypes_linux_sparc64.go | 6 + .../x/sys/unix/ztypes_openbsd_ppc64.go | 571 +++ .../x/sys/unix/ztypes_openbsd_riscv64.go | 571 +++ .../x/sys/unix/ztypes_solaris_amd64.go | 35 + .../golang.org/x/sys/unix/ztypes_zos_s390x.go | 11 +- vendor/golang.org/x/text/AUTHORS | 3 - vendor/golang.org/x/text/CONTRIBUTORS | 3 - vendor/golang.org/x/text/cases/cases.go | 162 + vendor/golang.org/x/text/cases/context.go | 376 ++ vendor/golang.org/x/text/cases/fold.go | 34 + vendor/golang.org/x/text/cases/icu.go | 62 + vendor/golang.org/x/text/cases/info.go | 82 + vendor/golang.org/x/text/cases/map.go | 816 ++++ .../golang.org/x/text/cases/tables10.0.0.go | 2256 +++++++++++ .../golang.org/x/text/cases/tables11.0.0.go | 2317 +++++++++++ .../golang.org/x/text/cases/tables12.0.0.go | 2360 +++++++++++ .../golang.org/x/text/cases/tables13.0.0.go | 2400 ++++++++++++ vendor/golang.org/x/text/cases/tables9.0.0.go | 2216 +++++++++++ vendor/golang.org/x/text/cases/trieval.go | 217 ++ vendor/golang.org/x/text/internal/internal.go | 49 + .../x/text/internal/language/common.go | 16 + .../x/text/internal/language/compact.go | 29 + .../text/internal/language/compact/compact.go | 61 + .../internal/language/compact/language.go | 260 ++ .../text/internal/language/compact/parents.go | 120 + .../text/internal/language/compact/tables.go | 1015 +++++ .../x/text/internal/language/compact/tags.go | 91 + .../x/text/internal/language/compose.go | 167 + .../x/text/internal/language/coverage.go | 28 + .../x/text/internal/language/language.go | 627 +++ .../x/text/internal/language/lookup.go | 412 ++ .../x/text/internal/language/match.go | 226 ++ .../x/text/internal/language/parse.go | 608 +++ .../x/text/internal/language/tables.go | 3472 +++++++++++++++++ .../x/text/internal/language/tags.go | 48 + vendor/golang.org/x/text/internal/match.go | 67 + vendor/golang.org/x/text/internal/tag/tag.go | 100 + vendor/golang.org/x/text/language/coverage.go | 187 + vendor/golang.org/x/text/language/doc.go | 98 + vendor/golang.org/x/text/language/language.go | 605 +++ vendor/golang.org/x/text/language/match.go | 735 ++++ vendor/golang.org/x/text/language/parse.go | 256 ++ vendor/golang.org/x/text/language/tables.go | 298 ++ vendor/golang.org/x/text/language/tags.go | 145 + vendor/golang.org/x/text/unicode/bidi/core.go | 26 +- .../x/text/unicode/norm/forminfo.go | 9 +- .../x/text/unicode/norm/normalize.go | 11 +- .../x/text/unicode/norm/tables13.0.0.go | 4 +- .../grpc/balancer/balancer.go | 2 +- .../grpc/balancer/roundrobin/roundrobin.go | 16 +- vendor/google.golang.org/grpc/dialoptions.go | 15 +- .../health/grpc_health_v1/health_grpc.pb.go | 17 + .../grpc/internal/binarylog/binarylog.go | 20 +- .../grpc/internal/binarylog/env_config.go | 2 +- .../grpc/internal/binarylog/method_logger.go | 19 +- .../grpc/internal/envconfig/observability.go | 36 + .../grpc/internal/envconfig/xds.go | 7 +- .../grpc/internal/grpcrand/grpcrand.go | 7 + .../grpc/internal/internal.go | 42 +- .../grpc/internal/resolver/unix/unix.go | 5 +- .../grpc/internal/transport/controlbuf.go | 4 +- .../grpc/internal/transport/http2_client.go | 27 +- .../grpc/internal/transport/http2_server.go | 19 +- .../grpc/internal/transport/http_util.go | 23 +- .../grpc/metadata/metadata.go | 55 +- .../reflection_grpc.pb.go | 16 + vendor/google.golang.org/grpc/server.go | 147 +- vendor/google.golang.org/grpc/stream.go | 115 +- vendor/google.golang.org/grpc/version.go | 2 +- vendor/modules.txt | 53 +- 290 files changed, 38654 insertions(+), 2369 deletions(-) delete mode 100644 vendor/github.com/google/go-cmp/cmp/internal/value/zero.go create mode 100644 vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_refresh_state.go delete mode 100644 vendor/github.com/huandu/xstrings/.travis.yml create mode 100644 vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/doc.go delete mode 100644 vendor/golang.org/x/crypto/AUTHORS delete mode 100644 vendor/golang.org/x/crypto/CONTRIBUTORS rename vendor/golang.org/x/crypto/internal/{subtle/aliasing.go => alias/alias.go} (84%) rename vendor/golang.org/x/crypto/internal/{subtle/aliasing_purego.go => alias/alias_purego.go} (86%) create mode 100644 vendor/golang.org/x/net/http2/hpack/static_table.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go delete mode 100644 vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go create mode 100644 vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s delete mode 100644 vendor/golang.org/x/sys/unix/str.go delete mode 100644 vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go delete mode 100644 vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go create mode 100644 vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go create mode 100644 vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go create mode 100644 vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go create mode 100644 vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go delete mode 100644 vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go delete mode 100644 vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s delete mode 100644 vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go delete mode 100644 vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s create mode 100644 vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go create mode 100644 vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s create mode 100644 vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go create mode 100644 vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s create mode 100644 vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go create mode 100644 vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go create mode 100644 vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go create mode 100644 vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go delete mode 100644 vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go create mode 100644 vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go create mode 100644 vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go delete mode 100644 vendor/golang.org/x/text/AUTHORS delete mode 100644 vendor/golang.org/x/text/CONTRIBUTORS create mode 100644 vendor/golang.org/x/text/cases/cases.go create mode 100644 vendor/golang.org/x/text/cases/context.go create mode 100644 vendor/golang.org/x/text/cases/fold.go create mode 100644 vendor/golang.org/x/text/cases/icu.go create mode 100644 vendor/golang.org/x/text/cases/info.go create mode 100644 vendor/golang.org/x/text/cases/map.go create mode 100644 vendor/golang.org/x/text/cases/tables10.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables11.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables12.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables13.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables9.0.0.go create mode 100644 vendor/golang.org/x/text/cases/trieval.go create mode 100644 vendor/golang.org/x/text/internal/internal.go create mode 100644 vendor/golang.org/x/text/internal/language/common.go create mode 100644 vendor/golang.org/x/text/internal/language/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go create mode 100644 vendor/golang.org/x/text/internal/language/compose.go create mode 100644 vendor/golang.org/x/text/internal/language/coverage.go create mode 100644 vendor/golang.org/x/text/internal/language/language.go create mode 100644 vendor/golang.org/x/text/internal/language/lookup.go create mode 100644 vendor/golang.org/x/text/internal/language/match.go create mode 100644 vendor/golang.org/x/text/internal/language/parse.go create mode 100644 vendor/golang.org/x/text/internal/language/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/tags.go create mode 100644 vendor/golang.org/x/text/internal/match.go create mode 100644 vendor/golang.org/x/text/internal/tag/tag.go create mode 100644 vendor/golang.org/x/text/language/coverage.go create mode 100644 vendor/golang.org/x/text/language/doc.go create mode 100644 vendor/golang.org/x/text/language/language.go create mode 100644 vendor/golang.org/x/text/language/match.go create mode 100644 vendor/golang.org/x/text/language/parse.go create mode 100644 vendor/golang.org/x/text/language/tables.go create mode 100644 vendor/golang.org/x/text/language/tags.go create mode 100644 vendor/google.golang.org/grpc/internal/envconfig/observability.go diff --git a/examples/main.tf b/examples/main.tf index 0ed55c37c..82a7d04b5 100644 --- a/examples/main.tf +++ b/examples/main.tf @@ -709,9 +709,13 @@ resource "netbox_virtualization_interface" "interface_test" { description = "Interface de test" } +data "netbox_json_ipam_rirs_list" "json_rir" { + limit = 1 +} + resource "netbox_ipam_aggregate" "aggregate_test" { prefix = "192.167.0.0/24" - rir_id = 1 + rir_id = jsondecode(data.netbox_json_ipam_rirs_list.json_rir.json)[0].id date_added = "2020-12-21" description = "Aggregate created by terraform" diff --git a/go.mod b/go.mod index 2a3c6812c..6db0ac501 100644 --- a/go.mod +++ b/go.mod @@ -3,10 +3,10 @@ module github.com/smutel/terraform-provider-netbox/v4 go 1.18 require ( - github.com/go-openapi/runtime v0.24.1 + github.com/go-openapi/runtime v0.24.2 github.com/go-openapi/strfmt v0.21.3 - github.com/hashicorp/terraform-plugin-docs v0.10.1 - github.com/hashicorp/terraform-plugin-sdk/v2 v2.21.0 + github.com/hashicorp/terraform-plugin-docs v0.13.0 + github.com/hashicorp/terraform-plugin-sdk/v2 v2.24.1 github.com/smutel/go-netbox/v3 v3.2.3 ) @@ -31,34 +31,34 @@ require ( github.com/go-openapi/swag v0.22.3 // indirect github.com/go-openapi/validate v0.22.0 // indirect github.com/golang/protobuf v1.5.2 // indirect - github.com/google/go-cmp v0.5.8 // indirect + github.com/google/go-cmp v0.5.9 // indirect github.com/google/uuid v1.3.0 // indirect github.com/hashicorp/errwrap v1.1.0 // indirect github.com/hashicorp/go-checkpoint v0.5.0 // indirect github.com/hashicorp/go-cleanhttp v0.5.2 // indirect github.com/hashicorp/go-cty v1.4.1-0.20200414143053-d3edf31b6320 // indirect - github.com/hashicorp/go-hclog v1.2.2 // indirect + github.com/hashicorp/go-hclog v1.3.1 // indirect github.com/hashicorp/go-multierror v1.1.1 // indirect - github.com/hashicorp/go-plugin v1.4.5 // indirect + github.com/hashicorp/go-plugin v1.4.6 // indirect github.com/hashicorp/go-uuid v1.0.3 // indirect github.com/hashicorp/go-version v1.6.0 // indirect github.com/hashicorp/hc-install v0.4.0 // indirect - github.com/hashicorp/hcl/v2 v2.13.0 // indirect + github.com/hashicorp/hcl/v2 v2.15.0 // indirect github.com/hashicorp/logutils v1.0.0 // indirect - github.com/hashicorp/terraform-exec v0.17.2 // indirect + github.com/hashicorp/terraform-exec v0.17.3 // indirect github.com/hashicorp/terraform-json v0.14.0 // indirect - github.com/hashicorp/terraform-plugin-go v0.14.0 // indirect + github.com/hashicorp/terraform-plugin-go v0.14.1 // indirect github.com/hashicorp/terraform-plugin-log v0.7.0 // indirect - github.com/hashicorp/terraform-registry-address v0.0.0-20220623143253-7d51757b572c // indirect + github.com/hashicorp/terraform-registry-address v0.1.0 // indirect github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734 // indirect github.com/hashicorp/yamux v0.1.1 // indirect - github.com/huandu/xstrings v1.3.2 // indirect + github.com/huandu/xstrings v1.3.3 // indirect github.com/imdario/mergo v0.3.13 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/mailru/easyjson v0.7.7 // indirect github.com/mattn/go-colorable v0.1.13 // indirect github.com/mattn/go-isatty v0.0.16 // indirect - github.com/mitchellh/cli v1.1.4 // indirect + github.com/mitchellh/cli v1.1.5 // indirect github.com/mitchellh/copystructure v1.2.0 // indirect github.com/mitchellh/go-testing-interface v1.14.1 // indirect github.com/mitchellh/go-wordwrap v1.0.1 // indirect @@ -74,15 +74,15 @@ require ( github.com/vmihailenco/msgpack v4.0.4+incompatible // indirect github.com/vmihailenco/msgpack/v4 v4.3.12 // indirect github.com/vmihailenco/tagparser v0.1.2 // indirect - github.com/zclconf/go-cty v1.11.0 // indirect - go.mongodb.org/mongo-driver v1.10.1 // indirect - golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d // indirect - golang.org/x/net v0.0.0-20220822230855-b0a4917ee28c // indirect - golang.org/x/sys v0.0.0-20220825204002-c680a09ffe64 // indirect - golang.org/x/text v0.3.7 // indirect + github.com/zclconf/go-cty v1.12.1 // indirect + go.mongodb.org/mongo-driver v1.11.0 // indirect + golang.org/x/crypto v0.2.0 // indirect + golang.org/x/net v0.2.0 // indirect + golang.org/x/sys v0.2.0 // indirect + golang.org/x/text v0.4.0 // indirect google.golang.org/appengine v1.6.7 // indirect - google.golang.org/genproto v0.0.0-20220822174746-9e6da59bd2fc // indirect - google.golang.org/grpc v1.49.0 // indirect + google.golang.org/genproto v0.0.0-20221114212237-e4508ebdbee1 // indirect + google.golang.org/grpc v1.50.1 // indirect google.golang.org/protobuf v1.28.1 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect diff --git a/go.sum b/go.sum index 9b1ec3220..a61b2f8e2 100644 --- a/go.sum +++ b/go.sum @@ -6,6 +6,7 @@ github.com/Masterminds/goutils v1.1.1/go.mod h1:8cTjp+g8YejhMuvIA5y2vz3BpJxksy86 github.com/Masterminds/semver/v3 v3.1.1 h1:hLg3sBzpNErnxhQtUy/mmLR2I9foDujNK030IGemrRc= github.com/Masterminds/semver/v3 v3.1.1/go.mod h1:VPu/7SZ7ePZ3QOrcuXROw5FAcLl4a0cBrbBpGY/8hQs= github.com/Masterminds/sprig/v3 v3.2.0/go.mod h1:tWhwTbUTndesPNeF0C900vKoq283u6zp4APT9vaF3SI= +github.com/Masterminds/sprig/v3 v3.2.1/go.mod h1:UoaO7Yp8KlPnJIYWTFkMaqPUYKTfGFPhxNuwnnxkKlk= github.com/Masterminds/sprig/v3 v3.2.2 h1:17jRggJu518dr3QaafizSXOjKYp94wKfABxUmyxvxX8= github.com/Masterminds/sprig/v3 v3.2.2/go.mod h1:UoaO7Yp8KlPnJIYWTFkMaqPUYKTfGFPhxNuwnnxkKlk= github.com/Microsoft/go-winio v0.4.14/go.mod h1:qXqCSQ3Xa7+6tgxaGTIe4Kpcdsi+P8jBhyzoq1bpyYA= @@ -23,6 +24,7 @@ github.com/anmitsu/go-shlex v0.0.0-20161002113705-648efa622239/go.mod h1:2FmKhYU github.com/apparentlymart/go-cidr v1.1.0 h1:2mAhrMoF+nhXqxTzSZMUzDHkLjmIHC+Zzn4tdgBZjnU= github.com/apparentlymart/go-cidr v1.1.0/go.mod h1:EBcsNrHc3zQeuaeCeCtQruQm+n9/YjEn/vI25Lg7Gwc= github.com/apparentlymart/go-dump v0.0.0-20190214190832-042adf3cf4a0 h1:MzVXffFUye+ZcSR6opIgz9Co7WcDx6ZcY+RjfFHoA0I= +github.com/apparentlymart/go-textseg v1.0.0 h1:rRmlIsPEEhUTIKQb7T++Nz/A5Q6C9IuX2wFoYVvnCs0= github.com/apparentlymart/go-textseg v1.0.0/go.mod h1:z96Txxhf3xSFMPmb5X/1W05FF/Nj9VFpLOpjS5yuumk= github.com/apparentlymart/go-textseg/v12 v12.0.0/go.mod h1:S/4uRK2UtaQttw1GenVJEynmyUenKwP++x/+DdGV/Ec= github.com/apparentlymart/go-textseg/v13 v13.0.0 h1:Y+KvPE1NYz0xl601PVImeQfFyEy6iT90AvPUL1NNfNw= @@ -76,6 +78,8 @@ github.com/go-openapi/loads v0.21.2 h1:r2a/xFIYeZ4Qd2TnGpWDIQNcP80dIaZgf704za8en github.com/go-openapi/loads v0.21.2/go.mod h1:Jq58Os6SSGz0rzh62ptiu8Z31I+OTHqmULx5e/gJbNw= github.com/go-openapi/runtime v0.24.1 h1:Sml5cgQKGYQHF+M7yYSHaH1eOjvTykrddTE/KtQVjqo= github.com/go-openapi/runtime v0.24.1/go.mod h1:AKurw9fNre+h3ELZfk6ILsfvPN+bvvlaU/M9q/r9hpk= +github.com/go-openapi/runtime v0.24.2 h1:yX9HMGQbz32M87ECaAhGpJjBmErO3QLcgdZj9BzGx7c= +github.com/go-openapi/runtime v0.24.2/go.mod h1:AKurw9fNre+h3ELZfk6ILsfvPN+bvvlaU/M9q/r9hpk= github.com/go-openapi/spec v0.20.4/go.mod h1:faYFR1CvsJZ0mNsmsphTMSoRrNV3TEDoAM7FOEWeq8I= github.com/go-openapi/spec v0.20.6/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA= github.com/go-openapi/spec v0.20.7 h1:1Rlu/ZrOCCob0n+JKKJAWhNWMPW8bOZRg8FJaY+0SKI= @@ -134,6 +138,8 @@ github.com/google/go-cmp v0.5.2/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.8 h1:e6P7q2lk1O+qJJb4BtCQXlK8vWEO8V1ZeuEdJNOqZyg= github.com/google/go-cmp v0.5.8/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= +github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/uuid v1.1.1/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.1.2/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.3.0 h1:t6JiXgmwXMjEs8VusXIJk2BXHsn+wx8BZdTaoZ5fu7I= @@ -151,11 +157,15 @@ github.com/hashicorp/go-cty v1.4.1-0.20200414143053-d3edf31b6320 h1:1/D3zfFHttUK github.com/hashicorp/go-cty v1.4.1-0.20200414143053-d3edf31b6320/go.mod h1:EiZBMaudVLy8fmjf9Npq1dq9RalhveqZG5w/yz3mHWs= github.com/hashicorp/go-hclog v1.2.2 h1:ihRI7YFwcZdiSD7SIenIhHfQH3OuDvWerAUBZbeQS3M= github.com/hashicorp/go-hclog v1.2.2/go.mod h1:W4Qnvbt70Wk/zYJryRzDRU/4r0kIg0PVHBcfoyhpF5M= +github.com/hashicorp/go-hclog v1.3.1 h1:vDwF1DFNZhntP4DAjuTpOw3uEgMUpXh1pB5fW9DqHpo= +github.com/hashicorp/go-hclog v1.3.1/go.mod h1:W4Qnvbt70Wk/zYJryRzDRU/4r0kIg0PVHBcfoyhpF5M= github.com/hashicorp/go-multierror v1.0.0/go.mod h1:dHtQlpGsu+cZNNAkkCN/P3hoUDHhCYQXV3UM06sGGrk= github.com/hashicorp/go-multierror v1.1.1 h1:H5DkEtf6CXdFp0N0Em5UCwQpXMWke8IA0+lD48awMYo= github.com/hashicorp/go-multierror v1.1.1/go.mod h1:iw975J/qwKPdAO1clOe2L8331t/9/fmwbPZ6JB6eMoM= github.com/hashicorp/go-plugin v1.4.5 h1:oTE/oQR4eghggRg8VY7PAz3dr++VwDNBGCcOfIvHpBo= github.com/hashicorp/go-plugin v1.4.5/go.mod h1:viDMjcLJuDui6pXb8U4HVfb8AamCWhHGUjr2IrTF67s= +github.com/hashicorp/go-plugin v1.4.6 h1:MDV3UrKQBM3du3G7MApDGvOsMYy3JQJ4exhSoKBAeVA= +github.com/hashicorp/go-plugin v1.4.6/go.mod h1:viDMjcLJuDui6pXb8U4HVfb8AamCWhHGUjr2IrTF67s= github.com/hashicorp/go-uuid v1.0.0/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= github.com/hashicorp/go-uuid v1.0.3 h1:2gKiV6YVmrJ1i2CKKa9obLvRieoRGviZFL26PcT/Co8= github.com/hashicorp/go-uuid v1.0.3/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= @@ -167,22 +177,34 @@ github.com/hashicorp/hc-install v0.4.0 h1:cZkRFr1WVa0Ty6x5fTvL1TuO1flul231rWkGH9 github.com/hashicorp/hc-install v0.4.0/go.mod h1:5d155H8EC5ewegao9A4PUTMNPZaq+TbOzkJJZ4vrXeI= github.com/hashicorp/hcl/v2 v2.13.0 h1:0Apadu1w6M11dyGFxWnmhhcMjkbAiKCv7G1r/2QgCNc= github.com/hashicorp/hcl/v2 v2.13.0/go.mod h1:e4z5nxYlWNPdDSNYX+ph14EvWYMFm3eP0zIUqPc2jr0= +github.com/hashicorp/hcl/v2 v2.15.0 h1:CPDXO6+uORPjKflkWCCwoWc9uRp+zSIPcCQ+BrxV7m8= +github.com/hashicorp/hcl/v2 v2.15.0/go.mod h1:JRmR89jycNkrrqnMmvPDMd56n1rQJ2Q6KocSLCMCXng= github.com/hashicorp/logutils v1.0.0 h1:dLEQVugN8vlakKOUE3ihGLTZJRB4j+M2cdTm/ORI65Y= github.com/hashicorp/logutils v1.0.0/go.mod h1:QIAnNjmIWmVIIkWDTG1z5v++HQmx9WQRO+LraFDTW64= github.com/hashicorp/terraform-exec v0.17.2 h1:EU7i3Fh7vDUI9nNRdMATCEfnm9axzTnad8zszYZ73Go= github.com/hashicorp/terraform-exec v0.17.2/go.mod h1:tuIbsL2l4MlwwIZx9HPM+LOV9vVyEfBYu2GsO1uH3/8= +github.com/hashicorp/terraform-exec v0.17.3 h1:MX14Kvnka/oWGmIkyuyvL6POx25ZmKrjlaclkx3eErU= +github.com/hashicorp/terraform-exec v0.17.3/go.mod h1:+NELG0EqQekJzhvikkeQsOAZpsw0cv/03rbeQJqscAI= github.com/hashicorp/terraform-json v0.14.0 h1:sh9iZ1Y8IFJLx+xQiKHGud6/TSUCM0N8e17dKDpqV7s= github.com/hashicorp/terraform-json v0.14.0/go.mod h1:5A9HIWPkk4e5aeeXIBbkcOvaZbIYnAIkEyqP2pNSckM= github.com/hashicorp/terraform-plugin-docs v0.10.1 h1:jiVYfhJ/hVXDAQN2XjLK3WH1A/YHgFCrFXPpxibvmjc= github.com/hashicorp/terraform-plugin-docs v0.10.1/go.mod h1:47ZcsxMUJxAjGzHf+dZ9q78oYf4PeJxO1N+i5XDtXBc= +github.com/hashicorp/terraform-plugin-docs v0.13.0 h1:6e+VIWsVGb6jYJewfzq2ok2smPzZrt1Wlm9koLeKazY= +github.com/hashicorp/terraform-plugin-docs v0.13.0/go.mod h1:W0oCmHAjIlTHBbvtppWHe8fLfZ2BznQbuv8+UD8OucQ= github.com/hashicorp/terraform-plugin-go v0.14.0 h1:ttnSlS8bz3ZPYbMb84DpcPhY4F5DsQtcAS7cHo8uvP4= github.com/hashicorp/terraform-plugin-go v0.14.0/go.mod h1:2nNCBeRLaenyQEi78xrGrs9hMbulveqG/zDMQSvVJTE= +github.com/hashicorp/terraform-plugin-go v0.14.1 h1:cwZzPYla82XwAqpLhSzdVsOMU+6H29tczAwrB0z9Zek= +github.com/hashicorp/terraform-plugin-go v0.14.1/go.mod h1:Bc/K6K26BQ2FHqIELPbpKtt2CzzbQou+0UQF3/0NsCQ= github.com/hashicorp/terraform-plugin-log v0.7.0 h1:SDxJUyT8TwN4l5b5/VkiTIaQgY6R+Y2BQ0sRZftGKQs= github.com/hashicorp/terraform-plugin-log v0.7.0/go.mod h1:p4R1jWBXRTvL4odmEkFfDdhUjHf9zcs/BCoNHAc7IK4= github.com/hashicorp/terraform-plugin-sdk/v2 v2.21.0 h1:eIJjFlI4k6BMso6Wq/bq56U0RukXc4JbwJJ8Oze2/tg= github.com/hashicorp/terraform-plugin-sdk/v2 v2.21.0/go.mod h1:mYPs/uchNcBq7AclQv9QUtSf9iNcfp1Ag21jqTlDf2M= +github.com/hashicorp/terraform-plugin-sdk/v2 v2.24.1 h1:zHcMbxY0+rFO9gY99elV/XC/UnQVg7FhRCbj1i5b7vM= +github.com/hashicorp/terraform-plugin-sdk/v2 v2.24.1/go.mod h1:+tNlb0wkfdsDJ7JEiERLz4HzM19HyiuIoGzTsM7rPpw= github.com/hashicorp/terraform-registry-address v0.0.0-20220623143253-7d51757b572c h1:D8aRO6+mTqHfLsK/BC3j5OAoogv1WLRWzY1AaTo3rBg= github.com/hashicorp/terraform-registry-address v0.0.0-20220623143253-7d51757b572c/go.mod h1:Wn3Na71knbXc1G8Lh+yu/dQWWJeFQEpDeJMtWMtlmNI= +github.com/hashicorp/terraform-registry-address v0.1.0 h1:W6JkV9wbum+m516rCl5/NjKxCyTVaaUBbzYcMzBDO3U= +github.com/hashicorp/terraform-registry-address v0.1.0/go.mod h1:EnyO2jYO6j29DTHbJcm00E5nQTFeTtyZH3H5ycydQ5A= github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734 h1:HKLsbzeOsfXmKNpr3GiT18XAblV0BjCbzL8KQAMZGa0= github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734/go.mod h1:kNDNcF7sN4DocDLBkQYz73HGKwN1ANB1blq4lIYLYvg= github.com/hashicorp/yamux v0.1.1 h1:yrQxtgseBDrq9Y652vSRDvsKCJKOUD+GzTS4Y0Y8pvE= @@ -190,6 +212,8 @@ github.com/hashicorp/yamux v0.1.1/go.mod h1:CtWFDAQgb7dxtzFs4tWbplKIe2jSi3+5vKbg github.com/huandu/xstrings v1.3.1/go.mod h1:y5/lhBue+AyNmUVz9RLU9xbLR0o4KIIExikq4ovT0aE= github.com/huandu/xstrings v1.3.2 h1:L18LIDzqlW6xN2rEkpdV8+oL/IXWJ1APd+vsdYy4Wdw= github.com/huandu/xstrings v1.3.2/go.mod h1:y5/lhBue+AyNmUVz9RLU9xbLR0o4KIIExikq4ovT0aE= +github.com/huandu/xstrings v1.3.3 h1:/Gcsuc1x8JVbJ9/rlye4xZnVAbEkGauT8lbebqcQws4= +github.com/huandu/xstrings v1.3.3/go.mod h1:y5/lhBue+AyNmUVz9RLU9xbLR0o4KIIExikq4ovT0aE= github.com/imdario/mergo v0.3.11/go.mod h1:jmQim1M+e3UYxmgPu/WyfjB3N3VflVyUjjjwH0dnCYA= github.com/imdario/mergo v0.3.12/go.mod h1:jmQim1M+e3UYxmgPu/WyfjB3N3VflVyUjjjwH0dnCYA= github.com/imdario/mergo v0.3.13 h1:lFzP57bqS/wsqKssCGmtLAb8A0wKjLGrve2q3PPVcBk= @@ -238,6 +262,8 @@ github.com/mattn/go-isatty v0.0.16 h1:bq3VjFmv/sOjHtdEhmkEV4x1AJtvUvOJ2PFAZ5+peK github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mitchellh/cli v1.1.4 h1:qj8czE26AU4PbiaPXK5uVmMSM+V5BYsFBiM9HhGRLUA= github.com/mitchellh/cli v1.1.4/go.mod h1:vTLESy5mRhKOs9KDp0/RATawxP1UqBmdrpVRMnpcvKQ= +github.com/mitchellh/cli v1.1.5 h1:OxRIeJXpAMztws/XHlN2vu6imG5Dpq+j61AzAX5fLng= +github.com/mitchellh/cli v1.1.5/go.mod h1:v8+iFts2sPIKUV1ltktPXMCC8fumSKFItNcD2cLtRR4= github.com/mitchellh/copystructure v1.0.0/go.mod h1:SNtv71yrdKgLRyLFxmLdkAbkKEFWgYaq1OVrnRcwhnw= github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw= github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s= @@ -331,6 +357,8 @@ github.com/zclconf/go-cty v1.2.0/go.mod h1:hOPWgoHbaTUnI5k4D2ld+GRpFJSCe6bCM7m1q github.com/zclconf/go-cty v1.10.0/go.mod h1:vVKLxnk3puL4qRAv72AO+W99LUD4da90g3uUAzyuvAk= github.com/zclconf/go-cty v1.11.0 h1:726SxLdi2SDnjY+BStqB9J1hNp4+2WlzyXLuimibIe0= github.com/zclconf/go-cty v1.11.0/go.mod h1:s9IfD1LK5ccNMSWCVFCE2rJfHiZgi7JijgeWIMfhLvA= +github.com/zclconf/go-cty v1.12.1 h1:PcupnljUm9EIvbgSHQnHhUr3fO6oFmkOrvs2BAFNXXY= +github.com/zclconf/go-cty v1.12.1/go.mod h1:s9IfD1LK5ccNMSWCVFCE2rJfHiZgi7JijgeWIMfhLvA= github.com/zclconf/go-cty-debug v0.0.0-20191215020915-b22d67c1ba0b/go.mod h1:ZRKQfBXbGkpdV6QMzT3rU1kSTAnfu1dO8dPKjYprgj8= go.mongodb.org/mongo-driver v1.7.3/go.mod h1:NqaYOwnXWr5Pm7AOpO5QFxKJ503nbMse/R79oO62zWg= go.mongodb.org/mongo-driver v1.7.5/go.mod h1:VXEWRZ6URJIkUq2SCAyapmhH0ZLRBP+FT4xhp5Zvxng= @@ -338,6 +366,8 @@ go.mongodb.org/mongo-driver v1.8.3/go.mod h1:0sQWfOeY63QTntERDJJ/0SuKK0T1uVSgKCu go.mongodb.org/mongo-driver v1.10.0/go.mod h1:wsihk0Kdgv8Kqu1Anit4sfK+22vSFbUrAVEYRhCXrA8= go.mongodb.org/mongo-driver v1.10.1 h1:NujsPveKwHaWuKUer/ceo9DzEe7HIj1SlJ6uvXZG0S4= go.mongodb.org/mongo-driver v1.10.1/go.mod h1:z4XpeoU6w+9Vht+jAFyLgVrD+jGSQQe0+CBWFHNiHt8= +go.mongodb.org/mongo-driver v1.11.0 h1:FZKhBSTydeuffHj9CBjXlR8vQLee1cQyTWYPA6/tqiE= +go.mongodb.org/mongo-driver v1.11.0/go.mod h1:s7p5vEtfbeR1gYi6pnj3c3/urpbLv2T5Sfd6Rp2HBB8= golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190219172222-a4c6cb3142f2/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= @@ -351,6 +381,8 @@ golang.org/x/crypto v0.0.0-20210421170649-83a5a9bb288b/go.mod h1:T9bdIzuCu7OtxOm golang.org/x/crypto v0.0.0-20210616213533-5ff15b29337e/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d h1:sK3txAijHtOK88l68nt020reeT1ZdKLIYetKl95FzVY= golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= +golang.org/x/crypto v0.2.0 h1:BRXPfhNivWL5Yq0BGQ39a2sW6t44aODpfxkWjYdzewE= +golang.org/x/crypto v0.2.0/go.mod h1:hebNnKkNXi2UzZN1eVRvBB7co0a+JxK6XbPiWVs/3J4= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180811021610-c39426892332/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20190108225652-1e06a53dbb7e/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -367,6 +399,8 @@ golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qx golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220822230855-b0a4917ee28c h1:JVAXQ10yGGVbSyoer5VILysz6YKjdNT2bsvlayjqhes= golang.org/x/net v0.0.0-20220822230855-b0a4917ee28c/go.mod h1:YDH+HFinaLZZlnHAfSS6ZXJJ9M9t4Dl22yv3iI2vPwk= +golang.org/x/net v0.2.0 h1:sZfSu1wtKLGlWI4ZZayP0ck9Y73K1ynO6gqzTdBVdPU= +golang.org/x/net v0.2.0/go.mod h1:KqCZLdyyvdV855qA2rE3GC2aiw5xGR5TEjj8smXukLY= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -402,10 +436,13 @@ golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220825204002-c680a09ffe64 h1:UiNENfZ8gDvpiWw7IpOMQ27spWmThO1RwwdQVbJahJM= golang.org/x/sys v0.0.0-20220825204002-c680a09ffe64/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.2.0 h1:ljd4t30dBnAvMZaQCevtY0xLLD0A+bRZXbgLMLU1F/A= +golang.org/x/sys v0.2.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211 h1:JGgROgKl9N8DuW20oFS5gxc+lE67/N3FcwmBPMe7ArY= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= +golang.org/x/term v0.2.0 h1:z85xZCsEl7bi/KwbNADeBYoOP0++7W1ipu+aGnpwzRM= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= @@ -413,6 +450,8 @@ golang.org/x/text v0.3.5/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7 h1:olpwvP2KacW1ZWvsR7uQhoyTYvKAupfQrRGBFM352Gk= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= +golang.org/x/text v0.4.0 h1:BrVqGRd7+k1DiOgtnFvAkoQEWQvBc25ouMJM6429SFg= +golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20190329151228-23e29df326fe/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= golang.org/x/tools v0.0.0-20190416151739-9c9e1878f421/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= @@ -426,8 +465,12 @@ google.golang.org/appengine v1.6.7 h1:FZR1q0exgwxzPzp/aF+VccGrSfxfPpkBqjIIEq3ru6 google.golang.org/appengine v1.6.7/go.mod h1:8WjMMxjGQR8xUklV/ARdw2HLXBOI7O7uCIDZVag1xfc= google.golang.org/genproto v0.0.0-20220822174746-9e6da59bd2fc h1:Nf+EdcTLHR8qDNN/KfkQL0u0ssxt9OhbaWCl5C0ucEI= google.golang.org/genproto v0.0.0-20220822174746-9e6da59bd2fc/go.mod h1:dbqgFATTzChvnt+ujMdZwITVAJHFtfyN1qUhDqEiIlk= +google.golang.org/genproto v0.0.0-20221114212237-e4508ebdbee1 h1:jCw9YRd2s40X9Vxi4zKsPRvSPlHWNqadVkpbMsCPzPQ= +google.golang.org/genproto v0.0.0-20221114212237-e4508ebdbee1/go.mod h1:rZS5c/ZVYMaOGBfO68GWtjOw/eLaZM1X6iVtgjZ+EWg= google.golang.org/grpc v1.49.0 h1:WTLtQzmQori5FUH25Pq4WT22oCsv8USpQ+F6rqtsmxw= google.golang.org/grpc v1.49.0/go.mod h1:ZgQEeidpAuNRZ8iRrlBKXZQP1ghovWIVhdJRyCDK+GI= +google.golang.org/grpc v1.50.1 h1:DS/BukOZWp8s6p4Dt/tOaJaTQyPyOoCcrjroHuCeLzY= +google.golang.org/grpc v1.50.1/go.mod h1:ZgQEeidpAuNRZ8iRrlBKXZQP1ghovWIVhdJRyCDK+GI= google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= google.golang.org/protobuf v1.28.1 h1:d0NfwRgPtno5B1Wa6L2DAG+KivqkdutMf1UhdNx175w= diff --git a/netbox/resource_netbox_ipam_aggregate_test.go b/netbox/resource_netbox_ipam_aggregate_test.go index fc486293e..aae1c80e1 100644 --- a/netbox/resource_netbox_ipam_aggregate_test.go +++ b/netbox/resource_netbox_ipam_aggregate_test.go @@ -98,6 +98,9 @@ func testAccCheckNetboxIPAMAggregateConfig(nameSuffix string, resourceFull, extr # name = "test-{{ .namesuffix }}" # slug = "test-{{ .namesuffix }}" #} + data "netbox_json_ipam_rirs_list" "json_rir" { + limit = 1 + } {{ if eq .extraresources "true" }} #resource "netbox_extras_tag" "test" { @@ -113,8 +116,8 @@ func testAccCheckNetboxIPAMAggregateConfig(nameSuffix string, resourceFull, extr resource "netbox_ipam_aggregate" "test" { prefix = "{{ .prefix }}" + rir_id = jsondecode(data.netbox_json_ipam_rirs_list.json_rir.json)[0].id #rir_id = netbox_ipam_rir.test.id - rir_id = 39 {{ if eq .resourcefull "true" }} tenant_id = netbox_tenancy_tenant.test.id diff --git a/netbox/resource_netbox_virtualization_vm_test.go b/netbox/resource_netbox_virtualization_vm_test.go index 03241016a..58fa88efd 100644 --- a/netbox/resource_netbox_virtualization_vm_test.go +++ b/netbox/resource_netbox_virtualization_vm_test.go @@ -100,12 +100,18 @@ func testAccCheckNetboxVirtualizationVMConfig(nameSuffix string, resourceFull, e # name = "test-{{ .namesuffix }}" # type_id = netbox_virtualization_cluster_type.test.id #} + data "netbox_virtualization_cluster" "cluster_test" { + name = "test" + } {{ if eq .extraresources "true" }} #resource "netbox_dcim_platform" "test" { # name = "test-{{ .namesuffix }}" # slug = "test-{{ .namesuffix }}" #} + data "netbox_dcim_platform" "platform_test" { + slug = "Debian_10" + } #resource "netbox_dcim_device_role" "test" { # name = "test-{{ .namesuffix }}" @@ -126,12 +132,13 @@ func testAccCheckNetboxVirtualizationVMConfig(nameSuffix string, resourceFull, e resource "netbox_virtualization_vm" "test" { name = "test-{{ .namesuffix }}" #cluster_id = netbox_virtualization_cluster.test.id - cluster_id = 30 + cluster_id = data.netbox_virtualization_cluster.cluster_test.id {{ if eq .resourcefull "true" }} comments = "VM created by terraform" #role_id = netbox_dcim_device_role.test.id #platform_id = netbox_dcim_platform.test.id + platform_id = data.netbox_dcim_platform.platform_test.id tenant_id = netbox_tenancy_tenant.test.id status = "planned" vcpus = 2 @@ -149,6 +156,10 @@ func testAccCheckNetboxVirtualizationVMConfig(nameSuffix string, resourceFull, e # name = netbox_extras_tag.test.name # slug = netbox_extras_tag.test.slug #} + tag { + name = "tag1" + slug = "tag1" + } {{ end }} } ` diff --git a/vendor/github.com/go-openapi/runtime/client/response.go b/vendor/github.com/go-openapi/runtime/client/response.go index b297a12ff..0bbd388bc 100644 --- a/vendor/github.com/go-openapi/runtime/client/response.go +++ b/vendor/github.com/go-openapi/runtime/client/response.go @@ -23,6 +23,8 @@ import ( var _ runtime.ClientResponse = response{} +func newResponse(resp *http.Response) runtime.ClientResponse { return response{resp: resp} } + type response struct { resp *http.Response } diff --git a/vendor/github.com/go-openapi/runtime/client/runtime.go b/vendor/github.com/go-openapi/runtime/client/runtime.go index ec86793db..611925aed 100644 --- a/vendor/github.com/go-openapi/runtime/client/runtime.go +++ b/vendor/github.com/go-openapi/runtime/client/runtime.go @@ -225,7 +225,7 @@ type Runtime struct { Transport http.RoundTripper Jar http.CookieJar - //Spec *spec.Document + // Spec *spec.Document Host string BasePath string Formats strfmt.Registry @@ -237,6 +237,7 @@ type Runtime struct { clientOnce *sync.Once client *http.Client schemes []string + response ClientResponseFunc } // New creates a new default runtime for a swagger api runtime.Client @@ -275,6 +276,7 @@ func New(host, basePath string, schemes []string) *Runtime { rt.Debug = logger.DebugEnabled() rt.logger = logger.StandardLogger{} + rt.response = newResponse if len(schemes) > 0 { rt.schemes = schemes @@ -329,6 +331,7 @@ func (r *Runtime) selectScheme(schemes []string) string { } return scheme } + func transportOrDefault(left, right http.RoundTripper) http.RoundTripper { if left == nil { return right @@ -381,7 +384,7 @@ func (r *Runtime) createHttpRequest(operation *runtime.ClientOperation) (*reques return r.DefaultAuthentication.AuthenticateRequest(req, reg) }) } - //if auth != nil { + // if auth != nil { // if err := auth.AuthenticateRequest(request, r.Formats); err != nil { // return nil, err // } @@ -500,7 +503,7 @@ func (r *Runtime) Submit(operation *runtime.ClientOperation) (interface{}, error return nil, fmt.Errorf("no consumer: %q", ct) } } - return readResponse.ReadResponse(response{res}, cons) + return readResponse.ReadResponse(r.response(res), cons) } // SetDebug changes the debug flag. @@ -516,3 +519,13 @@ func (r *Runtime) SetLogger(logger logger.Logger) { r.logger = logger middleware.Logger = logger } + +type ClientResponseFunc = func(*http.Response) runtime.ClientResponse + +// SetResponseReader changes the response reader implementation. +func (r *Runtime) SetResponseReader(f ClientResponseFunc) { + if f == nil { + return + } + r.response = f +} diff --git a/vendor/github.com/go-openapi/runtime/middleware/context.go b/vendor/github.com/go-openapi/runtime/middleware/context.go index 250e35fb0..0aa184c75 100644 --- a/vendor/github.com/go-openapi/runtime/middleware/context.go +++ b/vendor/github.com/go-openapi/runtime/middleware/context.go @@ -498,7 +498,9 @@ func (c *Context) Respond(rw http.ResponseWriter, r *http.Request, produces []st if resp, ok := data.(Responder); ok { producers := route.Producers - prod, ok := producers[format] + // producers contains keys with normalized format, if a format has MIME type parameter such as `text/plain; charset=utf-8` + // then you must provide `text/plain` to get the correct producer. HOWEVER, format here is not normalized. + prod, ok := producers[normalizeOffer(format)] if !ok { prods := c.api.ProducersFor(normalizeOffers([]string{c.api.DefaultProduces()})) pr, ok := prods[c.api.DefaultProduces()] diff --git a/vendor/github.com/go-openapi/runtime/middleware/parameter.go b/vendor/github.com/go-openapi/runtime/middleware/parameter.go index 8fa0cf4e4..9aaf65958 100644 --- a/vendor/github.com/go-openapi/runtime/middleware/parameter.go +++ b/vendor/github.com/go-openapi/runtime/middleware/parameter.go @@ -206,7 +206,11 @@ func (p *untypedParamBinder) Bind(request *http.Request, routeParams RouteParams if p.parameter.Type == "file" { file, header, ffErr := request.FormFile(p.parameter.Name) if ffErr != nil { - return errors.NewParseError(p.Name, p.parameter.In, "", ffErr) + if p.parameter.Required { + return errors.NewParseError(p.Name, p.parameter.In, "", ffErr) + } else { + return nil + } } target.Set(reflect.ValueOf(runtime.File{Data: file, Header: header})) return nil diff --git a/vendor/github.com/google/go-cmp/cmp/compare.go b/vendor/github.com/google/go-cmp/cmp/compare.go index fd2b3a42b..087320da7 100644 --- a/vendor/github.com/google/go-cmp/cmp/compare.go +++ b/vendor/github.com/google/go-cmp/cmp/compare.go @@ -13,21 +13,21 @@ // // The primary features of cmp are: // -// • When the default behavior of equality does not suit the needs of the test, -// custom equality functions can override the equality operation. -// For example, an equality function may report floats as equal so long as they -// are within some tolerance of each other. +// - When the default behavior of equality does not suit the test's needs, +// custom equality functions can override the equality operation. +// For example, an equality function may report floats as equal so long as +// they are within some tolerance of each other. // -// • Types that have an Equal method may use that method to determine equality. -// This allows package authors to determine the equality operation for the types -// that they define. +// - Types with an Equal method may use that method to determine equality. +// This allows package authors to determine the equality operation +// for the types that they define. // -// • If no custom equality functions are used and no Equal method is defined, -// equality is determined by recursively comparing the primitive kinds on both -// values, much like reflect.DeepEqual. Unlike reflect.DeepEqual, unexported -// fields are not compared by default; they result in panics unless suppressed -// by using an Ignore option (see cmpopts.IgnoreUnexported) or explicitly -// compared using the Exporter option. +// - If no custom equality functions are used and no Equal method is defined, +// equality is determined by recursively comparing the primitive kinds on +// both values, much like reflect.DeepEqual. Unlike reflect.DeepEqual, +// unexported fields are not compared by default; they result in panics +// unless suppressed by using an Ignore option (see cmpopts.IgnoreUnexported) +// or explicitly compared using the Exporter option. package cmp import ( @@ -45,25 +45,25 @@ import ( // Equal reports whether x and y are equal by recursively applying the // following rules in the given order to x and y and all of their sub-values: // -// • Let S be the set of all Ignore, Transformer, and Comparer options that -// remain after applying all path filters, value filters, and type filters. -// If at least one Ignore exists in S, then the comparison is ignored. -// If the number of Transformer and Comparer options in S is greater than one, -// then Equal panics because it is ambiguous which option to use. -// If S contains a single Transformer, then use that to transform the current -// values and recursively call Equal on the output values. -// If S contains a single Comparer, then use that to compare the current values. -// Otherwise, evaluation proceeds to the next rule. +// - Let S be the set of all Ignore, Transformer, and Comparer options that +// remain after applying all path filters, value filters, and type filters. +// If at least one Ignore exists in S, then the comparison is ignored. +// If the number of Transformer and Comparer options in S is non-zero, +// then Equal panics because it is ambiguous which option to use. +// If S contains a single Transformer, then use that to transform +// the current values and recursively call Equal on the output values. +// If S contains a single Comparer, then use that to compare the current values. +// Otherwise, evaluation proceeds to the next rule. // -// • If the values have an Equal method of the form "(T) Equal(T) bool" or -// "(T) Equal(I) bool" where T is assignable to I, then use the result of -// x.Equal(y) even if x or y is nil. Otherwise, no such method exists and -// evaluation proceeds to the next rule. +// - If the values have an Equal method of the form "(T) Equal(T) bool" or +// "(T) Equal(I) bool" where T is assignable to I, then use the result of +// x.Equal(y) even if x or y is nil. Otherwise, no such method exists and +// evaluation proceeds to the next rule. // -// • Lastly, try to compare x and y based on their basic kinds. -// Simple kinds like booleans, integers, floats, complex numbers, strings, and -// channels are compared using the equivalent of the == operator in Go. -// Functions are only equal if they are both nil, otherwise they are unequal. +// - Lastly, try to compare x and y based on their basic kinds. +// Simple kinds like booleans, integers, floats, complex numbers, strings, +// and channels are compared using the equivalent of the == operator in Go. +// Functions are only equal if they are both nil, otherwise they are unequal. // // Structs are equal if recursively calling Equal on all fields report equal. // If a struct contains unexported fields, Equal panics unless an Ignore option @@ -144,7 +144,7 @@ func rootStep(x, y interface{}) PathStep { // so that they have the same parent type. var t reflect.Type if !vx.IsValid() || !vy.IsValid() || vx.Type() != vy.Type() { - t = reflect.TypeOf((*interface{})(nil)).Elem() + t = anyType if vx.IsValid() { vvx := reflect.New(t).Elem() vvx.Set(vx) @@ -639,7 +639,9 @@ type dynChecker struct{ curr, next int } // Next increments the state and reports whether a check should be performed. // // Checks occur every Nth function call, where N is a triangular number: +// // 0 1 3 6 10 15 21 28 36 45 55 66 78 91 105 120 136 153 171 190 ... +// // See https://en.wikipedia.org/wiki/Triangular_number // // This sequence ensures that the cost of checks drops significantly as diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go index bc196b16c..a248e5436 100644 --- a/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go @@ -127,9 +127,9 @@ var randBool = rand.New(rand.NewSource(time.Now().Unix())).Intn(2) == 0 // This function returns an edit-script, which is a sequence of operations // needed to convert one list into the other. The following invariants for // the edit-script are maintained: -// • eq == (es.Dist()==0) -// • nx == es.LenX() -// • ny == es.LenY() +// - eq == (es.Dist()==0) +// - nx == es.LenX() +// - ny == es.LenY() // // This algorithm is not guaranteed to be an optimal solution (i.e., one that // produces an edit-script with a minimal Levenshtein distance). This algorithm @@ -169,12 +169,13 @@ func Difference(nx, ny int, f EqualFunc) (es EditScript) { // A diagonal edge is equivalent to a matching symbol between both X and Y. // Invariants: - // • 0 ≤ fwdPath.X ≤ (fwdFrontier.X, revFrontier.X) ≤ revPath.X ≤ nx - // • 0 ≤ fwdPath.Y ≤ (fwdFrontier.Y, revFrontier.Y) ≤ revPath.Y ≤ ny + // - 0 ≤ fwdPath.X ≤ (fwdFrontier.X, revFrontier.X) ≤ revPath.X ≤ nx + // - 0 ≤ fwdPath.Y ≤ (fwdFrontier.Y, revFrontier.Y) ≤ revPath.Y ≤ ny // // In general: - // • fwdFrontier.X < revFrontier.X - // • fwdFrontier.Y < revFrontier.Y + // - fwdFrontier.X < revFrontier.X + // - fwdFrontier.Y < revFrontier.Y + // // Unless, it is time for the algorithm to terminate. fwdPath := path{+1, point{0, 0}, make(EditScript, 0, (nx+ny)/2)} revPath := path{-1, point{nx, ny}, make(EditScript, 0)} @@ -195,19 +196,21 @@ func Difference(nx, ny int, f EqualFunc) (es EditScript) { // computing sub-optimal edit-scripts between two lists. // // The algorithm is approximately as follows: - // • Searching for differences switches back-and-forth between - // a search that starts at the beginning (the top-left corner), and - // a search that starts at the end (the bottom-right corner). The goal of - // the search is connect with the search from the opposite corner. - // • As we search, we build a path in a greedy manner, where the first - // match seen is added to the path (this is sub-optimal, but provides a - // decent result in practice). When matches are found, we try the next pair - // of symbols in the lists and follow all matches as far as possible. - // • When searching for matches, we search along a diagonal going through - // through the "frontier" point. If no matches are found, we advance the - // frontier towards the opposite corner. - // • This algorithm terminates when either the X coordinates or the - // Y coordinates of the forward and reverse frontier points ever intersect. + // - Searching for differences switches back-and-forth between + // a search that starts at the beginning (the top-left corner), and + // a search that starts at the end (the bottom-right corner). + // The goal of the search is connect with the search + // from the opposite corner. + // - As we search, we build a path in a greedy manner, + // where the first match seen is added to the path (this is sub-optimal, + // but provides a decent result in practice). When matches are found, + // we try the next pair of symbols in the lists and follow all matches + // as far as possible. + // - When searching for matches, we search along a diagonal going through + // through the "frontier" point. If no matches are found, + // we advance the frontier towards the opposite corner. + // - This algorithm terminates when either the X coordinates or the + // Y coordinates of the forward and reverse frontier points ever intersect. // This algorithm is correct even if searching only in the forward direction // or in the reverse direction. We do both because it is commonly observed @@ -389,6 +392,7 @@ type point struct{ X, Y int } func (p *point) add(dx, dy int) { p.X += dx; p.Y += dy } // zigzag maps a consecutive sequence of integers to a zig-zag sequence. +// // [0 1 2 3 4 5 ...] => [0 -1 +1 -2 +2 ...] func zigzag(x int) int { if x&1 != 0 { diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/zero.go b/vendor/github.com/google/go-cmp/cmp/internal/value/zero.go deleted file mode 100644 index 9147a2997..000000000 --- a/vendor/github.com/google/go-cmp/cmp/internal/value/zero.go +++ /dev/null @@ -1,48 +0,0 @@ -// Copyright 2017, The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package value - -import ( - "math" - "reflect" -) - -// IsZero reports whether v is the zero value. -// This does not rely on Interface and so can be used on unexported fields. -func IsZero(v reflect.Value) bool { - switch v.Kind() { - case reflect.Bool: - return v.Bool() == false - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - return v.Int() == 0 - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - return v.Uint() == 0 - case reflect.Float32, reflect.Float64: - return math.Float64bits(v.Float()) == 0 - case reflect.Complex64, reflect.Complex128: - return math.Float64bits(real(v.Complex())) == 0 && math.Float64bits(imag(v.Complex())) == 0 - case reflect.String: - return v.String() == "" - case reflect.UnsafePointer: - return v.Pointer() == 0 - case reflect.Chan, reflect.Func, reflect.Interface, reflect.Ptr, reflect.Map, reflect.Slice: - return v.IsNil() - case reflect.Array: - for i := 0; i < v.Len(); i++ { - if !IsZero(v.Index(i)) { - return false - } - } - return true - case reflect.Struct: - for i := 0; i < v.NumField(); i++ { - if !IsZero(v.Field(i)) { - return false - } - } - return true - } - return false -} diff --git a/vendor/github.com/google/go-cmp/cmp/options.go b/vendor/github.com/google/go-cmp/cmp/options.go index e57b9eb53..1f9ca9c48 100644 --- a/vendor/github.com/google/go-cmp/cmp/options.go +++ b/vendor/github.com/google/go-cmp/cmp/options.go @@ -33,6 +33,7 @@ type Option interface { } // applicableOption represents the following types: +// // Fundamental: ignore | validator | *comparer | *transformer // Grouping: Options type applicableOption interface { @@ -43,6 +44,7 @@ type applicableOption interface { } // coreOption represents the following types: +// // Fundamental: ignore | validator | *comparer | *transformer // Filters: *pathFilter | *valuesFilter type coreOption interface { @@ -336,9 +338,9 @@ func (tr transformer) String() string { // both implement T. // // The equality function must be: -// • Symmetric: equal(x, y) == equal(y, x) -// • Deterministic: equal(x, y) == equal(x, y) -// • Pure: equal(x, y) does not modify x or y +// - Symmetric: equal(x, y) == equal(y, x) +// - Deterministic: equal(x, y) == equal(x, y) +// - Pure: equal(x, y) does not modify x or y func Comparer(f interface{}) Option { v := reflect.ValueOf(f) if !function.IsType(v.Type(), function.Equal) || v.IsNil() { @@ -430,7 +432,7 @@ func AllowUnexported(types ...interface{}) Option { } // Result represents the comparison result for a single node and -// is provided by cmp when calling Result (see Reporter). +// is provided by cmp when calling Report (see Reporter). type Result struct { _ [0]func() // Make Result incomparable flags resultFlags diff --git a/vendor/github.com/google/go-cmp/cmp/path.go b/vendor/github.com/google/go-cmp/cmp/path.go index c71003463..a0a588502 100644 --- a/vendor/github.com/google/go-cmp/cmp/path.go +++ b/vendor/github.com/google/go-cmp/cmp/path.go @@ -41,13 +41,13 @@ type PathStep interface { // The type of each valid value is guaranteed to be identical to Type. // // In some cases, one or both may be invalid or have restrictions: - // • For StructField, both are not interface-able if the current field - // is unexported and the struct type is not explicitly permitted by - // an Exporter to traverse unexported fields. - // • For SliceIndex, one may be invalid if an element is missing from - // either the x or y slice. - // • For MapIndex, one may be invalid if an entry is missing from - // either the x or y map. + // - For StructField, both are not interface-able if the current field + // is unexported and the struct type is not explicitly permitted by + // an Exporter to traverse unexported fields. + // - For SliceIndex, one may be invalid if an element is missing from + // either the x or y slice. + // - For MapIndex, one may be invalid if an entry is missing from + // either the x or y map. // // The provided values must not be mutated. Values() (vx, vy reflect.Value) @@ -94,6 +94,7 @@ func (pa Path) Index(i int) PathStep { // The simplified path only contains struct field accesses. // // For example: +// // MyMap.MySlices.MyField func (pa Path) String() string { var ss []string @@ -108,6 +109,7 @@ func (pa Path) String() string { // GoString returns the path to a specific node using Go syntax. // // For example: +// // (*root.MyMap["key"].(*mypkg.MyStruct).MySlices)[2][3].MyField func (pa Path) GoString() string { var ssPre, ssPost []string @@ -159,7 +161,7 @@ func (ps pathStep) String() string { if ps.typ == nil { return "" } - s := ps.typ.String() + s := value.TypeString(ps.typ, false) if s == "" || strings.ContainsAny(s, "{}\n") { return "root" // Type too simple or complex to print } @@ -282,7 +284,7 @@ type typeAssertion struct { func (ta TypeAssertion) Type() reflect.Type { return ta.typ } func (ta TypeAssertion) Values() (vx, vy reflect.Value) { return ta.vx, ta.vy } -func (ta TypeAssertion) String() string { return fmt.Sprintf(".(%v)", ta.typ) } +func (ta TypeAssertion) String() string { return fmt.Sprintf(".(%v)", value.TypeString(ta.typ, false)) } // Transform is a transformation from the parent type to the current type. type Transform struct{ *transform } diff --git a/vendor/github.com/google/go-cmp/cmp/report_compare.go b/vendor/github.com/google/go-cmp/cmp/report_compare.go index 1ef65ac1d..2050bf6b4 100644 --- a/vendor/github.com/google/go-cmp/cmp/report_compare.go +++ b/vendor/github.com/google/go-cmp/cmp/report_compare.go @@ -7,8 +7,6 @@ package cmp import ( "fmt" "reflect" - - "github.com/google/go-cmp/cmp/internal/value" ) // numContextRecords is the number of surrounding equal records to print. @@ -117,7 +115,7 @@ func (opts formatOptions) FormatDiff(v *valueNode, ptrs *pointerReferences) (out // For leaf nodes, format the value based on the reflect.Values alone. // As a special case, treat equal []byte as a leaf nodes. - isBytes := v.Type.Kind() == reflect.Slice && v.Type.Elem() == reflect.TypeOf(byte(0)) + isBytes := v.Type.Kind() == reflect.Slice && v.Type.Elem() == byteType isEqualBytes := isBytes && v.NumDiff+v.NumIgnored+v.NumTransformed == 0 if v.MaxDepth == 0 || isEqualBytes { switch opts.DiffMode { @@ -248,11 +246,11 @@ func (opts formatOptions) formatDiffList(recs []reportRecord, k reflect.Kind, pt var isZero bool switch opts.DiffMode { case diffIdentical: - isZero = value.IsZero(r.Value.ValueX) || value.IsZero(r.Value.ValueY) + isZero = r.Value.ValueX.IsZero() || r.Value.ValueY.IsZero() case diffRemoved: - isZero = value.IsZero(r.Value.ValueX) + isZero = r.Value.ValueX.IsZero() case diffInserted: - isZero = value.IsZero(r.Value.ValueY) + isZero = r.Value.ValueY.IsZero() } if isZero { continue diff --git a/vendor/github.com/google/go-cmp/cmp/report_reflect.go b/vendor/github.com/google/go-cmp/cmp/report_reflect.go index 287b89358..2ab41fad3 100644 --- a/vendor/github.com/google/go-cmp/cmp/report_reflect.go +++ b/vendor/github.com/google/go-cmp/cmp/report_reflect.go @@ -16,6 +16,13 @@ import ( "github.com/google/go-cmp/cmp/internal/value" ) +var ( + anyType = reflect.TypeOf((*interface{})(nil)).Elem() + stringType = reflect.TypeOf((*string)(nil)).Elem() + bytesType = reflect.TypeOf((*[]byte)(nil)).Elem() + byteType = reflect.TypeOf((*byte)(nil)).Elem() +) + type formatValueOptions struct { // AvoidStringer controls whether to avoid calling custom stringer // methods like error.Error or fmt.Stringer.String. @@ -184,7 +191,7 @@ func (opts formatOptions) FormatValue(v reflect.Value, parentKind reflect.Kind, } for i := 0; i < v.NumField(); i++ { vv := v.Field(i) - if value.IsZero(vv) { + if vv.IsZero() { continue // Elide fields with zero values } if len(list) == maxLen { @@ -205,7 +212,7 @@ func (opts formatOptions) FormatValue(v reflect.Value, parentKind reflect.Kind, } // Check whether this is a []byte of text data. - if t.Elem() == reflect.TypeOf(byte(0)) { + if t.Elem() == byteType { b := v.Bytes() isPrintSpace := func(r rune) bool { return unicode.IsPrint(r) || unicode.IsSpace(r) } if len(b) > 0 && utf8.Valid(b) && len(bytes.TrimFunc(b, isPrintSpace)) == 0 { diff --git a/vendor/github.com/google/go-cmp/cmp/report_slices.go b/vendor/github.com/google/go-cmp/cmp/report_slices.go index 68b5c1ae1..23e444f62 100644 --- a/vendor/github.com/google/go-cmp/cmp/report_slices.go +++ b/vendor/github.com/google/go-cmp/cmp/report_slices.go @@ -104,7 +104,7 @@ func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { case t.Kind() == reflect.String: sx, sy = vx.String(), vy.String() isString = true - case t.Kind() == reflect.Slice && t.Elem() == reflect.TypeOf(byte(0)): + case t.Kind() == reflect.Slice && t.Elem() == byteType: sx, sy = string(vx.Bytes()), string(vy.Bytes()) isString = true case t.Kind() == reflect.Array: @@ -147,7 +147,10 @@ func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { }) efficiencyLines := float64(esLines.Dist()) / float64(len(esLines)) efficiencyBytes := float64(esBytes.Dist()) / float64(len(esBytes)) - isPureLinedText = efficiencyLines < 4*efficiencyBytes + quotedLength := len(strconv.Quote(sx + sy)) + unquotedLength := len(sx) + len(sy) + escapeExpansionRatio := float64(quotedLength) / float64(unquotedLength) + isPureLinedText = efficiencyLines < 4*efficiencyBytes || escapeExpansionRatio > 1.1 } } @@ -171,12 +174,13 @@ func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { // differences in a string literal. This format is more readable, // but has edge-cases where differences are visually indistinguishable. // This format is avoided under the following conditions: - // • A line starts with `"""` - // • A line starts with "..." - // • A line contains non-printable characters - // • Adjacent different lines differ only by whitespace + // - A line starts with `"""` + // - A line starts with "..." + // - A line contains non-printable characters + // - Adjacent different lines differ only by whitespace // // For example: + // // """ // ... // 3 identical lines // foo @@ -231,7 +235,7 @@ func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { var out textNode = &textWrap{Prefix: "(", Value: list2, Suffix: ")"} switch t.Kind() { case reflect.String: - if t != reflect.TypeOf(string("")) { + if t != stringType { out = opts.FormatType(t, out) } case reflect.Slice: @@ -326,12 +330,12 @@ func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { switch t.Kind() { case reflect.String: out = &textWrap{Prefix: "strings.Join(", Value: out, Suffix: fmt.Sprintf(", %q)", delim)} - if t != reflect.TypeOf(string("")) { + if t != stringType { out = opts.FormatType(t, out) } case reflect.Slice: out = &textWrap{Prefix: "bytes.Join(", Value: out, Suffix: fmt.Sprintf(", %q)", delim)} - if t != reflect.TypeOf([]byte(nil)) { + if t != bytesType { out = opts.FormatType(t, out) } } @@ -446,7 +450,6 @@ func (opts formatOptions) formatDiffSlice( // {NumIdentical: 3}, // {NumInserted: 1}, // ] -// func coalesceAdjacentEdits(name string, es diff.EditScript) (groups []diffStats) { var prevMode byte lastStats := func(mode byte) *diffStats { @@ -503,7 +506,6 @@ func coalesceAdjacentEdits(name string, es diff.EditScript) (groups []diffStats) // {NumIdentical: 8, NumRemoved: 12, NumInserted: 3}, // {NumIdentical: 63}, // ] -// func coalesceInterveningIdentical(groups []diffStats, windowSize int) []diffStats { groups, groupsOrig := groups[:0], groups for i, ds := range groupsOrig { @@ -548,7 +550,6 @@ func coalesceInterveningIdentical(groups []diffStats, windowSize int) []diffStat // {NumRemoved: 9}, // {NumIdentical: 64}, // incremented by 10 // ] -// func cleanupSurroundingIdentical(groups []diffStats, eq func(i, j int) bool) []diffStats { var ix, iy int // indexes into sequence x and y for i, ds := range groups { diff --git a/vendor/github.com/google/go-cmp/cmp/report_text.go b/vendor/github.com/google/go-cmp/cmp/report_text.go index 0fd46d7ff..388fcf571 100644 --- a/vendor/github.com/google/go-cmp/cmp/report_text.go +++ b/vendor/github.com/google/go-cmp/cmp/report_text.go @@ -393,6 +393,7 @@ func (s diffStats) Append(ds diffStats) diffStats { // String prints a humanly-readable summary of coalesced records. // // Example: +// // diffStats{Name: "Field", NumIgnored: 5}.String() => "5 ignored fields" func (s diffStats) String() string { var ss []string diff --git a/vendor/github.com/hashicorp/go-hclog/intlogger.go b/vendor/github.com/hashicorp/go-hclog/intlogger.go index e2ebdb01a..e4cd8eddc 100644 --- a/vendor/github.com/hashicorp/go-hclog/intlogger.go +++ b/vendor/github.com/hashicorp/go-hclog/intlogger.go @@ -17,6 +17,8 @@ import ( "sync" "sync/atomic" "time" + "unicode" + "unicode/utf8" "github.com/fatih/color" ) @@ -48,6 +50,12 @@ var ( Warn: color.New(color.FgHiYellow), Error: color.New(color.FgHiRed), } + + faintBoldColor = color.New(color.Faint, color.Bold) + faintColor = color.New(color.Faint) + faintMultiLinePrefix = faintColor.Sprint(" | ") + faintFieldSeparator = faintColor.Sprint("=") + faintFieldSeparatorWithNewLine = faintColor.Sprint("=\n") ) // Make sure that intLogger is a Logger @@ -70,6 +78,7 @@ type intLogger struct { level *int32 headerColor ColorOption + fieldColor ColorOption implied []interface{} @@ -115,14 +124,19 @@ func newLogger(opts *LoggerOptions) *intLogger { mutex = new(sync.Mutex) } - var primaryColor, headerColor ColorOption - - if opts.ColorHeaderOnly { - primaryColor = ColorOff + var ( + primaryColor ColorOption = ColorOff + headerColor ColorOption = ColorOff + fieldColor ColorOption = ColorOff + ) + switch { + case opts.ColorHeaderOnly: headerColor = opts.Color - } else { + case opts.ColorHeaderAndFields: + fieldColor = opts.Color + headerColor = opts.Color + default: primaryColor = opts.Color - headerColor = ColorOff } l := &intLogger{ @@ -137,6 +151,7 @@ func newLogger(opts *LoggerOptions) *intLogger { exclude: opts.Exclude, independentLevels: opts.IndependentLevels, headerColor: headerColor, + fieldColor: fieldColor, } if opts.IncludeLocation { l.callerOffset = offsetIntLogger + opts.AdditionalLocationOffset @@ -235,7 +250,18 @@ func needsQuoting(str string) bool { return false } -// Non-JSON logging format function +// logPlain is the non-JSON logging format function which writes directly +// to the underlying writer the logger was initialized with. +// +// If the logger was initialized with a color function, it also handles +// applying the color to the log message. +// +// Color Options +// 1. No color. +// 2. Color the whole log line, based on the level. +// 3. Color only the header (level) part of the log line. +// 4. Color both the header and fields of the log line. +// func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, args ...interface{}) { if !l.disableTime { @@ -281,7 +307,7 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, var stacktrace CapturedStacktrace - if args != nil && len(args) > 0 { + if len(args) > 0 { if len(args)%2 != 0 { cs, ok := args[len(args)-1].(CapturedStacktrace) if ok { @@ -295,13 +321,16 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, l.writer.WriteByte(':') + // Handle the field arguments, which come in pairs (key=val). FOR: for i := 0; i < len(args); i = i + 2 { var ( + key string val string raw bool ) + // Convert the field value to a string. switch st := args[i+1].(type) { case string: val = st @@ -353,8 +382,7 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, } } - var key string - + // Convert the field key to a string. switch st := args[i].(type) { case string: key = st @@ -362,21 +390,49 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, key = fmt.Sprintf("%s", st) } + // Optionally apply the ANSI "faint" and "bold" + // SGR values to the key. + if l.fieldColor != ColorOff { + key = faintBoldColor.Sprint(key) + } + + // Values may contain multiple lines, and that format + // is preserved, with each line prefixed with a " | " + // to show it's part of a collection of lines. + // + // Values may also need quoting, if not all the runes + // in the value string are "normal", like if they + // contain ANSI escape sequences. if strings.Contains(val, "\n") { l.writer.WriteString("\n ") l.writer.WriteString(key) - l.writer.WriteString("=\n") - writeIndent(l.writer, val, " | ") + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparatorWithNewLine) + writeIndent(l.writer, val, faintMultiLinePrefix) + } else { + l.writer.WriteString("=\n") + writeIndent(l.writer, val, " | ") + } l.writer.WriteString(" ") } else if !raw && needsQuoting(val) { l.writer.WriteByte(' ') l.writer.WriteString(key) - l.writer.WriteByte('=') - l.writer.WriteString(strconv.Quote(val)) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparator) + } else { + l.writer.WriteByte('=') + } + l.writer.WriteByte('"') + writeEscapedForOutput(l.writer, val, true) + l.writer.WriteByte('"') } else { l.writer.WriteByte(' ') l.writer.WriteString(key) - l.writer.WriteByte('=') + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparator) + } else { + l.writer.WriteByte('=') + } l.writer.WriteString(val) } } @@ -396,19 +452,98 @@ func writeIndent(w *writer, str string, indent string) { if nl == -1 { if str != "" { w.WriteString(indent) - w.WriteString(str) + writeEscapedForOutput(w, str, false) w.WriteString("\n") } return } w.WriteString(indent) - w.WriteString(str[:nl]) + writeEscapedForOutput(w, str[:nl], false) w.WriteString("\n") str = str[nl+1:] } } +func needsEscaping(str string) bool { + for _, b := range str { + if !unicode.IsPrint(b) || b == '"' { + return true + } + } + + return false +} + +const ( + lowerhex = "0123456789abcdef" +) + +var bufPool = sync.Pool{ + New: func() interface{} { + return new(bytes.Buffer) + }, +} + +func writeEscapedForOutput(w io.Writer, str string, escapeQuotes bool) { + if !needsEscaping(str) { + w.Write([]byte(str)) + return + } + + bb := bufPool.Get().(*bytes.Buffer) + bb.Reset() + + defer bufPool.Put(bb) + + for _, r := range str { + if escapeQuotes && r == '"' { + bb.WriteString(`\"`) + } else if unicode.IsPrint(r) { + bb.WriteRune(r) + } else { + switch r { + case '\a': + bb.WriteString(`\a`) + case '\b': + bb.WriteString(`\b`) + case '\f': + bb.WriteString(`\f`) + case '\n': + bb.WriteString(`\n`) + case '\r': + bb.WriteString(`\r`) + case '\t': + bb.WriteString(`\t`) + case '\v': + bb.WriteString(`\v`) + default: + switch { + case r < ' ': + bb.WriteString(`\x`) + bb.WriteByte(lowerhex[byte(r)>>4]) + bb.WriteByte(lowerhex[byte(r)&0xF]) + case !utf8.ValidRune(r): + r = 0xFFFD + fallthrough + case r < 0x10000: + bb.WriteString(`\u`) + for s := 12; s >= 0; s -= 4 { + bb.WriteByte(lowerhex[r>>uint(s)&0xF]) + } + default: + bb.WriteString(`\U`) + for s := 28; s >= 0; s -= 4 { + bb.WriteByte(lowerhex[r>>uint(s)&0xF]) + } + } + } + } + } + + w.Write(bb.Bytes()) +} + func (l *intLogger) renderSlice(v reflect.Value) string { var buf bytes.Buffer diff --git a/vendor/github.com/hashicorp/go-hclog/logger.go b/vendor/github.com/hashicorp/go-hclog/logger.go index f37187401..50dee8220 100644 --- a/vendor/github.com/hashicorp/go-hclog/logger.go +++ b/vendor/github.com/hashicorp/go-hclog/logger.go @@ -274,6 +274,10 @@ type LoggerOptions struct { // Only color the header, not the body. This can help with readability of long messages. ColorHeaderOnly bool + // Color the header and message body fields. This can help with readability + // of long messages with multiple fields. + ColorHeaderAndFields bool + // A function which is called with the log information and if it returns true the value // should not be logged. // This is useful when interacting with a system that you wish to suppress the log diff --git a/vendor/github.com/hashicorp/go-plugin/CHANGELOG.md b/vendor/github.com/hashicorp/go-plugin/CHANGELOG.md index 7463b2c0f..834196288 100644 --- a/vendor/github.com/hashicorp/go-plugin/CHANGELOG.md +++ b/vendor/github.com/hashicorp/go-plugin/CHANGELOG.md @@ -1,3 +1,9 @@ +## v1.4.6 + +BUG FIXES: + +* server: Prevent gRPC broker goroutine leak when using `GRPCServer` type `GracefulStop()` or `Stop()` methods [[GH-220](https://github.com/hashicorp/go-plugin/pull/220)] + ## v1.4.5 ENHANCEMENTS: diff --git a/vendor/github.com/hashicorp/go-plugin/LICENSE b/vendor/github.com/hashicorp/go-plugin/LICENSE index 82b4de97c..042324fb7 100644 --- a/vendor/github.com/hashicorp/go-plugin/LICENSE +++ b/vendor/github.com/hashicorp/go-plugin/LICENSE @@ -1,3 +1,5 @@ +Copyright (c) 2016 HashiCorp, Inc. + Mozilla Public License, version 2.0 1. Definitions diff --git a/vendor/github.com/hashicorp/go-plugin/grpc_server.go b/vendor/github.com/hashicorp/go-plugin/grpc_server.go index 387628bf4..54b061cc3 100644 --- a/vendor/github.com/hashicorp/go-plugin/grpc_server.go +++ b/vendor/github.com/hashicorp/go-plugin/grpc_server.go @@ -107,14 +107,26 @@ func (s *GRPCServer) Init() error { return nil } -// Stop calls Stop on the underlying grpc.Server +// Stop calls Stop on the underlying grpc.Server and Close on the underlying +// grpc.Broker if present. func (s *GRPCServer) Stop() { s.server.Stop() + + if s.broker != nil { + s.broker.Close() + s.broker = nil + } } -// GracefulStop calls GracefulStop on the underlying grpc.Server +// GracefulStop calls GracefulStop on the underlying grpc.Server and Close on +// the underlying grpc.Broker if present. func (s *GRPCServer) GracefulStop() { s.server.GracefulStop() + + if s.broker != nil { + s.broker.Close() + s.broker = nil + } } // Config is the GRPCServerConfig encoded as JSON then base64. diff --git a/vendor/github.com/hashicorp/go-plugin/rpc_server.go b/vendor/github.com/hashicorp/go-plugin/rpc_server.go index 449ba6cc1..064809d29 100644 --- a/vendor/github.com/hashicorp/go-plugin/rpc_server.go +++ b/vendor/github.com/hashicorp/go-plugin/rpc_server.go @@ -42,6 +42,8 @@ func (s *RPCServer) Config() string { return "" } // ServerProtocol impl. func (s *RPCServer) Serve(lis net.Listener) { + defer s.done() + for { conn, err := lis.Accept() if err != nil { @@ -82,7 +84,7 @@ func (s *RPCServer) ServeConn(conn io.ReadWriteCloser) { // Connect the stdstreams (in, out, err) stdstream := make([]net.Conn, 2) - for i, _ := range stdstream { + for i := range stdstream { stdstream[i], err = mux.Accept() if err != nil { mux.Close() @@ -133,13 +135,15 @@ type controlServer struct { // Ping can be called to verify the connection (and likely the binary) // is still alive to a plugin. func (c *controlServer) Ping( - null bool, response *struct{}) error { + null bool, response *struct{}, +) error { *response = struct{}{} return nil } func (c *controlServer) Quit( - null bool, response *struct{}) error { + null bool, response *struct{}, +) error { // End the server c.server.done() @@ -156,7 +160,8 @@ type dispenseServer struct { } func (d *dispenseServer) Dispense( - name string, response *uint32) error { + name string, response *uint32, +) error { // Find the function to create this implementation p, ok := d.plugins[name] if !ok { diff --git a/vendor/github.com/hashicorp/hcl/v2/CHANGELOG.md b/vendor/github.com/hashicorp/hcl/v2/CHANGELOG.md index 9f6c23b1c..8bcfd834a 100644 --- a/vendor/github.com/hashicorp/hcl/v2/CHANGELOG.md +++ b/vendor/github.com/hashicorp/hcl/v2/CHANGELOG.md @@ -1,10 +1,35 @@ # HCL Changelog +## v2.15.0 (November 10, 2022) + +### Bugs Fixed + +* ext/typeexpr: Skip null objects when applying defaults. This prevents crashes when null objects are creating inside collections, and stops incomplete objects being created with only optional attributes set. ([#567](https://github.com/hashicorp/hcl/pull/567)) +* ext/typeexpr: Ensure default values do not have optional metadata attached. This prevents crashes when default values are inserted into concrete go-cty values that have also been stripped of their optional metadata. ([#568](https://github.com/hashicorp/hcl/pull/568)) + +### Enhancements + +* ext/typeexpr: With the [go-cty](https://github.com/zclconf/go-cty) upstream depenendency updated to v1.12.0, the `Defaults` struct and associated functions can apply additional and more flexible 'unsafe' conversions (examples include tuples into collections such as lists and sets, and additional safety around null and dynamic values). ([#564](https://github.com/hashicorp/hcl/pull/564)) +* ext/typeexpr: With the [go-cty](https://github.com/zclconf/go-cty) upstream depenendency updated to v1.12.0, users should now apply the go-cty convert functionality *before* setting defaults on a given `cty.Value`, rather than after, if they require a specific `cty.Type`. ([#564](https://github.com/hashicorp/hcl/pull/564)) + +## v2.14.1 (September 23, 2022) + +### Bugs Fixed + +* ext/typeexpr: Type convert defaults for optional object attributes when applying them. This prevents crashes in certain cases when the objects in question are part of a collection. ([#555](https://github.com/hashicorp/hcl/pull/555)) + +## v2.14.0 (September 1, 2022) + +### Enhancements + +* ext/typeexpr: Added support for optional object attributes to `TypeConstraint`. Attributes can be wrapped in the special `optional(…)` modifier, allowing the attribute to be omitted while still meeting the type constraint. For more information, [cty's documentation on conversion between object types](https://github.com/zclconf/go-cty/blob/main/docs/convert.md#conversion-between-object-types). ([#549](https://github.com/hashicorp/hcl/pull/549)) +* ext/typeexpr: New function: `TypeConstraintWithDefaults`. In this mode, the `optional(…)` modifier accepts a second argument which can be used as the default value for omitted object attributes. The function returns both a `cty.Type` and associated `Defaults`, the latter of which has an `Apply` method to apply defaults to a given value. ([#549](https://github.com/hashicorp/hcl/pull/549)) + ## v2.13.0 (June 22, 2022) ### Enhancements -* hcl: `hcl.Diagnostic` how has an additional field `Extra` which is intended for carrying arbitrary supporting data ("extra information") related to the diagnostic message, intended to allow diagnostic renderers to optionally tailor the presentation of messages for particular situations. ([#539](https://github.com/hashicorp/hcl/pull/539)) +* hcl: `hcl.Diagnostic` now has an additional field `Extra` which is intended for carrying arbitrary supporting data ("extra information") related to the diagnostic message, intended to allow diagnostic renderers to optionally tailor the presentation of messages for particular situations. ([#539](https://github.com/hashicorp/hcl/pull/539)) * hclsyntax: When an error occurs during a function call, the returned diagnostics will include _extra information_ (as described in the previous point) about which function was being called and, if the message is about an error returned by the function itself, that raw `error` value without any post-processing. ([#539](https://github.com/hashicorp/hcl/pull/539)) ### Bugs Fixed diff --git a/vendor/github.com/hashicorp/hcl/v2/hclsyntax/spec.md b/vendor/github.com/hashicorp/hcl/v2/hclsyntax/spec.md index 33c152daa..3201f54a7 100644 --- a/vendor/github.com/hashicorp/hcl/v2/hclsyntax/spec.md +++ b/vendor/github.com/hashicorp/hcl/v2/hclsyntax/spec.md @@ -84,7 +84,7 @@ Comments serve as program documentation and come in two forms: sequence, and may have any characters within except the ending sequence. An inline comments is considered equivalent to a whitespace sequence. -Comments and whitespace cannot begin within within other comments, or within +Comments and whitespace cannot begin within other comments, or within template literals except inside an interpolation sequence or template directive. ### Identifiers diff --git a/vendor/github.com/hashicorp/terraform-exec/internal/version/version.go b/vendor/github.com/hashicorp/terraform-exec/internal/version/version.go index 164c0fd6b..dbc9466b3 100644 --- a/vendor/github.com/hashicorp/terraform-exec/internal/version/version.go +++ b/vendor/github.com/hashicorp/terraform-exec/internal/version/version.go @@ -1,6 +1,6 @@ package version -const version = "0.17.2" +const version = "0.17.3" // ModuleVersion returns the current version of the github.com/hashicorp/terraform-exec Go module. // This is a function to allow for future possible enhancement using debug.BuildInfo. diff --git a/vendor/github.com/hashicorp/terraform-exec/tfexec/exit_errors.go b/vendor/github.com/hashicorp/terraform-exec/tfexec/exit_errors.go index ea25b2a56..9fc152ddd 100644 --- a/vendor/github.com/hashicorp/terraform-exec/tfexec/exit_errors.go +++ b/vendor/github.com/hashicorp/terraform-exec/tfexec/exit_errors.go @@ -46,6 +46,7 @@ var ( statePlanReadErrRegexp = regexp.MustCompile( `Terraform couldn't read the given file as a state or plan file.|` + `Error: Failed to read the given file as a state or plan file`) + lockIdInvalidErrRegexp = regexp.MustCompile(`Failed to unlock state: `) ) func (tf *Terraform) wrapExitError(ctx context.Context, err error, stderr string) error { @@ -160,6 +161,8 @@ func (tf *Terraform) wrapExitError(ctx context.Context, err error, stderr string } case statePlanReadErrRegexp.MatchString(stderr): return &ErrStatePlanRead{stderr: stderr} + case lockIdInvalidErrRegexp.MatchString(stderr): + return &ErrLockIdInvalid{stderr: stderr} } return fmt.Errorf("%w\n%s", &unwrapper{exitErr, ctxErr}, stderr) @@ -256,6 +259,16 @@ func (e *ErrNoConfig) Error() string { return e.stderr } +type ErrLockIdInvalid struct { + unwrapper + + stderr string +} + +func (e *ErrLockIdInvalid) Error() string { + return e.stderr +} + // ErrCLIUsage is returned when the combination of flags or arguments is incorrect. // // CLI indicates usage errors in three different ways: either diff --git a/vendor/github.com/hashicorp/terraform-exec/tfexec/force_unlock.go b/vendor/github.com/hashicorp/terraform-exec/tfexec/force_unlock.go index c8dddffa1..de95f547a 100644 --- a/vendor/github.com/hashicorp/terraform-exec/tfexec/force_unlock.go +++ b/vendor/github.com/hashicorp/terraform-exec/tfexec/force_unlock.go @@ -2,6 +2,7 @@ package tfexec import ( "context" + "fmt" "os/exec" ) @@ -21,7 +22,10 @@ func (opt *DirOption) configureForceUnlock(conf *forceUnlockConfig) { // ForceUnlock represents the `terraform force-unlock` command func (tf *Terraform) ForceUnlock(ctx context.Context, lockID string, opts ...ForceUnlockOption) error { - unlockCmd := tf.forceUnlockCmd(ctx, lockID, opts...) + unlockCmd, err := tf.forceUnlockCmd(ctx, lockID, opts...) + if err != nil { + return err + } if err := tf.runTerraformCmd(ctx, unlockCmd); err != nil { return err @@ -30,21 +34,25 @@ func (tf *Terraform) ForceUnlock(ctx context.Context, lockID string, opts ...For return nil } -func (tf *Terraform) forceUnlockCmd(ctx context.Context, lockID string, opts ...ForceUnlockOption) *exec.Cmd { +func (tf *Terraform) forceUnlockCmd(ctx context.Context, lockID string, opts ...ForceUnlockOption) (*exec.Cmd, error) { c := defaultForceUnlockOptions for _, o := range opts { o.configureForceUnlock(&c) } - args := []string{"force-unlock", "-force"} + args := []string{"force-unlock", "-no-color", "-force"} // positional arguments args = append(args, lockID) // optional positional arguments if c.dir != "" { + err := tf.compatible(ctx, nil, tf0_15_0) + if err != nil { + return nil, fmt.Errorf("[DIR] option was removed in Terraform v0.15.0") + } args = append(args, c.dir) } - return tf.buildTerraformCmd(ctx, nil, args...) + return tf.buildTerraformCmd(ctx, nil, args...), nil } diff --git a/vendor/github.com/hashicorp/terraform-exec/tfexec/init.go b/vendor/github.com/hashicorp/terraform-exec/tfexec/init.go index bff9ecd3e..8fd366777 100644 --- a/vendor/github.com/hashicorp/terraform-exec/tfexec/init.go +++ b/vendor/github.com/hashicorp/terraform-exec/tfexec/init.go @@ -52,6 +52,10 @@ func (opt *DirOption) configureInit(conf *initConfig) { conf.dir = opt.path } +func (opt *ForceCopyOption) configureInit(conf *initConfig) { + conf.forceCopy = opt.forceCopy +} + func (opt *FromModuleOption) configureInit(conf *initConfig) { conf.fromModule = opt.source } @@ -116,7 +120,7 @@ func (tf *Terraform) initCmd(ctx context.Context, opts ...InitOption) (*exec.Cmd o.configureInit(&c) } - args := []string{"init", "-no-color", "-force-copy", "-input=false"} + args := []string{"init", "-no-color", "-input=false"} // string opts: only pass if set if c.fromModule != "" { @@ -144,6 +148,10 @@ func (tf *Terraform) initCmd(ctx context.Context, opts ...InitOption) (*exec.Cmd args = append(args, "-verify-plugins="+fmt.Sprint(c.verifyPlugins)) } + if c.forceCopy { + args = append(args, "-force-copy") + } + // unary flags: pass if true if c.reconfigure { args = append(args, "-reconfigure") diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go index a48a94a24..54e4d201d 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go @@ -11,7 +11,8 @@ import ( type generateCmd struct { commonCmd - flagLegacySidebar bool + flagLegacySidebar bool + flagIgnoreDeprecated bool flagProviderName string flagRenderedProviderName string @@ -75,6 +76,7 @@ func (cmd *generateCmd) Flags() *flag.FlagSet { fs.StringVar(&cmd.flagWebsiteTmpDir, "website-temp-dir", "", "temporary directory (used during generation)") fs.StringVar(&cmd.flagWebsiteSourceDir, "website-source-dir", "templates", "templates directory") fs.StringVar(&cmd.tfVersion, "tf-version", "", "terraform binary version to download") + fs.BoolVar(&cmd.flagIgnoreDeprecated, "ignore-deprecated", false, "don't generate documentation for deprecated resources and data-sources") return fs } @@ -100,6 +102,7 @@ func (cmd *generateCmd) runInternal() error { cmd.flagWebsiteTmpDir, cmd.flagWebsiteSourceDir, cmd.tfVersion, + cmd.flagIgnoreDeprecated, ) if err != nil { return fmt.Errorf("unable to generate website: %w", err) diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go index f9fed5f8c..ce5a4b137 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go @@ -64,8 +64,9 @@ var ( ) type generator struct { - legacySidebar bool - tfVersion string + ignoreDeprecated bool + legacySidebar bool + tfVersion string providerName string renderedProviderName string @@ -85,10 +86,11 @@ func (g *generator) warnf(format string, a ...interface{}) { g.ui.Warn(fmt.Sprintf(format, a...)) } -func Generate(ui cli.Ui, legacySidebar bool, providerName, renderedProviderName, renderedWebsiteDir, examplesDir, websiteTmpDir, websiteSourceDir, tfVersion string) error { +func Generate(ui cli.Ui, legacySidebar bool, providerName, renderedProviderName, renderedWebsiteDir, examplesDir, websiteTmpDir, websiteSourceDir, tfVersion string, ignoreDeprecated bool) error { g := &generator{ - legacySidebar: legacySidebar, - tfVersion: tfVersion, + ignoreDeprecated: ignoreDeprecated, + legacySidebar: legacySidebar, + tfVersion: tfVersion, providerName: providerName, renderedProviderName: renderedProviderName, @@ -319,6 +321,10 @@ func (g *generator) renderMissingProviderDoc(providerName string, schema *tfjson func (g *generator) renderMissingDocs(providerName string, providerSchema *tfjson.ProviderSchema) error { g.infof("generating missing resource content") for name, schema := range providerSchema.ResourceSchemas { + if g.ignoreDeprecated && schema.Block.Deprecated { + continue + } + err := g.renderMissingResourceDoc(providerName, name, "Resource", schema, websiteResourceFileTemplate, websiteResourceFallbackFileTemplate, @@ -332,6 +338,10 @@ func (g *generator) renderMissingDocs(providerName string, providerSchema *tfjso g.infof("generating missing data source content") for name, schema := range providerSchema.DataSourceSchemas { + if g.ignoreDeprecated && schema.Block.Deprecated { + continue + } + err := g.renderMissingResourceDoc(providerName, name, "Data Source", schema, websiteDataSourceFileTemplate, websiteDataSourceFallbackFileTemplate, @@ -415,9 +425,10 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj switch relDir { case "data-sources/": resSchema, resName := resourceSchema(providerSchema.DataSourceSchemas, shortName, relFile) + exampleFilePath := filepath.Join(g.examplesDir, "data-sources", resName, "data-source.tf") if resSchema != nil { tmpl := resourceTemplate(tmplData) - render, err := tmpl.Render(resName, providerName, g.renderedProviderName, "Data Source", "", "", resSchema) + render, err := tmpl.Render(resName, providerName, g.renderedProviderName, "Data Source", exampleFilePath, "", resSchema) if err != nil { return fmt.Errorf("unable to render data source template %q: %w", rel, err) } @@ -430,9 +441,12 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj g.warnf("data source entitled %q, or %q does not exist", shortName, resName) case "resources/": resSchema, resName := resourceSchema(providerSchema.ResourceSchemas, shortName, relFile) + exampleFilePath := filepath.Join(g.examplesDir, "resources", resName, "resource.tf") + importFilePath := filepath.Join(g.examplesDir, "resources", resName, "import.sh") + if resSchema != nil { tmpl := resourceTemplate(tmplData) - render, err := tmpl.Render(resName, providerName, g.renderedProviderName, "Resource", "", "", resSchema) + render, err := tmpl.Render(resName, providerName, g.renderedProviderName, "Resource", exampleFilePath, importFilePath, resSchema) if err != nil { return fmt.Errorf("unable to render resource template %q: %w", rel, err) } @@ -446,7 +460,8 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj case "": // provider if relFile == "index.md.tmpl" { tmpl := providerTemplate(tmplData) - render, err := tmpl.Render(providerName, g.renderedProviderName, "", providerSchema.ConfigSchema) + exampleFilePath := filepath.Join(g.examplesDir, "provider", "provider.tf") + render, err := tmpl.Render(providerName, g.renderedProviderName, exampleFilePath, providerSchema.ConfigSchema) if err != nil { return fmt.Errorf("unable to render provider template %q: %w", rel, err) } diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go index f1970f781..dcc1e541b 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go @@ -7,6 +7,9 @@ import ( "strings" "text/template" + "golang.org/x/text/cases" + "golang.org/x/text/language" + tfjson "github.com/hashicorp/terraform-json" "github.com/hashicorp/terraform-plugin-docs/internal/mdplain" @@ -31,18 +34,19 @@ type ( func newTemplate(name, text string) (*template.Template, error) { tmpl := template.New(name) + titleCaser := cases.Title(language.Und) - tmpl.Funcs(template.FuncMap(map[string]interface{}{ + tmpl.Funcs(map[string]interface{}{ "codefile": tmplfuncs.CodeFile, + "lower": strings.ToLower, "plainmarkdown": mdplain.PlainMarkdown, "prefixlines": tmplfuncs.PrefixLines, - "tffile": func(file string) (string, error) { - // TODO: omit comment handling - return tmplfuncs.CodeFile("terraform", file) - }, - "trimspace": strings.TrimSpace, - "split": strings.Split, - })) + "split": strings.Split, + "tffile": terraformCodeFile, + "title": titleCaser.String, + "trimspace": strings.TrimSpace, + "upper": strings.ToUpper, + }) var err error tmpl, err = tmpl.Parse(text) @@ -53,6 +57,11 @@ func newTemplate(name, text string) (*template.Template, error) { return tmpl, nil } +func terraformCodeFile(file string) (string, error) { + // TODO: omit comment handling + return tmplfuncs.CodeFile("terraform", file) +} + func renderTemplate(name string, text string, out io.Writer, data interface{}) error { tmpl, err := newTemplate(name, text) if err != nil { @@ -130,16 +139,11 @@ func (t providerTemplate) Render(providerName, renderedProviderName, exampleFile return "", nil } return renderStringTemplate("providerTemplate", s, struct { - Type string - Name string Description string HasExample bool ExampleFile string - HasImport bool - ImportFile string - ProviderName string ProviderShortName string @@ -149,7 +153,7 @@ func (t providerTemplate) Render(providerName, renderedProviderName, exampleFile }{ Description: schema.Block.Description, - HasExample: exampleFile != "", + HasExample: exampleFile != "" && fileExists(exampleFile), ExampleFile: exampleFile, ProviderName: providerName, @@ -195,10 +199,10 @@ func (t resourceTemplate) Render(name, providerName, renderedProviderName, typeN Name: name, Description: schema.Block.Description, - HasExample: exampleFile != "", + HasExample: exampleFile != "" && fileExists(exampleFile), ExampleFile: exampleFile, - HasImport: importFile != "", + HasImport: importFile != "" && fileExists(importFile), ImportFile: importFile, ProviderName: providerName, diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go b/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go index 9415aa080..df46a76d4 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go @@ -293,7 +293,9 @@ nameLoop: } for _, name := range sortedNames { - path := append(parents, name) + path := make([]string, len(parents), len(parents)+1) + copy(path, parents) + path = append(path, name) if childBlock, ok := block.NestedBlocks[name]; ok { nt, err := writeBlockType(w, path, childBlock) @@ -473,36 +475,55 @@ func writeObjectChildren(w io.Writer, parents []string, ty cty.Type, group group } func writeNestedAttributeChildren(w io.Writer, parents []string, nestedAttributes *tfjson.SchemaNestedAttributeType, group groupFilter) error { - _, err := io.WriteString(w, group.nestedTitle+"\n\n") - if err != nil { - return err - } - sortedNames := []string{} for n := range nestedAttributes.Attributes { sortedNames = append(sortedNames, n) } sort.Strings(sortedNames) - nestedTypes := []nestedType{} + groups := map[int][]string{} for _, name := range sortedNames { att := nestedAttributes.Attributes[name] - path := append(parents, name) - nt, err := writeAttribute(w, path, att, group) + for i, gf := range groupFilters { + if gf.filterAttribute(att) { + groups[i] = append(groups[i], name) + } + } + } + + nestedTypes := []nestedType{} + + for i, gf := range groupFilters { + names, ok := groups[i] + if !ok || len(names) == 0 { + continue + } + + _, err := io.WriteString(w, gf.nestedTitle+"\n\n") if err != nil { - return fmt.Errorf("unable to render attribute %q: %w", name, err) + return err } - nestedTypes = append(nestedTypes, nt...) - } + for _, name := range names { + att := nestedAttributes.Attributes[name] + path := append(parents, name) - _, err = io.WriteString(w, "\n") - if err != nil { - return err + nt, err := writeAttribute(w, path, att, group) + if err != nil { + return fmt.Errorf("unable to render attribute %q: %w", name, err) + } + + nestedTypes = append(nestedTypes, nt...) + } + + _, err = io.WriteString(w, "\n") + if err != nil { + return err + } } - err = writeNestedTypes(w, nestedTypes) + err := writeNestedTypes(w, nestedTypes) if err != nil { return err } diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/LICENSE b/vendor/github.com/hashicorp/terraform-plugin-go/LICENSE index c33dcc7c9..e5ead304d 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/LICENSE +++ b/vendor/github.com/hashicorp/terraform-plugin-go/LICENSE @@ -1,3 +1,5 @@ +Copyright (c) 2020 HashiCorp, Inc. + Mozilla Public License, version 2.0 1. Definitions diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.pb.go b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.pb.go index 45071cea7..9b7abe79e 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.pb.go +++ b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.pb.go @@ -1795,6 +1795,15 @@ func (x *PrepareProviderConfig_Response) GetDiagnostics() []*Diagnostic { return nil } +// Request is the message that is sent to the provider during the +// UpgradeResourceState RPC. +// +// This message intentionally does not include configuration data as any +// configuration-based or configuration-conditional changes should occur +// during the PlanResourceChange RPC. Additionally, the configuration is +// not guaranteed to exist (in the case of resource destruction), be wholly +// known, nor match the given prior state, which could lead to unexpected +// provider behaviors for practitioners. type UpgradeResourceState_Request struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -2231,6 +2240,14 @@ func (x *Configure_Response) GetDiagnostics() []*Diagnostic { return nil } +// Request is the message that is sent to the provider during the +// ReadResource RPC. +// +// This message intentionally does not include configuration data as any +// configuration-based or configuration-conditional changes should occur +// during the PlanResourceChange RPC. Additionally, the configuration is +// not guaranteed to be wholly known nor match the given prior state, which +// could lead to unexpected provider behaviors for practitioners. type ReadResource_Request struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.proto b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.proto index fdc123a85..6cdaf2c03 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.proto +++ b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/internal/tfplugin5/tfplugin5.proto @@ -183,6 +183,15 @@ message PrepareProviderConfig { } message UpgradeResourceState { + // Request is the message that is sent to the provider during the + // UpgradeResourceState RPC. + // + // This message intentionally does not include configuration data as any + // configuration-based or configuration-conditional changes should occur + // during the PlanResourceChange RPC. Additionally, the configuration is + // not guaranteed to exist (in the case of resource destruction), be wholly + // known, nor match the given prior state, which could lead to unexpected + // provider behaviors for practitioners. message Request { string type_name = 1; @@ -240,6 +249,14 @@ message Configure { } message ReadResource { + // Request is the message that is sent to the provider during the + // ReadResource RPC. + // + // This message intentionally does not include configuration data as any + // configuration-based or configuration-conditional changes should occur + // during the PlanResourceChange RPC. Additionally, the configuration is + // not guaranteed to be wholly known nor match the given prior state, which + // could lead to unexpected provider behaviors for practitioners. message Request { string type_name = 1; DynamicValue current_state = 2; diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/provider.go b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/provider.go index c7b95a5d1..0bc84ff26 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/provider.go +++ b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov5/provider.go @@ -54,7 +54,7 @@ type GetProviderSchemaResponse struct { // will be specified in the provider block of the user's configuration. Provider *Schema - // ProviderMeta defines the schema for the provider's metadta, which + // ProviderMeta defines the schema for the provider's metadata, which // will be specified in the provider_meta blocks of the terraform block // for a module. This is an advanced feature and its usage should be // coordinated with the Terraform Core team by opening an issue at diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.pb.go b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.pb.go index 338c96a53..817f059cc 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.pb.go +++ b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.pb.go @@ -1814,6 +1814,15 @@ func (x *ValidateProviderConfig_Response) GetDiagnostics() []*Diagnostic { return nil } +// Request is the message that is sent to the provider during the +// UpgradeResourceState RPC. +// +// This message intentionally does not include configuration data as any +// configuration-based or configuration-conditional changes should occur +// during the PlanResourceChange RPC. Additionally, the configuration is +// not guaranteed to exist (in the case of resource destruction), be wholly +// known, nor match the given prior state, which could lead to unexpected +// provider behaviors for practitioners. type UpgradeResourceState_Request struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -2250,6 +2259,14 @@ func (x *ConfigureProvider_Response) GetDiagnostics() []*Diagnostic { return nil } +// Request is the message that is sent to the provider during the +// ReadResource RPC. +// +// This message intentionally does not include configuration data as any +// configuration-based or configuration-conditional changes should occur +// during the PlanResourceChange RPC. Additionally, the configuration is +// not guaranteed to be wholly known nor match the given prior state, which +// could lead to unexpected provider behaviors for practitioners. type ReadResource_Request struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.proto b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.proto index b6d05bb74..affb15fb4 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.proto +++ b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/internal/tfplugin6/tfplugin6.proto @@ -201,6 +201,15 @@ message ValidateProviderConfig { } message UpgradeResourceState { + // Request is the message that is sent to the provider during the + // UpgradeResourceState RPC. + // + // This message intentionally does not include configuration data as any + // configuration-based or configuration-conditional changes should occur + // during the PlanResourceChange RPC. Additionally, the configuration is + // not guaranteed to exist (in the case of resource destruction), be wholly + // known, nor match the given prior state, which could lead to unexpected + // provider behaviors for practitioners. message Request { string type_name = 1; @@ -258,6 +267,14 @@ message ConfigureProvider { } message ReadResource { + // Request is the message that is sent to the provider during the + // ReadResource RPC. + // + // This message intentionally does not include configuration data as any + // configuration-based or configuration-conditional changes should occur + // during the PlanResourceChange RPC. Additionally, the configuration is + // not guaranteed to be wholly known nor match the given prior state, which + // could lead to unexpected provider behaviors for practitioners. message Request { string type_name = 1; DynamicValue current_state = 2; diff --git a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/provider.go b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/provider.go index 21f81f7a1..970ef8e70 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/provider.go +++ b/vendor/github.com/hashicorp/terraform-plugin-go/tfprotov6/provider.go @@ -54,7 +54,7 @@ type GetProviderSchemaResponse struct { // will be specified in the provider block of the user's configuration. Provider *Schema - // ProviderMeta defines the schema for the provider's metadta, which + // ProviderMeta defines the schema for the provider's metadata, which // will be specified in the provider_meta blocks of the terraform block // for a module. This is an advanced feature and its usage should be // coordinated with the Terraform Core team by opening an issue at diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/LICENSE b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/LICENSE index c33dcc7c9..fba4c76f7 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/LICENSE +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/LICENSE @@ -1,3 +1,5 @@ +Copyright (c) 2019 HashiCorp, Inc. + Mozilla Public License, version 2.0 1. Definitions diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/logging/logging.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/logging/logging.go index 235586aed..74eb7f666 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/logging/logging.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/logging/logging.go @@ -3,7 +3,6 @@ package logging import ( "fmt" "io" - "io/ioutil" "log" "os" "strings" @@ -32,7 +31,7 @@ var ValidLevels = []logutils.LogLevel{"TRACE", "DEBUG", "INFO", "WARN", "ERROR"} // environment variable. Calls to tflog.* will have their output managed by the // tfsdklog sink. func LogOutput(t testing.T) (logOutput io.Writer, err error) { - logOutput = ioutil.Discard + logOutput = io.Discard logLevel := LogLevel() if logLevel == "" { @@ -88,7 +87,7 @@ func LogOutput(t testing.T) (logOutput io.Writer, err error) { // SetOutput checks for a log destination with LogOutput, and calls // log.SetOutput with the result. If LogOutput returns nil, SetOutput uses -// ioutil.Discard. Any error from LogOutout is fatal. +// io.Discard. Any error from LogOutout is fatal. func SetOutput(t testing.T) { out, err := LogOutput(t) if err != nil { @@ -96,7 +95,7 @@ func SetOutput(t testing.T) { } if out == nil { - out = ioutil.Discard + out = io.Discard } log.SetOutput(out) diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/plugin.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/plugin.go index 9e52348d6..120f04276 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/plugin.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/plugin.go @@ -3,7 +3,7 @@ package resource import ( "context" "fmt" - "io/ioutil" + "io" "os" "strings" "sync" @@ -157,6 +157,13 @@ func runProviderCommand(ctx context.Context, t testing.T, f func() error, wd *pl host = v } + // schema.Provider have a global stop context that is created outside + // the server context and have their own associated goroutine. Since + // Terraform does not call the StopProvider RPC to stop the server in + // reattach mode, ensure that we save these servers to later call that + // RPC and end those goroutines. + legacyProviderServers := make([]*schema.GRPCProviderServer, 0, len(factories.legacy)) + // Spin up gRPC servers for every provider factory, start a // WaitGroup to listen for all of the close channels. var wg sync.WaitGroup @@ -180,18 +187,24 @@ func runProviderCommand(ctx context.Context, t testing.T, f func() error, wd *pl // shut down. wg.Add(1) + grpcProviderServer := schema.NewGRPCProviderServer(provider) + legacyProviderServers = append(legacyProviderServers, grpcProviderServer) + + // Ensure StopProvider is always called when returning early. + defer grpcProviderServer.StopProvider(ctx, nil) //nolint:errcheck // does not return errors + // configure the settings our plugin will be served with // the GRPCProviderFunc wraps a non-gRPC provider server // into a gRPC interface, and the logger just discards logs // from go-plugin. opts := &plugin.ServeOpts{ GRPCProviderFunc: func() tfprotov5.ProviderServer { - return schema.NewGRPCProviderServer(provider) + return grpcProviderServer }, Logger: hclog.New(&hclog.LoggerOptions{ Name: "plugintest", Level: hclog.Trace, - Output: ioutil.Discard, + Output: io.Discard, }), NoLogOutputOverride: true, UseTFLogSink: t, @@ -279,7 +292,7 @@ func runProviderCommand(ctx context.Context, t testing.T, f func() error, wd *pl Logger: hclog.New(&hclog.LoggerOptions{ Name: "plugintest", Level: hclog.Trace, - Output: ioutil.Discard, + Output: io.Discard, }), NoLogOutputOverride: true, UseTFLogSink: t, @@ -364,7 +377,7 @@ func runProviderCommand(ctx context.Context, t testing.T, f func() error, wd *pl Logger: hclog.New(&hclog.LoggerOptions{ Name: "plugintest", Level: hclog.Trace, - Output: ioutil.Discard, + Output: io.Discard, }), NoLogOutputOverride: true, UseTFLogSink: t, @@ -430,6 +443,12 @@ func runProviderCommand(ctx context.Context, t testing.T, f func() error, wd *pl // get closed, and we'll hang here. cancel() + // For legacy providers, call the StopProvider RPC so the StopContext + // goroutine is cleaned up properly. + for _, legacyProviderServer := range legacyProviderServers { + legacyProviderServer.StopProvider(ctx, nil) //nolint:errcheck // does not return errors + } + logging.HelperResourceTrace(ctx, "Waiting for providers to stop") // wait for the servers to actually shut down; it may take a moment for diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testcase_providers.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testcase_providers.go index c09e4657c..19a548cdb 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testcase_providers.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testcase_providers.go @@ -9,7 +9,7 @@ import ( // providerConfig takes the list of providers in a TestCase and returns a // config with only empty provider blocks. This is useful for Import, where no // config is provided, but the providers must be defined. -func (c TestCase) providerConfig(_ context.Context) string { +func (c TestCase) providerConfig(_ context.Context, skipProviderBlock bool) string { var providerBlocks, requiredProviderBlocks strings.Builder // [BF] The Providers field handling predates the logic being moved to this @@ -21,7 +21,9 @@ func (c TestCase) providerConfig(_ context.Context) string { } for name, externalProvider := range c.ExternalProviders { - providerBlocks.WriteString(fmt.Sprintf("provider %q {}\n", name)) + if !skipProviderBlock { + providerBlocks.WriteString(fmt.Sprintf("provider %q {}\n", name)) + } if externalProvider.Source == "" && externalProvider.VersionConstraint == "" { continue diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing.go index 53c3746d8..caadc3ddc 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing.go @@ -551,6 +551,16 @@ type TestStep struct { // ImportStateCheck checks the results of ImportState. It should be // used to verify that the resulting value of ImportState has the // proper resources, IDs, and attributes. + // + // Prefer ImportStateVerify over ImportStateCheck, unless the resource + // import explicitly is expected to create multiple resources (not a + // recommended resource implementation) or if attributes are imported with + // syntactically different but semantically/functionally equivalent values + // where special logic is needed. + // + // Terraform versions 1.3 and later can include data source states during + // import, which the testing framework will skip to prevent the need for + // Terraform version specific logic in provider testing. ImportStateCheck ImportStateCheckFunc // ImportStateVerify, if true, will also check that the state values @@ -564,6 +574,28 @@ type TestStep struct { ImportStateVerify bool ImportStateVerifyIgnore []string + // ImportStatePersist, if true, will update the persisted state with the + // state generated by the import operation (i.e., terraform import). When + // false (default) the state generated by the import operation is discarded + // at the end of the test step that is verifying import behavior. + ImportStatePersist bool + + //--------------------------------------------------------------- + // RefreshState testing + //--------------------------------------------------------------- + + // RefreshState, if true, will test the functionality of `terraform + // refresh` by refreshing the state, running any checks against the + // refreshed state, and running a plan to verify against unexpected plan + // differences. + // + // If the refresh is expected to result in a non-empty plan + // ExpectNonEmptyPlan should be set to true in the same TestStep. + // + // RefreshState cannot be the first TestStep and, it is mutually exclusive + // with ImportState. + RefreshState bool + // ProviderFactories can be specified for the providers that are valid for // this TestStep. When providers are specified at the TestStep level, all // TestStep within a TestCase must declare providers. diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new.go index 7b136d0d1..007ab66c0 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new.go @@ -89,7 +89,7 @@ func runNewTest(ctx context.Context, t testing.T, c TestCase, helper *plugintest }() if c.hasProviders(ctx) { - err := wd.SetConfig(ctx, c.providerConfig(ctx)) + err := wd.SetConfig(ctx, c.providerConfig(ctx, false)) if err != nil { logging.HelperResourceError(ctx, @@ -114,7 +114,7 @@ func runNewTest(ctx context.Context, t testing.T, c TestCase, helper *plugintest logging.HelperResourceDebug(ctx, "Starting TestSteps") - // use this to track last step succesfully applied + // use this to track last step successfully applied // acts as default for import tests var appliedCfg string @@ -170,7 +170,7 @@ func runNewTest(ctx context.Context, t testing.T, c TestCase, helper *plugintest protov6: protov6ProviderFactories(c.ProtoV6ProviderFactories).merge(step.ProtoV6ProviderFactories), } - providerCfg := step.providerConfig(ctx) + providerCfg := step.providerConfig(ctx, step.configHasProviderBlock(ctx)) err := wd.SetConfig(ctx, providerCfg) @@ -241,6 +241,45 @@ func runNewTest(ctx context.Context, t testing.T, c TestCase, helper *plugintest continue } + if step.RefreshState { + logging.HelperResourceTrace(ctx, "TestStep is RefreshState mode") + + err := testStepNewRefreshState(ctx, t, wd, step, providers) + if step.ExpectError != nil { + logging.HelperResourceDebug(ctx, "Checking TestStep ExpectError") + if err == nil { + logging.HelperResourceError(ctx, + "Error running refresh: expected an error but got none", + ) + t.Fatalf("Step %d/%d error running refresh: expected an error but got none", stepNumber, len(c.Steps)) + } + if !step.ExpectError.MatchString(err.Error()) { + logging.HelperResourceError(ctx, + fmt.Sprintf("Error running refresh: expected an error with pattern (%s)", step.ExpectError.String()), + map[string]interface{}{logging.KeyError: err}, + ) + t.Fatalf("Step %d/%d error running refresh, expected an error with pattern (%s), no match on: %s", stepNumber, len(c.Steps), step.ExpectError.String(), err) + } + } else { + if err != nil && c.ErrorCheck != nil { + logging.HelperResourceDebug(ctx, "Calling TestCase ErrorCheck") + err = c.ErrorCheck(err) + logging.HelperResourceDebug(ctx, "Called TestCase ErrorCheck") + } + if err != nil { + logging.HelperResourceError(ctx, + "Error running refresh", + map[string]interface{}{logging.KeyError: err}, + ) + t.Fatalf("Step %d/%d error running refresh: %s", stepNumber, len(c.Steps), err) + } + } + + logging.HelperResourceDebug(ctx, "Finished TestStep") + + continue + } + if step.Config != "" { logging.HelperResourceTrace(ctx, "TestStep is Config mode") @@ -278,7 +317,7 @@ func runNewTest(ctx context.Context, t testing.T, c TestCase, helper *plugintest } } - appliedCfg = step.Config + appliedCfg = step.mergedConfig(ctx, c) logging.HelperResourceDebug(ctx, "Finished TestStep") @@ -332,7 +371,7 @@ func testIDRefresh(ctx context.Context, t testing.T, c TestCase, wd *plugintest. // Temporarily set the config to a minimal provider config for the refresh // test. After the refresh we can reset it. - err := wd.SetConfig(ctx, c.providerConfig(ctx)) + err := wd.SetConfig(ctx, c.providerConfig(ctx, step.configHasProviderBlock(ctx))) if err != nil { t.Fatalf("Error setting import test config: %s", err) } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_config.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_config.go index 09d18c364..0d4e0b0e4 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_config.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_config.go @@ -16,7 +16,7 @@ import ( func testStepNewConfig(ctx context.Context, t testing.T, c TestCase, wd *plugintest.WorkingDir, step TestStep, providers *providerFactories) error { t.Helper() - err := wd.SetConfig(ctx, step.Config) + err := wd.SetConfig(ctx, step.mergedConfig(ctx, c)) if err != nil { return fmt.Errorf("Error setting config: %w", err) } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_import_state.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_import_state.go index ec61b055f..0ec007168 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_import_state.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_import_state.go @@ -7,7 +7,7 @@ import ( "strings" "github.com/davecgh/go-spew/spew" - testing "github.com/mitchellh/go-testing-interface" + "github.com/mitchellh/go-testing-interface" "github.com/hashicorp/terraform-plugin-sdk/v2/internal/logging" "github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest" @@ -86,8 +86,17 @@ func testStepNewImportState(ctx context.Context, t testing.T, helper *plugintest t.Fatal("Cannot import state with no specified config") } } - importWd := helper.RequireNewWorkingDir(ctx, t) - defer importWd.Close() + + var importWd *plugintest.WorkingDir + + // Use the same working directory to persist the state from import + if step.ImportStatePersist { + importWd = wd + } else { + importWd = helper.RequireNewWorkingDir(ctx, t) + defer importWd.Close() + } + err = importWd.SetConfig(ctx, step.Config) if err != nil { t.Fatalf("Error setting test config: %s", err) @@ -95,11 +104,13 @@ func testStepNewImportState(ctx context.Context, t testing.T, helper *plugintest logging.HelperResourceDebug(ctx, "Running Terraform CLI init and import") - err = runProviderCommand(ctx, t, func() error { - return importWd.Init(ctx) - }, importWd, providers) - if err != nil { - t.Fatalf("Error running init: %s", err) + if !step.ImportStatePersist { + err = runProviderCommand(ctx, t, func() error { + return importWd.Init(ctx) + }, importWd, providers) + if err != nil { + t.Fatalf("Error running init: %s", err) + } } err = runProviderCommand(ctx, t, func() error { @@ -126,12 +137,18 @@ func testStepNewImportState(ctx context.Context, t testing.T, helper *plugintest logging.HelperResourceTrace(ctx, "Using TestStep ImportStateCheck") var states []*terraform.InstanceState - for _, r := range importState.RootModule().Resources { - if r.Primary != nil { - is := r.Primary.DeepCopy() - is.Ephemeral.Type = r.Type // otherwise the check function cannot see the type - states = append(states, is) + for address, r := range importState.RootModule().Resources { + if strings.HasPrefix(address, "data.") { + continue } + + if r.Primary == nil { + continue + } + + is := r.Primary.DeepCopy() + is.Ephemeral.Type = r.Type // otherwise the check function cannot see the type + states = append(states, is) } logging.HelperResourceDebug(ctx, "Calling TestStep ImportStateCheck") @@ -147,20 +164,27 @@ func testStepNewImportState(ctx context.Context, t testing.T, helper *plugintest if step.ImportStateVerify { logging.HelperResourceTrace(ctx, "Using TestStep ImportStateVerify") - newResources := importState.RootModule().Resources - oldResources := state.RootModule().Resources + // Ensure that we do not match against data sources as they + // cannot be imported and are not what we want to verify. + // Mode is not present in ResourceState so we use the + // stringified ResourceStateKey for comparison. + newResources := make(map[string]*terraform.ResourceState) + for k, v := range importState.RootModule().Resources { + if !strings.HasPrefix(k, "data.") { + newResources[k] = v + } + } + oldResources := make(map[string]*terraform.ResourceState) + for k, v := range state.RootModule().Resources { + if !strings.HasPrefix(k, "data.") { + oldResources[k] = v + } + } for _, r := range newResources { // Find the existing resource var oldR *terraform.ResourceState - for r2Key, r2 := range oldResources { - // Ensure that we do not match against data sources as they - // cannot be imported and are not what we want to verify. - // Mode is not present in ResourceState so we use the - // stringified ResourceStateKey for comparison. - if strings.HasPrefix(r2Key, "data.") { - continue - } + for _, r2 := range oldResources { if r2.Primary != nil && r2.Primary.ID == r.Primary.ID && r2.Type == r.Type && r2.Provider == r.Provider { oldR = r2 diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_refresh_state.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_refresh_state.go new file mode 100644 index 000000000..161129347 --- /dev/null +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/testing_new_refresh_state.go @@ -0,0 +1,97 @@ +package resource + +import ( + "context" + "fmt" + + "github.com/davecgh/go-spew/spew" + tfjson "github.com/hashicorp/terraform-json" + "github.com/mitchellh/go-testing-interface" + + "github.com/hashicorp/terraform-plugin-sdk/v2/internal/logging" + "github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest" + "github.com/hashicorp/terraform-plugin-sdk/v2/terraform" +) + +func testStepNewRefreshState(ctx context.Context, t testing.T, wd *plugintest.WorkingDir, step TestStep, providers *providerFactories) error { + t.Helper() + + spewConf := spew.NewDefaultConfig() + spewConf.SortKeys = true + + var err error + // Explicitly ensure prior state exists before refresh. + err = runProviderCommand(ctx, t, func() error { + _, err = getState(ctx, t, wd) + if err != nil { + return err + } + return nil + }, wd, providers) + if err != nil { + t.Fatalf("Error getting state: %s", err) + } + + err = runProviderCommand(ctx, t, func() error { + return wd.Refresh(ctx) + }, wd, providers) + if err != nil { + return err + } + + var refreshState *terraform.State + err = runProviderCommand(ctx, t, func() error { + refreshState, err = getState(ctx, t, wd) + if err != nil { + return err + } + return nil + }, wd, providers) + if err != nil { + t.Fatalf("Error getting state: %s", err) + } + + // Go through the refreshed state and verify + if step.Check != nil { + logging.HelperResourceDebug(ctx, "Calling TestStep Check for RefreshState") + + if err := step.Check(refreshState); err != nil { + t.Fatal(err) + } + + logging.HelperResourceDebug(ctx, "Called TestStep Check for RefreshState") + } + + // do a plan + err = runProviderCommand(ctx, t, func() error { + return wd.CreatePlan(ctx) + }, wd, providers) + if err != nil { + return fmt.Errorf("Error running post-apply plan: %w", err) + } + + var plan *tfjson.Plan + err = runProviderCommand(ctx, t, func() error { + var err error + plan, err = wd.SavedPlan(ctx) + return err + }, wd, providers) + if err != nil { + return fmt.Errorf("Error retrieving post-apply plan: %w", err) + } + + if !planIsEmpty(plan) && !step.ExpectNonEmptyPlan { + var stdout string + err = runProviderCommand(ctx, t, func() error { + var err error + stdout, err = wd.SavedPlanRawStdout(ctx) + return err + }, wd, providers) + if err != nil { + return fmt.Errorf("Error retrieving formatted plan output: %w", err) + } + return fmt.Errorf("After refreshing state during this test step, a followup plan was not empty.\nstdout:\n\n%s", stdout) + } + + return nil +} diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_providers.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_providers.go index 35d4a9bf5..757f8f638 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_providers.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_providers.go @@ -3,17 +3,63 @@ package resource import ( "context" "fmt" + "regexp" "strings" ) +var configProviderBlockRegex = regexp.MustCompile(`provider "?[a-zA-Z0-9_-]+"? {`) + +// configHasProviderBlock returns true if the Config has declared a provider +// configuration block, e.g. provider "examplecloud" {...} +func (s TestStep) configHasProviderBlock(_ context.Context) bool { + return configProviderBlockRegex.MatchString(s.Config) +} + +// configHasTerraformBlock returns true if the Config has declared a terraform +// configuration block, e.g. terraform {...} +func (s TestStep) configHasTerraformBlock(_ context.Context) bool { + return strings.Contains(s.Config, "terraform {") +} + +// mergedConfig prepends any necessary terraform configuration blocks to the +// TestStep Config. +// +// If there are ExternalProviders configurations in either the TestCase or +// TestStep, the terraform configuration block should be included with the +// step configuration to prevent errors with providers outside the +// registry.terraform.io hostname or outside the hashicorp namespace. +func (s TestStep) mergedConfig(ctx context.Context, testCase TestCase) string { + var config strings.Builder + + // Prevent issues with existing configurations containing the terraform + // configuration block. + if s.configHasTerraformBlock(ctx) { + config.WriteString(s.Config) + + return config.String() + } + + if testCase.hasProviders(ctx) { + config.WriteString(testCase.providerConfig(ctx, s.configHasProviderBlock(ctx))) + } else { + config.WriteString(s.providerConfig(ctx, s.configHasProviderBlock(ctx))) + } + + config.WriteString(s.Config) + + return config.String() +} + // providerConfig takes the list of providers in a TestStep and returns a // config with only empty provider blocks. This is useful for Import, where no // config is provided, but the providers must be defined. -func (s TestStep) providerConfig(_ context.Context) string { +func (s TestStep) providerConfig(_ context.Context, skipProviderBlock bool) string { var providerBlocks, requiredProviderBlocks strings.Builder for name, externalProvider := range s.ExternalProviders { - providerBlocks.WriteString(fmt.Sprintf("provider %q {}\n", name)) + if !skipProviderBlock { + providerBlocks.WriteString(fmt.Sprintf("provider %q {}\n", name)) + } if externalProvider.Source == "" && externalProvider.VersionConstraint == "" { continue diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_validate.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_validate.go index 95b36e7b9..0ba655168 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_validate.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/resource/teststep_validate.go @@ -43,7 +43,10 @@ func (s TestStep) hasProviders(_ context.Context) bool { // validate ensures the TestStep is valid based on the following criteria: // -// - Config or ImportState is set. +// - Config or ImportState or RefreshState is set. +// - Config and RefreshState are not both set. +// - RefreshState and Destroy are not both set. +// - RefreshState is not the first TestStep. // - Providers are not specified (ExternalProviders, // ProtoV5ProviderFactories, ProtoV6ProviderFactories, ProviderFactories) // if specified at the TestCase level. @@ -58,8 +61,32 @@ func (s TestStep) validate(ctx context.Context, req testStepValidateRequest) err logging.HelperResourceTrace(ctx, "Validating TestStep") - if s.Config == "" && !s.ImportState { - err := fmt.Errorf("TestStep missing Config or ImportState") + if s.Config == "" && !s.ImportState && !s.RefreshState { + err := fmt.Errorf("TestStep missing Config or ImportState or RefreshState") + logging.HelperResourceError(ctx, "TestStep validation error", map[string]interface{}{logging.KeyError: err}) + return err + } + + if s.Config != "" && s.RefreshState { + err := fmt.Errorf("TestStep cannot have Config and RefreshState") + logging.HelperResourceError(ctx, "TestStep validation error", map[string]interface{}{logging.KeyError: err}) + return err + } + + if s.RefreshState && s.Destroy { + err := fmt.Errorf("TestStep cannot have RefreshState and Destroy") + logging.HelperResourceError(ctx, "TestStep validation error", map[string]interface{}{logging.KeyError: err}) + return err + } + + if s.RefreshState && req.StepNumber == 1 { + err := fmt.Errorf("TestStep cannot have RefreshState as first step") + logging.HelperResourceError(ctx, "TestStep validation error", map[string]interface{}{logging.KeyError: err}) + return err + } + + if s.ImportState && s.RefreshState { + err := fmt.Errorf("TestStep cannot have ImportState and RefreshState in same step") logging.HelperResourceError(ctx, "TestStep validation error", map[string]interface{}{logging.KeyError: err}) return err } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/schema/schema.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/schema/schema.go index fc955ce16..4a3e146b6 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/schema/schema.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/helper/schema/schema.go @@ -1093,9 +1093,10 @@ func checkKeysAgainstSchemaFlags(k string, keys []string, topSchemaMap schemaMap return nil } +var validFieldNameRe = regexp.MustCompile("^[a-z0-9_]+$") + func isValidFieldName(name string) bool { - re := regexp.MustCompile("^[a-z0-9_]+$") - return re.MatchString(name) + return validFieldNameRe.MatchString(name) } // resourceDiffer is an interface that is used by the private diff functions. @@ -1735,15 +1736,7 @@ func (m schemaMap) validate( // The SDK has to allow the unknown value through initially, so that // Required fields set via an interpolated value are accepted. if !isWhollyKnown(raw) { - if schema.Deprecated != "" { - return append(diags, diag.Diagnostic{ - Severity: diag.Warning, - Summary: "Argument is deprecated", - Detail: schema.Deprecated, - AttributePath: path, - }) - } - return diags + return nil } err = validateConflictingAttributes(k, schema, c) @@ -1946,7 +1939,7 @@ func (m schemaMap) validateList( return append(diags, diag.Diagnostic{ Severity: diag.Error, Summary: "Too many list items", - Detail: fmt.Sprintf("Attribute supports %d item maximum, but config has %d declared.", schema.MaxItems, rawV.Len()), + Detail: fmt.Sprintf("Attribute %s supports %d item maximum, but config has %d declared.", k, schema.MaxItems, rawV.Len()), AttributePath: path, }) } @@ -1955,7 +1948,7 @@ func (m schemaMap) validateList( return append(diags, diag.Diagnostic{ Severity: diag.Error, Summary: "Not enough list items", - Detail: fmt.Sprintf("Attribute requires %d item minimum, but config has only %d declared.", schema.MinItems, rawV.Len()), + Detail: fmt.Sprintf("Attribute %s requires %d item minimum, but config has only %d declared.", k, schema.MinItems, rawV.Len()), AttributePath: path, }) } @@ -2134,7 +2127,7 @@ func validateMapValues(k string, m map[string]interface{}, schema *Schema, path }) } default: - panic(fmt.Sprintf("Unknown validation type: %#v", schema.Type)) + panic(fmt.Sprintf("Unknown validation type: %#v", valueType)) } } return diags diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/logging/keys.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/logging/keys.go index 03931b024..ad5107218 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/logging/keys.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/logging/keys.go @@ -31,6 +31,9 @@ const ( // The TestStep number of the test being executed. Starts at 1. KeyTestStepNumber = "test_step_number" + // Terraform configuration used during acceptance testing Terraform operations. + KeyTestTerraformConfiguration = "test_terraform_configuration" + // The Terraform CLI logging level (TF_LOG) used for an acceptance test. KeyTestTerraformLogLevel = "test_terraform_log_level" @@ -49,6 +52,9 @@ const ( // The path to the Terraform CLI used for an acceptance test. KeyTestTerraformPath = "test_terraform_path" + // Terraform plan output generated during a TestStep. + KeyTestTerraformPlan = "test_terraform_plan" + // The working directory of the acceptance test. KeyTestWorkingDirectory = "test_working_directory" ) diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/config.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/config.go index c238145aa..920c47165 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/config.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/config.go @@ -3,7 +3,6 @@ package plugintest import ( "context" "fmt" - "io/ioutil" "os" "strings" @@ -35,7 +34,7 @@ func DiscoverConfig(ctx context.Context, sourceDir string) (*Config, error) { tfPath := os.Getenv(EnvTfAccTerraformPath) tempDir := os.Getenv(EnvTfAccTempDir) - tfDir, err := ioutil.TempDir(tempDir, "plugintest-terraform") + tfDir, err := os.MkdirTemp(tempDir, "plugintest-terraform") if err != nil { return nil, fmt.Errorf("failed to create temp dir: %w", err) } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/helper.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/helper.go index 0411eae0a..bfe89e1b9 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/helper.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/helper.go @@ -4,7 +4,6 @@ import ( "context" "errors" "fmt" - "io/ioutil" "os" "strings" @@ -70,7 +69,7 @@ func AutoInitHelper(ctx context.Context, sourceDir string) (*Helper, error) { // automatically clean those up. func InitHelper(ctx context.Context, config *Config) (*Helper, error) { tempDir := os.Getenv(EnvTfAccTempDir) - baseDir, err := ioutil.TempDir(tempDir, "plugintest") + baseDir, err := os.MkdirTemp(tempDir, "plugintest") if err != nil { return nil, fmt.Errorf("failed to create temporary directory for test helper: %s", err) } @@ -105,7 +104,7 @@ func (h *Helper) Close() error { // program exits, the Close method on the helper itself will attempt to // delete it. func (h *Helper) NewWorkingDir(ctx context.Context, t TestControl) (*WorkingDir, error) { - dir, err := ioutil.TempDir(h.baseDir, "work") + dir, err := os.MkdirTemp(h.baseDir, "work") if err != nil { return nil, err } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/util.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/util.go index 335e217ad..c77a9cb08 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/util.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/util.go @@ -28,79 +28,40 @@ func symlinkFile(src string, dest string) error { return nil } -// symlinkDir is a simplistic function for recursively symlinking all files in a directory to a new path. -// It is intended only for limited internal use and does not cover all edge cases. -func symlinkDir(srcDir string, destDir string) (err error) { - srcInfo, err := os.Stat(srcDir) - if err != nil { - return err - } - - err = os.MkdirAll(destDir, srcInfo.Mode()) - if err != nil { - return err - } - - directory, _ := os.Open(srcDir) - defer directory.Close() - objects, err := directory.Readdir(-1) - - for _, obj := range objects { - srcPath := filepath.Join(srcDir, obj.Name()) - destPath := filepath.Join(destDir, obj.Name()) - - if obj.IsDir() { - err = symlinkDir(srcPath, destPath) - if err != nil { - return err - } - } else { - err = symlinkFile(srcPath, destPath) - if err != nil { - return err - } - } - - } - return -} - // symlinkDirectoriesOnly finds only the first-level child directories in srcDir // and symlinks them into destDir. // Unlike symlinkDir, this is done non-recursively in order to limit the number // of file descriptors used. -func symlinkDirectoriesOnly(srcDir string, destDir string) (err error) { +func symlinkDirectoriesOnly(srcDir string, destDir string) error { srcInfo, err := os.Stat(srcDir) if err != nil { - return err + return fmt.Errorf("unable to stat source directory %q: %w", srcDir, err) } err = os.MkdirAll(destDir, srcInfo.Mode()) if err != nil { - return err + return fmt.Errorf("unable to make destination directory %q: %w", destDir, err) } - directory, err := os.Open(srcDir) - if err != nil { - return err - } - defer directory.Close() - objects, err := directory.Readdir(-1) + dirEntries, err := os.ReadDir(srcDir) + if err != nil { - return err + return fmt.Errorf("unable to read source directory %q: %w", srcDir, err) } - for _, obj := range objects { - srcPath := filepath.Join(srcDir, obj.Name()) - destPath := filepath.Join(destDir, obj.Name()) - - if obj.IsDir() { - err = symlinkFile(srcPath, destPath) - if err != nil { - return err - } + for _, dirEntry := range dirEntries { + if !dirEntry.IsDir() { + continue } + srcPath := filepath.Join(srcDir, dirEntry.Name()) + destPath := filepath.Join(destDir, dirEntry.Name()) + err := symlinkFile(srcPath, destPath) + + if err != nil { + return fmt.Errorf("unable to symlink directory %q to %q: %w", srcPath, destPath, err) + } } - return + + return nil } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/working_dir.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/working_dir.go index ecbf5aac1..159399350 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/working_dir.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/internal/plugintest/working_dir.go @@ -1,11 +1,9 @@ package plugintest import ( - "bytes" "context" "encoding/json" "fmt" - "io/ioutil" "os" "path/filepath" @@ -76,6 +74,8 @@ func (wd *WorkingDir) GetHelper() *Helper { // Destroy to establish the configuration. Any previously-set configuration is // discarded and any saved plan is cleared. func (wd *WorkingDir) SetConfig(ctx context.Context, cfg string) error { + logging.HelperResourceTrace(ctx, "Setting Terraform configuration", map[string]any{logging.KeyTestTerraformConfiguration: cfg}) + outFilename := filepath.Join(wd.baseDir, ConfigFileName) rmFilename := filepath.Join(wd.baseDir, ConfigFileNameJSON) bCfg := []byte(cfg) @@ -85,7 +85,7 @@ func (wd *WorkingDir) SetConfig(ctx context.Context, cfg string) error { if err := os.Remove(rmFilename); err != nil && !os.IsNotExist(err) { return fmt.Errorf("unable to remove %q: %w", rmFilename, err) } - err := ioutil.WriteFile(outFilename, bCfg, 0700) + err := os.WriteFile(outFilename, bCfg, 0700) if err != nil { return err } @@ -174,11 +174,29 @@ func (wd *WorkingDir) planFilename() string { func (wd *WorkingDir) CreatePlan(ctx context.Context) error { logging.HelperResourceTrace(ctx, "Calling Terraform CLI plan command") - _, err := wd.tf.Plan(context.Background(), tfexec.Reattach(wd.reattachInfo), tfexec.Refresh(false), tfexec.Out(PlanFileName)) + hasChanges, err := wd.tf.Plan(context.Background(), tfexec.Reattach(wd.reattachInfo), tfexec.Refresh(false), tfexec.Out(PlanFileName)) logging.HelperResourceTrace(ctx, "Called Terraform CLI plan command") - return err + if err != nil { + return err + } + + if !hasChanges { + logging.HelperResourceTrace(ctx, "Created plan with no changes") + + return nil + } + + stdout, err := wd.SavedPlanRawStdout(ctx) + + if err != nil { + return fmt.Errorf("error retrieving formatted plan output: %w", err) + } + + logging.HelperResourceTrace(ctx, "Created plan with changes", map[string]any{logging.KeyTestTerraformPlan: stdout}) + + return nil } // CreateDestroyPlan runs "terraform plan -destroy" to create a saved plan @@ -186,11 +204,29 @@ func (wd *WorkingDir) CreatePlan(ctx context.Context) error { func (wd *WorkingDir) CreateDestroyPlan(ctx context.Context) error { logging.HelperResourceTrace(ctx, "Calling Terraform CLI plan -destroy command") - _, err := wd.tf.Plan(context.Background(), tfexec.Reattach(wd.reattachInfo), tfexec.Refresh(false), tfexec.Out(PlanFileName), tfexec.Destroy(true)) + hasChanges, err := wd.tf.Plan(context.Background(), tfexec.Reattach(wd.reattachInfo), tfexec.Refresh(false), tfexec.Out(PlanFileName), tfexec.Destroy(true)) logging.HelperResourceTrace(ctx, "Called Terraform CLI plan -destroy command") - return err + if err != nil { + return err + } + + if !hasChanges { + logging.HelperResourceTrace(ctx, "Created destroy plan with no changes") + + return nil + } + + stdout, err := wd.SavedPlanRawStdout(ctx) + + if err != nil { + return fmt.Errorf("error retrieving formatted plan output: %w", err) + } + + logging.HelperResourceTrace(ctx, "Created destroy plan with changes", map[string]any{logging.KeyTestTerraformPlan: stdout}) + + return nil } // Apply runs "terraform apply". If CreatePlan has previously completed @@ -243,11 +279,11 @@ func (wd *WorkingDir) SavedPlan(ctx context.Context) (*tfjson.Plan, error) { return nil, fmt.Errorf("there is no current saved plan") } - logging.HelperResourceTrace(ctx, "Calling Terraform CLI apply command") + logging.HelperResourceTrace(ctx, "Calling Terraform CLI show command for JSON plan") plan, err := wd.tf.ShowPlanFile(context.Background(), wd.planFilename(), tfexec.Reattach(wd.reattachInfo)) - logging.HelperResourceTrace(ctx, "Calling Terraform CLI apply command") + logging.HelperResourceTrace(ctx, "Calling Terraform CLI show command for JSON plan") return plan, err } @@ -261,22 +297,17 @@ func (wd *WorkingDir) SavedPlanRawStdout(ctx context.Context) (string, error) { return "", fmt.Errorf("there is no current saved plan") } - var ret bytes.Buffer - - wd.tf.SetStdout(&ret) - defer wd.tf.SetStdout(ioutil.Discard) - - logging.HelperResourceTrace(ctx, "Calling Terraform CLI show command") + logging.HelperResourceTrace(ctx, "Calling Terraform CLI show command for stdout plan") - _, err := wd.tf.ShowPlanFileRaw(context.Background(), wd.planFilename(), tfexec.Reattach(wd.reattachInfo)) + stdout, err := wd.tf.ShowPlanFileRaw(context.Background(), wd.planFilename(), tfexec.Reattach(wd.reattachInfo)) - logging.HelperResourceTrace(ctx, "Called Terraform CLI show command") + logging.HelperResourceTrace(ctx, "Called Terraform CLI show command for stdout plan") if err != nil { return "", err } - return ret.String(), nil + return stdout, nil } // State returns an object describing the current state. @@ -284,11 +315,11 @@ func (wd *WorkingDir) SavedPlanRawStdout(ctx context.Context) (string, error) { // If the state cannot be read, State returns an error. func (wd *WorkingDir) State(ctx context.Context) (*tfjson.State, error) { - logging.HelperResourceTrace(ctx, "Calling Terraform CLI show command") + logging.HelperResourceTrace(ctx, "Calling Terraform CLI show command for JSON state") state, err := wd.tf.Show(context.Background(), tfexec.Reattach(wd.reattachInfo)) - logging.HelperResourceTrace(ctx, "Called Terraform CLI show command") + logging.HelperResourceTrace(ctx, "Called Terraform CLI show command for JSON state") return state, err } diff --git a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/plugin/serve.go b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/plugin/serve.go index 88975da2c..cce6212b1 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/plugin/serve.go +++ b/vendor/github.com/hashicorp/terraform-plugin-sdk/v2/plugin/serve.go @@ -55,6 +55,10 @@ type ServeOpts struct { // information needed for Terraform to connect to the provider to stdout. // os.Interrupt will be captured and used to stop the server. // + // Ensure the ProviderAddr field is correctly set when this is enabled, + // otherwise the TF_REATTACH_PROVIDERS environment variable will not + // correctly point Terraform to the running provider binary. + // // This option cannot be combined with TestConfig. Debug bool @@ -76,8 +80,11 @@ type ServeOpts struct { // the terraform-plugin-log logging sink. UseTFLogSink testing.T - // ProviderAddr is the address of the provider under test, like - // registry.terraform.io/hashicorp/random. + // ProviderAddr is the address of the provider under test or debugging, + // such as registry.terraform.io/hashicorp/random. This value is used in + // the TF_REATTACH_PROVIDERS environment variable during debugging so + // Terraform can correctly match the provider address in the Terraform + // configuration to the running provider binary. ProviderAddr string } diff --git a/vendor/github.com/hashicorp/terraform-registry-address/LICENSE b/vendor/github.com/hashicorp/terraform-registry-address/LICENSE index c33dcc7c9..84cd06439 100644 --- a/vendor/github.com/hashicorp/terraform-registry-address/LICENSE +++ b/vendor/github.com/hashicorp/terraform-registry-address/LICENSE @@ -1,3 +1,5 @@ +Copyright (c) 2021 HashiCorp, Inc. + Mozilla Public License, version 2.0 1. Definitions diff --git a/vendor/github.com/huandu/xstrings/.travis.yml b/vendor/github.com/huandu/xstrings/.travis.yml deleted file mode 100644 index d6460be41..000000000 --- a/vendor/github.com/huandu/xstrings/.travis.yml +++ /dev/null @@ -1,7 +0,0 @@ -language: go -install: - - go get golang.org/x/tools/cmd/cover - - go get github.com/mattn/goveralls -script: - - go test -v -covermode=count -coverprofile=coverage.out - - 'if [ "$TRAVIS_PULL_REQUEST" = "false" ] && [ ! -z "$COVERALLS_TOKEN" ]; then $HOME/gopath/bin/goveralls -coverprofile=coverage.out -service=travis-ci -repotoken $COVERALLS_TOKEN; fi' diff --git a/vendor/github.com/huandu/xstrings/README.md b/vendor/github.com/huandu/xstrings/README.md index 292bf2f39..750c3c7eb 100644 --- a/vendor/github.com/huandu/xstrings/README.md +++ b/vendor/github.com/huandu/xstrings/README.md @@ -1,7 +1,7 @@ -# xstrings # +# xstrings -[![Build Status](https://travis-ci.org/huandu/xstrings.svg?branch=master)](https://travis-ci.org/huandu/xstrings) -[![GoDoc](https://godoc.org/github.com/huandu/xstrings?status.svg)](https://godoc.org/github.com/huandu/xstrings) +[![Build Status](https://github.com/huandu/xstrings/workflows/Go/badge.svg)](https://github.com/huandu/xstrings/actions) +[![Go Doc](https://godoc.org/github.com/huandu/xstrings?status.svg)](https://pkg.go.dev/github.com/huandu/xstrings) [![Go Report](https://goreportcard.com/badge/github.com/huandu/xstrings)](https://goreportcard.com/report/github.com/huandu/xstrings) [![Coverage Status](https://coveralls.io/repos/github/huandu/xstrings/badge.svg?branch=master)](https://coveralls.io/github/huandu/xstrings?branch=master) @@ -9,109 +9,109 @@ Go package [xstrings](https://godoc.org/github.com/huandu/xstrings) is a collect All functions are well tested and carefully tuned for performance. -## Propose a new function ## +## Propose a new function Please review [contributing guideline](CONTRIBUTING.md) and [create new issue](https://github.com/huandu/xstrings/issues) to state why it should be included. -## Install ## +## Install Use `go get` to install this library. go get github.com/huandu/xstrings -## API document ## +## API document See [GoDoc](https://godoc.org/github.com/huandu/xstrings) for full document. -## Function list ## +## Function list Go functions have a unique naming style. One, who has experience in other language but new in Go, may have difficulties to find out right string function to use. Here is a list of functions in [strings](http://golang.org/pkg/strings) and [xstrings](https://godoc.org/github.com/huandu/xstrings) with enough extra information about how to map these functions to their friends in other languages. Hope this list could be helpful for fresh gophers. -### Package `xstrings` functions ### - -*Keep this table sorted by Function in ascending order.* - -| Function | Friends | # | -| -------- | ------- | --- | -| [Center](https://godoc.org/github.com/huandu/xstrings#Center) | `str.center` in Python; `String#center` in Ruby | [#30](https://github.com/huandu/xstrings/issues/30) | -| [Count](https://godoc.org/github.com/huandu/xstrings#Count) | `String#count` in Ruby | [#16](https://github.com/huandu/xstrings/issues/16) | -| [Delete](https://godoc.org/github.com/huandu/xstrings#Delete) | `String#delete` in Ruby | [#17](https://github.com/huandu/xstrings/issues/17) | -| [ExpandTabs](https://godoc.org/github.com/huandu/xstrings#ExpandTabs) | `str.expandtabs` in Python | [#27](https://github.com/huandu/xstrings/issues/27) | -| [FirstRuneToLower](https://godoc.org/github.com/huandu/xstrings#FirstRuneToLower) | `lcfirst` in PHP or Perl | [#15](https://github.com/huandu/xstrings/issues/15) | -| [FirstRuneToUpper](https://godoc.org/github.com/huandu/xstrings#FirstRuneToUpper) | `String#capitalize` in Ruby; `ucfirst` in PHP or Perl | [#15](https://github.com/huandu/xstrings/issues/15) | -| [Insert](https://godoc.org/github.com/huandu/xstrings#Insert) | `String#insert` in Ruby | [#18](https://github.com/huandu/xstrings/issues/18) | -| [LastPartition](https://godoc.org/github.com/huandu/xstrings#LastPartition) | `str.rpartition` in Python; `String#rpartition` in Ruby | [#19](https://github.com/huandu/xstrings/issues/19) | -| [LeftJustify](https://godoc.org/github.com/huandu/xstrings#LeftJustify) | `str.ljust` in Python; `String#ljust` in Ruby | [#28](https://github.com/huandu/xstrings/issues/28) | -| [Len](https://godoc.org/github.com/huandu/xstrings#Len) | `mb_strlen` in PHP | [#23](https://github.com/huandu/xstrings/issues/23) | -| [Partition](https://godoc.org/github.com/huandu/xstrings#Partition) | `str.partition` in Python; `String#partition` in Ruby | [#10](https://github.com/huandu/xstrings/issues/10) | -| [Reverse](https://godoc.org/github.com/huandu/xstrings#Reverse) | `String#reverse` in Ruby; `strrev` in PHP; `reverse` in Perl | [#7](https://github.com/huandu/xstrings/issues/7) | -| [RightJustify](https://godoc.org/github.com/huandu/xstrings#RightJustify) | `str.rjust` in Python; `String#rjust` in Ruby | [#29](https://github.com/huandu/xstrings/issues/29) | -| [RuneWidth](https://godoc.org/github.com/huandu/xstrings#RuneWidth) | - | [#27](https://github.com/huandu/xstrings/issues/27) | -| [Scrub](https://godoc.org/github.com/huandu/xstrings#Scrub) | `String#scrub` in Ruby | [#20](https://github.com/huandu/xstrings/issues/20) | -| [Shuffle](https://godoc.org/github.com/huandu/xstrings#Shuffle) | `str_shuffle` in PHP | [#13](https://github.com/huandu/xstrings/issues/13) | -| [ShuffleSource](https://godoc.org/github.com/huandu/xstrings#ShuffleSource) | `str_shuffle` in PHP | [#13](https://github.com/huandu/xstrings/issues/13) | -| [Slice](https://godoc.org/github.com/huandu/xstrings#Slice) | `mb_substr` in PHP | [#9](https://github.com/huandu/xstrings/issues/9) | -| [Squeeze](https://godoc.org/github.com/huandu/xstrings#Squeeze) | `String#squeeze` in Ruby | [#11](https://github.com/huandu/xstrings/issues/11) | -| [Successor](https://godoc.org/github.com/huandu/xstrings#Successor) | `String#succ` or `String#next` in Ruby | [#22](https://github.com/huandu/xstrings/issues/22) | -| [SwapCase](https://godoc.org/github.com/huandu/xstrings#SwapCase) | `str.swapcase` in Python; `String#swapcase` in Ruby | [#12](https://github.com/huandu/xstrings/issues/12) | -| [ToCamelCase](https://godoc.org/github.com/huandu/xstrings#ToCamelCase) | `String#camelize` in RoR | [#1](https://github.com/huandu/xstrings/issues/1) | -| [ToKebab](https://godoc.org/github.com/huandu/xstrings#ToKebabCase) | - | [#41](https://github.com/huandu/xstrings/issues/41) | -| [ToSnakeCase](https://godoc.org/github.com/huandu/xstrings#ToSnakeCase) | `String#underscore` in RoR | [#1](https://github.com/huandu/xstrings/issues/1) | -| [Translate](https://godoc.org/github.com/huandu/xstrings#Translate) | `str.translate` in Python; `String#tr` in Ruby; `strtr` in PHP; `tr///` in Perl | [#21](https://github.com/huandu/xstrings/issues/21) | -| [Width](https://godoc.org/github.com/huandu/xstrings#Width) | `mb_strwidth` in PHP | [#26](https://github.com/huandu/xstrings/issues/26) | -| [WordCount](https://godoc.org/github.com/huandu/xstrings#WordCount) | `str_word_count` in PHP | [#14](https://github.com/huandu/xstrings/issues/14) | -| [WordSplit](https://godoc.org/github.com/huandu/xstrings#WordSplit) | - | [#14](https://github.com/huandu/xstrings/issues/14) | - -### Package `strings` functions ### - -*Keep this table sorted by Function in ascending order.* - -| Function | Friends | -| -------- | ------- | -| [Contains](http://golang.org/pkg/strings/#Contains) | `String#include?` in Ruby | -| [ContainsAny](http://golang.org/pkg/strings/#ContainsAny) | - | -| [ContainsRune](http://golang.org/pkg/strings/#ContainsRune) | - | -| [Count](http://golang.org/pkg/strings/#Count) | `str.count` in Python; `substr_count` in PHP | -| [EqualFold](http://golang.org/pkg/strings/#EqualFold) | `stricmp` in PHP; `String#casecmp` in Ruby | -| [Fields](http://golang.org/pkg/strings/#Fields) | `str.split` in Python; `split` in Perl; `String#split` in Ruby | -| [FieldsFunc](http://golang.org/pkg/strings/#FieldsFunc) | - | -| [HasPrefix](http://golang.org/pkg/strings/#HasPrefix) | `str.startswith` in Python; `String#start_with?` in Ruby | -| [HasSuffix](http://golang.org/pkg/strings/#HasSuffix) | `str.endswith` in Python; `String#end_with?` in Ruby | -| [Index](http://golang.org/pkg/strings/#Index) | `str.index` in Python; `String#index` in Ruby; `strpos` in PHP; `index` in Perl | -| [IndexAny](http://golang.org/pkg/strings/#IndexAny) | - | -| [IndexByte](http://golang.org/pkg/strings/#IndexByte) | - | -| [IndexFunc](http://golang.org/pkg/strings/#IndexFunc) | - | -| [IndexRune](http://golang.org/pkg/strings/#IndexRune) | - | -| [Join](http://golang.org/pkg/strings/#Join) | `str.join` in Python; `Array#join` in Ruby; `implode` in PHP; `join` in Perl | -| [LastIndex](http://golang.org/pkg/strings/#LastIndex) | `str.rindex` in Python; `String#rindex`; `strrpos` in PHP; `rindex` in Perl | -| [LastIndexAny](http://golang.org/pkg/strings/#LastIndexAny) | - | -| [LastIndexFunc](http://golang.org/pkg/strings/#LastIndexFunc) | - | -| [Map](http://golang.org/pkg/strings/#Map) | `String#each_codepoint` in Ruby | -| [Repeat](http://golang.org/pkg/strings/#Repeat) | operator `*` in Python and Ruby; `str_repeat` in PHP | -| [Replace](http://golang.org/pkg/strings/#Replace) | `str.replace` in Python; `String#sub` in Ruby; `str_replace` in PHP | -| [Split](http://golang.org/pkg/strings/#Split) | `str.split` in Python; `String#split` in Ruby; `explode` in PHP; `split` in Perl | -| [SplitAfter](http://golang.org/pkg/strings/#SplitAfter) | - | -| [SplitAfterN](http://golang.org/pkg/strings/#SplitAfterN) | - | -| [SplitN](http://golang.org/pkg/strings/#SplitN) | `str.split` in Python; `String#split` in Ruby; `explode` in PHP; `split` in Perl | -| [Title](http://golang.org/pkg/strings/#Title) | `str.title` in Python | -| [ToLower](http://golang.org/pkg/strings/#ToLower) | `str.lower` in Python; `String#downcase` in Ruby; `strtolower` in PHP; `lc` in Perl | -| [ToLowerSpecial](http://golang.org/pkg/strings/#ToLowerSpecial) | - | -| [ToTitle](http://golang.org/pkg/strings/#ToTitle) | - | -| [ToTitleSpecial](http://golang.org/pkg/strings/#ToTitleSpecial) | - | -| [ToUpper](http://golang.org/pkg/strings/#ToUpper) | `str.upper` in Python; `String#upcase` in Ruby; `strtoupper` in PHP; `uc` in Perl | -| [ToUpperSpecial](http://golang.org/pkg/strings/#ToUpperSpecial) | - | -| [Trim](http://golang.org/pkg/strings/#Trim) | `str.strip` in Python; `String#strip` in Ruby; `trim` in PHP | -| [TrimFunc](http://golang.org/pkg/strings/#TrimFunc) | - | -| [TrimLeft](http://golang.org/pkg/strings/#TrimLeft) | `str.lstrip` in Python; `String#lstrip` in Ruby; `ltrim` in PHP | -| [TrimLeftFunc](http://golang.org/pkg/strings/#TrimLeftFunc) | - | -| [TrimPrefix](http://golang.org/pkg/strings/#TrimPrefix) | - | -| [TrimRight](http://golang.org/pkg/strings/#TrimRight) | `str.rstrip` in Python; `String#rstrip` in Ruby; `rtrim` in PHP | -| [TrimRightFunc](http://golang.org/pkg/strings/#TrimRightFunc) | - | -| [TrimSpace](http://golang.org/pkg/strings/#TrimSpace) | `str.strip` in Python; `String#strip` in Ruby; `trim` in PHP | -| [TrimSuffix](http://golang.org/pkg/strings/#TrimSuffix) | `String#chomp` in Ruby; `chomp` in Perl | - -## License ## +### Package `xstrings` functions + +_Keep this table sorted by Function in ascending order._ + +| Function | Friends | # | +| --------------------------------------------------------------------------------- | ------------------------------------------------------------------------------- | --------------------------------------------------- | +| [Center](https://godoc.org/github.com/huandu/xstrings#Center) | `str.center` in Python; `String#center` in Ruby | [#30](https://github.com/huandu/xstrings/issues/30) | +| [Count](https://godoc.org/github.com/huandu/xstrings#Count) | `String#count` in Ruby | [#16](https://github.com/huandu/xstrings/issues/16) | +| [Delete](https://godoc.org/github.com/huandu/xstrings#Delete) | `String#delete` in Ruby | [#17](https://github.com/huandu/xstrings/issues/17) | +| [ExpandTabs](https://godoc.org/github.com/huandu/xstrings#ExpandTabs) | `str.expandtabs` in Python | [#27](https://github.com/huandu/xstrings/issues/27) | +| [FirstRuneToLower](https://godoc.org/github.com/huandu/xstrings#FirstRuneToLower) | `lcfirst` in PHP or Perl | [#15](https://github.com/huandu/xstrings/issues/15) | +| [FirstRuneToUpper](https://godoc.org/github.com/huandu/xstrings#FirstRuneToUpper) | `String#capitalize` in Ruby; `ucfirst` in PHP or Perl | [#15](https://github.com/huandu/xstrings/issues/15) | +| [Insert](https://godoc.org/github.com/huandu/xstrings#Insert) | `String#insert` in Ruby | [#18](https://github.com/huandu/xstrings/issues/18) | +| [LastPartition](https://godoc.org/github.com/huandu/xstrings#LastPartition) | `str.rpartition` in Python; `String#rpartition` in Ruby | [#19](https://github.com/huandu/xstrings/issues/19) | +| [LeftJustify](https://godoc.org/github.com/huandu/xstrings#LeftJustify) | `str.ljust` in Python; `String#ljust` in Ruby | [#28](https://github.com/huandu/xstrings/issues/28) | +| [Len](https://godoc.org/github.com/huandu/xstrings#Len) | `mb_strlen` in PHP | [#23](https://github.com/huandu/xstrings/issues/23) | +| [Partition](https://godoc.org/github.com/huandu/xstrings#Partition) | `str.partition` in Python; `String#partition` in Ruby | [#10](https://github.com/huandu/xstrings/issues/10) | +| [Reverse](https://godoc.org/github.com/huandu/xstrings#Reverse) | `String#reverse` in Ruby; `strrev` in PHP; `reverse` in Perl | [#7](https://github.com/huandu/xstrings/issues/7) | +| [RightJustify](https://godoc.org/github.com/huandu/xstrings#RightJustify) | `str.rjust` in Python; `String#rjust` in Ruby | [#29](https://github.com/huandu/xstrings/issues/29) | +| [RuneWidth](https://godoc.org/github.com/huandu/xstrings#RuneWidth) | - | [#27](https://github.com/huandu/xstrings/issues/27) | +| [Scrub](https://godoc.org/github.com/huandu/xstrings#Scrub) | `String#scrub` in Ruby | [#20](https://github.com/huandu/xstrings/issues/20) | +| [Shuffle](https://godoc.org/github.com/huandu/xstrings#Shuffle) | `str_shuffle` in PHP | [#13](https://github.com/huandu/xstrings/issues/13) | +| [ShuffleSource](https://godoc.org/github.com/huandu/xstrings#ShuffleSource) | `str_shuffle` in PHP | [#13](https://github.com/huandu/xstrings/issues/13) | +| [Slice](https://godoc.org/github.com/huandu/xstrings#Slice) | `mb_substr` in PHP | [#9](https://github.com/huandu/xstrings/issues/9) | +| [Squeeze](https://godoc.org/github.com/huandu/xstrings#Squeeze) | `String#squeeze` in Ruby | [#11](https://github.com/huandu/xstrings/issues/11) | +| [Successor](https://godoc.org/github.com/huandu/xstrings#Successor) | `String#succ` or `String#next` in Ruby | [#22](https://github.com/huandu/xstrings/issues/22) | +| [SwapCase](https://godoc.org/github.com/huandu/xstrings#SwapCase) | `str.swapcase` in Python; `String#swapcase` in Ruby | [#12](https://github.com/huandu/xstrings/issues/12) | +| [ToCamelCase](https://godoc.org/github.com/huandu/xstrings#ToCamelCase) | `String#camelize` in RoR | [#1](https://github.com/huandu/xstrings/issues/1) | +| [ToKebab](https://godoc.org/github.com/huandu/xstrings#ToKebabCase) | - | [#41](https://github.com/huandu/xstrings/issues/41) | +| [ToSnakeCase](https://godoc.org/github.com/huandu/xstrings#ToSnakeCase) | `String#underscore` in RoR | [#1](https://github.com/huandu/xstrings/issues/1) | +| [Translate](https://godoc.org/github.com/huandu/xstrings#Translate) | `str.translate` in Python; `String#tr` in Ruby; `strtr` in PHP; `tr///` in Perl | [#21](https://github.com/huandu/xstrings/issues/21) | +| [Width](https://godoc.org/github.com/huandu/xstrings#Width) | `mb_strwidth` in PHP | [#26](https://github.com/huandu/xstrings/issues/26) | +| [WordCount](https://godoc.org/github.com/huandu/xstrings#WordCount) | `str_word_count` in PHP | [#14](https://github.com/huandu/xstrings/issues/14) | +| [WordSplit](https://godoc.org/github.com/huandu/xstrings#WordSplit) | - | [#14](https://github.com/huandu/xstrings/issues/14) | + +### Package `strings` functions + +_Keep this table sorted by Function in ascending order._ + +| Function | Friends | +| --------------------------------------------------------------- | ----------------------------------------------------------------------------------- | +| [Contains](http://golang.org/pkg/strings/#Contains) | `String#include?` in Ruby | +| [ContainsAny](http://golang.org/pkg/strings/#ContainsAny) | - | +| [ContainsRune](http://golang.org/pkg/strings/#ContainsRune) | - | +| [Count](http://golang.org/pkg/strings/#Count) | `str.count` in Python; `substr_count` in PHP | +| [EqualFold](http://golang.org/pkg/strings/#EqualFold) | `stricmp` in PHP; `String#casecmp` in Ruby | +| [Fields](http://golang.org/pkg/strings/#Fields) | `str.split` in Python; `split` in Perl; `String#split` in Ruby | +| [FieldsFunc](http://golang.org/pkg/strings/#FieldsFunc) | - | +| [HasPrefix](http://golang.org/pkg/strings/#HasPrefix) | `str.startswith` in Python; `String#start_with?` in Ruby | +| [HasSuffix](http://golang.org/pkg/strings/#HasSuffix) | `str.endswith` in Python; `String#end_with?` in Ruby | +| [Index](http://golang.org/pkg/strings/#Index) | `str.index` in Python; `String#index` in Ruby; `strpos` in PHP; `index` in Perl | +| [IndexAny](http://golang.org/pkg/strings/#IndexAny) | - | +| [IndexByte](http://golang.org/pkg/strings/#IndexByte) | - | +| [IndexFunc](http://golang.org/pkg/strings/#IndexFunc) | - | +| [IndexRune](http://golang.org/pkg/strings/#IndexRune) | - | +| [Join](http://golang.org/pkg/strings/#Join) | `str.join` in Python; `Array#join` in Ruby; `implode` in PHP; `join` in Perl | +| [LastIndex](http://golang.org/pkg/strings/#LastIndex) | `str.rindex` in Python; `String#rindex`; `strrpos` in PHP; `rindex` in Perl | +| [LastIndexAny](http://golang.org/pkg/strings/#LastIndexAny) | - | +| [LastIndexFunc](http://golang.org/pkg/strings/#LastIndexFunc) | - | +| [Map](http://golang.org/pkg/strings/#Map) | `String#each_codepoint` in Ruby | +| [Repeat](http://golang.org/pkg/strings/#Repeat) | operator `*` in Python and Ruby; `str_repeat` in PHP | +| [Replace](http://golang.org/pkg/strings/#Replace) | `str.replace` in Python; `String#sub` in Ruby; `str_replace` in PHP | +| [Split](http://golang.org/pkg/strings/#Split) | `str.split` in Python; `String#split` in Ruby; `explode` in PHP; `split` in Perl | +| [SplitAfter](http://golang.org/pkg/strings/#SplitAfter) | - | +| [SplitAfterN](http://golang.org/pkg/strings/#SplitAfterN) | - | +| [SplitN](http://golang.org/pkg/strings/#SplitN) | `str.split` in Python; `String#split` in Ruby; `explode` in PHP; `split` in Perl | +| [Title](http://golang.org/pkg/strings/#Title) | `str.title` in Python | +| [ToLower](http://golang.org/pkg/strings/#ToLower) | `str.lower` in Python; `String#downcase` in Ruby; `strtolower` in PHP; `lc` in Perl | +| [ToLowerSpecial](http://golang.org/pkg/strings/#ToLowerSpecial) | - | +| [ToTitle](http://golang.org/pkg/strings/#ToTitle) | - | +| [ToTitleSpecial](http://golang.org/pkg/strings/#ToTitleSpecial) | - | +| [ToUpper](http://golang.org/pkg/strings/#ToUpper) | `str.upper` in Python; `String#upcase` in Ruby; `strtoupper` in PHP; `uc` in Perl | +| [ToUpperSpecial](http://golang.org/pkg/strings/#ToUpperSpecial) | - | +| [Trim](http://golang.org/pkg/strings/#Trim) | `str.strip` in Python; `String#strip` in Ruby; `trim` in PHP | +| [TrimFunc](http://golang.org/pkg/strings/#TrimFunc) | - | +| [TrimLeft](http://golang.org/pkg/strings/#TrimLeft) | `str.lstrip` in Python; `String#lstrip` in Ruby; `ltrim` in PHP | +| [TrimLeftFunc](http://golang.org/pkg/strings/#TrimLeftFunc) | - | +| [TrimPrefix](http://golang.org/pkg/strings/#TrimPrefix) | - | +| [TrimRight](http://golang.org/pkg/strings/#TrimRight) | `str.rstrip` in Python; `String#rstrip` in Ruby; `rtrim` in PHP | +| [TrimRightFunc](http://golang.org/pkg/strings/#TrimRightFunc) | - | +| [TrimSpace](http://golang.org/pkg/strings/#TrimSpace) | `str.strip` in Python; `String#strip` in Ruby; `trim` in PHP | +| [TrimSuffix](http://golang.org/pkg/strings/#TrimSuffix) | `String#chomp` in Ruby; `chomp` in Perl | + +## License This library is licensed under MIT license. See LICENSE for details. diff --git a/vendor/github.com/huandu/xstrings/convert.go b/vendor/github.com/huandu/xstrings/convert.go index 3d5a34950..151c3151d 100644 --- a/vendor/github.com/huandu/xstrings/convert.go +++ b/vendor/github.com/huandu/xstrings/convert.go @@ -130,7 +130,7 @@ func camelCaseToLowerCase(str string, connector rune) string { wt, word, remaining = nextWord(remaining) } - if wt != invalidWord && wt != punctWord { + if wt != invalidWord && wt != punctWord && wt != connectorWord { buf.WriteRune(connector) } diff --git a/vendor/github.com/zclconf/go-cty/cty/convert/conversion.go b/vendor/github.com/zclconf/go-cty/cty/convert/conversion.go index ededc5f37..541b9a490 100644 --- a/vendor/github.com/zclconf/go-cty/cty/convert/conversion.go +++ b/vendor/github.com/zclconf/go-cty/cty/convert/conversion.go @@ -43,14 +43,14 @@ func getConversion(in cty.Type, out cty.Type, unsafe bool) conversion { out = out.WithoutOptionalAttributesDeep() if !isKnown { - return cty.UnknownVal(out), nil + return cty.UnknownVal(dynamicReplace(in.Type(), out)), nil } if isNull { // We'll pass through nulls, albeit type converted, and let // the caller deal with whatever handling they want to do in // case null values are considered valid in some applications. - return cty.NullVal(out), nil + return cty.NullVal(dynamicReplace(in.Type(), out)), nil } } diff --git a/vendor/github.com/zclconf/go-cty/cty/convert/conversion_collection.go b/vendor/github.com/zclconf/go-cty/cty/convert/conversion_collection.go index e70b0184c..05399c9a6 100644 --- a/vendor/github.com/zclconf/go-cty/cty/convert/conversion_collection.go +++ b/vendor/github.com/zclconf/go-cty/cty/convert/conversion_collection.go @@ -39,6 +39,11 @@ func conversionCollectionToList(ety cty.Type, conv conversion) conversion { return cty.NilVal, err } } + + if val.IsNull() { + val = cty.NullVal(val.Type().WithoutOptionalAttributesDeep()) + } + elems = append(elems, val) i++ @@ -50,7 +55,7 @@ func conversionCollectionToList(ety cty.Type, conv conversion) conversion { if ety == cty.DynamicPseudoType { return cty.ListValEmpty(val.Type().ElementType()), nil } - return cty.ListValEmpty(ety), nil + return cty.ListValEmpty(ety.WithoutOptionalAttributesDeep()), nil } if !cty.CanListVal(elems) { @@ -88,6 +93,11 @@ func conversionCollectionToSet(ety cty.Type, conv conversion) conversion { return cty.NilVal, err } } + + if val.IsNull() { + val = cty.NullVal(val.Type().WithoutOptionalAttributesDeep()) + } + elems = append(elems, val) i++ @@ -99,7 +109,7 @@ func conversionCollectionToSet(ety cty.Type, conv conversion) conversion { if ety == cty.DynamicPseudoType { return cty.SetValEmpty(val.Type().ElementType()), nil } - return cty.SetValEmpty(ety), nil + return cty.SetValEmpty(ety.WithoutOptionalAttributesDeep()), nil } if !cty.CanSetVal(elems) { @@ -180,7 +190,7 @@ func conversionTupleToSet(tupleType cty.Type, setEty cty.Type, unsafe bool) conv if len(tupleEtys) == 0 { // Empty tuple short-circuit return func(val cty.Value, path cty.Path) (cty.Value, error) { - return cty.SetValEmpty(setEty), nil + return cty.SetValEmpty(setEty.WithoutOptionalAttributesDeep()), nil } } @@ -242,6 +252,11 @@ func conversionTupleToSet(tupleType cty.Type, setEty cty.Type, unsafe bool) conv return cty.NilVal, err } } + + if val.IsNull() { + val = cty.NullVal(val.Type().WithoutOptionalAttributesDeep()) + } + elems = append(elems, val) i++ @@ -265,7 +280,7 @@ func conversionTupleToList(tupleType cty.Type, listEty cty.Type, unsafe bool) co if len(tupleEtys) == 0 { // Empty tuple short-circuit return func(val cty.Value, path cty.Path) (cty.Value, error) { - return cty.ListValEmpty(listEty), nil + return cty.ListValEmpty(listEty.WithoutOptionalAttributesDeep()), nil } } @@ -357,7 +372,7 @@ func conversionObjectToMap(objectType cty.Type, mapEty cty.Type, unsafe bool) co if len(objectAtys) == 0 { // Empty object short-circuit return func(val cty.Value, path cty.Path) (cty.Value, error) { - return cty.MapValEmpty(mapEty), nil + return cty.MapValEmpty(mapEty.WithoutOptionalAttributesDeep()), nil } } @@ -448,13 +463,28 @@ func conversionMapToObject(mapType cty.Type, objType cty.Type, unsafe bool) conv elemConvs[name] = getConversion(mapEty, objectAty, unsafe) if elemConvs[name] == nil { - // If any of our element conversions are impossible, then the our - // whole conversion is impossible. + // This means that this conversion is impossible. Typically, we + // would give up at this point and declare the whole conversion + // impossible. But, if this attribute is optional then maybe we will + // be able to do this conversion anyway provided the actual concrete + // map doesn't have this value set. + // + // We only do this in "unsafe" mode, because we cannot guarantee + // that the returned conversion will actually succeed once applied. + if objType.AttributeOptional(name) && unsafe { + // This attribute is optional, so let's leave this conversion in + // as a nil, and we can error later if we actually have to + // convert this. + continue + } + + // Otherwise, give up. This conversion is impossible as we have a + // required attribute that doesn't match the map's inner type. return nil } } - // If we fall out here then a conversion is possible, using the + // If we fall out here then a conversion may be possible, using the // element conversions in elemConvs return func(val cty.Value, path cty.Path) (cty.Value, error) { elems := make(map[string]cty.Value, len(elemConvs)) @@ -474,12 +504,43 @@ func conversionMapToObject(mapType cty.Type, objType cty.Type, unsafe bool) conv Key: name, } - conv := elemConvs[name.AsString()] - if conv != nil { + // There are 3 cases here: + // 1. This attribute is not in elemConvs + // 2. This attribute is in elemConvs and is not nil + // 3. This attribute is in elemConvs and is nil. + + // In case 1, we do not enter any of the branches below. This case + // means the attribute type is the same between the map and the + // object, and we don't need to do any conversion. + + if conv, ok := elemConvs[name.AsString()]; conv != nil { + // This is case 2. The attribute type is different between the + // map and the object, and we know how to convert between them. + // So, we reset val to be the converted value and carry on. val, err = conv(val, elemPath) if err != nil { return cty.NilVal, err } + } else if ok { + // This is case 3 and it is an error. The attribute types are + // different between the map and the object, but we cannot + // convert between them. + // + // Now typically, this would be picked earlier on when we were + // building elemConvs. However, in the case of optional + // attributes there was a chance we could still convert the + // overall object even if this particular attribute was not + // convertable. This is because it could have not been set in + // the map, and we could skip over it here and set a null value. + // + // Since we reached this branch, we know that map did actually + // contain a non-convertable optional attribute. This means we + // error. + return cty.NilVal, path.NewErrorf("map element type is incompatible with attribute %q: %s", name.AsString(), MismatchMessage(val.Type(), objType.AttributeType(name.AsString()))) + } + + if val.IsNull() { + val = cty.NullVal(val.Type().WithoutOptionalAttributesDeep()) } elems[name.AsString()] = val diff --git a/vendor/github.com/zclconf/go-cty/cty/convert/conversion_dynamic.go b/vendor/github.com/zclconf/go-cty/cty/convert/conversion_dynamic.go index 4d19cf6c5..3b554e01b 100644 --- a/vendor/github.com/zclconf/go-cty/cty/convert/conversion_dynamic.go +++ b/vendor/github.com/zclconf/go-cty/cty/convert/conversion_dynamic.go @@ -31,3 +31,107 @@ func dynamicFixup(wantType cty.Type) conversion { func dynamicPassthrough(in cty.Value, path cty.Path) (cty.Value, error) { return in, nil } + +// dynamicReplace aims to return the out type unchanged, but if it finds a +// dynamic type either directly or in any descendent elements it replaces them +// with the equivalent type from in. +// +// This function assumes that in and out are compatible from a Convert +// perspective, and will panic if it finds that they are not. For example if +// in is an object and out is a map, this function will still attempt to iterate +// through both as if they were the same. +func dynamicReplace(in, out cty.Type) cty.Type { + if in == cty.DynamicPseudoType || in == cty.NilType { + // Short circuit this case, there's no point worrying about this if in + // is a dynamic type or a nil type. Out is the best we can do. + return out + } + + switch { + case out == cty.DynamicPseudoType: + // So replace out with in. + return in + case out.IsPrimitiveType(), out.IsCapsuleType(): + // out is not dynamic and it doesn't contain descendent elements so just + // return it unchanged. + return out + case out.IsMapType(): + var elemType cty.Type + + // Maps are compatible with other maps or objects. + if in.IsMapType() { + elemType = dynamicReplace(in.ElementType(), out.ElementType()) + } + + if in.IsObjectType() { + var types []cty.Type + for _, t := range in.AttributeTypes() { + types = append(types, t) + } + unifiedType, _ := unify(types, true) + elemType = dynamicReplace(unifiedType, out.ElementType()) + } + + return cty.Map(elemType) + case out.IsObjectType(): + // Objects are compatible with other objects and maps. + outTypes := map[string]cty.Type{} + if in.IsMapType() { + for attr, attrType := range out.AttributeTypes() { + outTypes[attr] = dynamicReplace(in.ElementType(), attrType) + } + } + + if in.IsObjectType() { + for attr, attrType := range out.AttributeTypes() { + if !in.HasAttribute(attr) { + // If in does not have this attribute, then it is an + // optional attribute and there is nothing we can do except + // to return the type from out even if it is dynamic. + outTypes[attr] = attrType + continue + } + outTypes[attr] = dynamicReplace(in.AttributeType(attr), attrType) + } + } + + return cty.Object(outTypes) + case out.IsSetType(): + var elemType cty.Type + + // Sets are compatible with other sets, lists, tuples. + if in.IsSetType() || in.IsListType() { + elemType = dynamicReplace(in.ElementType(), out.ElementType()) + } + + if in.IsTupleType() { + unifiedType, _ := unify(in.TupleElementTypes(), true) + elemType = dynamicReplace(unifiedType, out.ElementType()) + } + + return cty.Set(elemType) + case out.IsListType(): + var elemType cty.Type + + // Lists are compatible with other lists, sets, and tuples. + if in.IsSetType() || in.IsListType() { + elemType = dynamicReplace(in.ElementType(), out.ElementType()) + } + + if in.IsTupleType() { + unifiedType, _ := unify(in.TupleElementTypes(), true) + elemType = dynamicReplace(unifiedType, out.ElementType()) + } + + return cty.List(elemType) + case out.IsTupleType(): + // Tuples are only compatible with other tuples + var types []cty.Type + for ix := 0; ix < len(out.TupleElementTypes()); ix++ { + types = append(types, dynamicReplace(in.TupleElementType(ix), out.TupleElementType(ix))) + } + return cty.Tuple(types) + default: + panic("unrecognized type " + out.FriendlyName()) + } +} diff --git a/vendor/github.com/zclconf/go-cty/cty/convert/conversion_object.go b/vendor/github.com/zclconf/go-cty/cty/convert/conversion_object.go index 098c109bd..51958ef4b 100644 --- a/vendor/github.com/zclconf/go-cty/cty/convert/conversion_object.go +++ b/vendor/github.com/zclconf/go-cty/cty/convert/conversion_object.go @@ -80,13 +80,19 @@ func conversionObjectToObject(in, out cty.Type, unsafe bool) conversion { } } + if val.IsNull() { + // Strip optional attributes out of the embedded type for null + // values. + val = cty.NullVal(val.Type().WithoutOptionalAttributesDeep()) + } + attrVals[name] = val } for name := range outOptionals { if _, exists := attrVals[name]; !exists { wantTy := outAtys[name] - attrVals[name] = cty.NullVal(wantTy) + attrVals[name] = cty.NullVal(wantTy.WithoutOptionalAttributesDeep()) } } diff --git a/vendor/github.com/zclconf/go-cty/cty/convert/public.go b/vendor/github.com/zclconf/go-cty/cty/convert/public.go index af19bdc50..aab0d0ec9 100644 --- a/vendor/github.com/zclconf/go-cty/cty/convert/public.go +++ b/vendor/github.com/zclconf/go-cty/cty/convert/public.go @@ -40,7 +40,7 @@ func GetConversionUnsafe(in cty.Type, out cty.Type) Conversion { // This is a convenience wrapper around calling GetConversionUnsafe and then // immediately passing the given value to the resulting function. func Convert(in cty.Value, want cty.Type) (cty.Value, error) { - if in.Type().Equals(want) { + if in.Type().Equals(want.WithoutOptionalAttributesDeep()) { return in, nil } diff --git a/vendor/github.com/zclconf/go-cty/cty/function/argument.go b/vendor/github.com/zclconf/go-cty/cty/function/argument.go index 5a26c275f..61a1cf97d 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/argument.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/argument.go @@ -10,6 +10,9 @@ type Parameter struct { // value, but callers may use it for documentation, etc. Name string + // Description is an optional description for the argument. + Description string + // A type that any argument for this parameter must conform to. // cty.DynamicPseudoType can be used, either at top-level or nested // in a parameterized type, to indicate that any type should be diff --git a/vendor/github.com/zclconf/go-cty/cty/function/function.go b/vendor/github.com/zclconf/go-cty/cty/function/function.go index c00a0e7f8..c4d99f6c9 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/function.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/function.go @@ -14,6 +14,9 @@ type Function struct { // Spec is the specification of a function, used to instantiate // a new Function. type Spec struct { + // Description is an optional description for the function specification. + Description string + // Params is a description of the positional parameters for the function. // The standard checking logic rejects any calls that do not provide // arguments conforming to this definition, freeing the function @@ -344,3 +347,62 @@ func (f Function) VarParam() *Parameter { ret := *f.spec.VarParam return &ret } + +// Description returns a human-readable description of the function. +func (f Function) Description() string { + return f.spec.Description +} + +// WithNewDescriptions returns a new function that has the same signature +// and implementation as the receiver but has the function description and +// the parameter descriptions replaced with those given in the arguments. +// +// All descriptions may be given as an empty string to specify that there +// should be no description at all. +// +// The paramDescs argument must match the number of parameters +// the reciever expects, or this function will panic. If the function has a +// VarParam then that counts as one parameter for the sake of this rule. The +// given descriptions will be assigned in order starting with the positional +// arguments in their declared order, followed by the variadic parameter if +// any. +// +// As a special case, WithNewDescriptions will accept a paramDescs which +// does not cover the reciever's variadic parameter (if any), so that it's +// possible to add a variadic parameter to a function which didn't previously +// have one without that being a breaking change for an existing caller using +// WithNewDescriptions against that function. In this case the base description +// of the variadic parameter will be preserved. +func (f Function) WithNewDescriptions(funcDesc string, paramDescs []string) Function { + retSpec := *f.spec // shallow copy of the reciever + retSpec.Description = funcDesc + + retSpec.Params = make([]Parameter, len(f.spec.Params)) + copy(retSpec.Params, f.spec.Params) // shallow copy of positional parameters + if f.spec.VarParam != nil { + retVarParam := *f.spec.VarParam // shallow copy of variadic parameter + retSpec.VarParam = &retVarParam + } + + if retSpec.VarParam != nil { + if with, without := len(retSpec.Params)+1, len(retSpec.Params); len(paramDescs) != with && len(paramDescs) != without { + panic(fmt.Sprintf("paramDescs must have length of either %d or %d", with, without)) + } + } else { + if want := len(retSpec.Params); len(paramDescs) != want { + panic(fmt.Sprintf("paramDescs must have length %d", want)) + } + } + + posParamDescs := paramDescs[:len(retSpec.Params)] + varParamDescs := paramDescs[len(retSpec.Params):] // guaranteed to be zero or one elements because of the rules above + + for i, desc := range posParamDescs { + retSpec.Params[i].Description = desc + } + for _, desc := range varParamDescs { + retSpec.VarParam.Description = desc + } + + return New(&retSpec) +} diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bool.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bool.go index 4f1ecc8d9..8192d8ce8 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bool.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bool.go @@ -6,6 +6,7 @@ import ( ) var NotFunc = function.New(&function.Spec{ + Description: `Applies the logical NOT operation to the given boolean value.`, Params: []function.Parameter{ { Name: "val", @@ -21,6 +22,7 @@ var NotFunc = function.New(&function.Spec{ }) var AndFunc = function.New(&function.Spec{ + Description: `Applies the logical AND operation to the given boolean values.`, Params: []function.Parameter{ { Name: "a", @@ -42,6 +44,7 @@ var AndFunc = function.New(&function.Spec{ }) var OrFunc = function.New(&function.Spec{ + Description: `Applies the logical OR operation to the given boolean values.`, Params: []function.Parameter{ { Name: "a", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bytes.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bytes.go index a132e0cde..3fe600ff1 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bytes.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/bytes.go @@ -30,6 +30,7 @@ func BytesVal(buf []byte) cty.Value { // BytesLen is a Function that returns the length of the buffer encapsulated // in a Bytes value. var BytesLenFunc = function.New(&function.Spec{ + Description: `Returns the total number of bytes in the given buffer.`, Params: []function.Parameter{ { Name: "buf", @@ -46,6 +47,7 @@ var BytesLenFunc = function.New(&function.Spec{ // BytesSlice is a Function that returns a slice of the given Bytes value. var BytesSliceFunc = function.New(&function.Spec{ + Description: `Extracts a subslice from the given buffer.`, Params: []function.Parameter{ { Name: "buf", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/collection.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/collection.go index a91821e94..0573e74e3 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/collection.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/collection.go @@ -12,6 +12,7 @@ import ( ) var HasIndexFunc = function.New(&function.Spec{ + Description: `Returns true if if the given collection can be indexed with the given key without producing an error, or false otherwise.`, Params: []function.Parameter{ { Name: "collection", @@ -37,6 +38,7 @@ var HasIndexFunc = function.New(&function.Spec{ }) var IndexFunc = function.New(&function.Spec{ + Description: `Returns the element with the given key from the given collection, or raises an error if there is no such element.`, Params: []function.Parameter{ { Name: "collection", @@ -106,6 +108,7 @@ var IndexFunc = function.New(&function.Spec{ }) var LengthFunc = function.New(&function.Spec{ + Description: `Returns the number of elements in the given collection.`, Params: []function.Parameter{ { Name: "collection", @@ -127,6 +130,7 @@ var LengthFunc = function.New(&function.Spec{ }) var ElementFunc = function.New(&function.Spec{ + Description: `Returns the element with the given index from the given list or tuple, applying the modulo operation to the given index if it's greater than the number of elements.`, Params: []function.Parameter{ { Name: "list", @@ -206,9 +210,11 @@ var ElementFunc = function.New(&function.Spec{ // CoalesceListFunc is a function that takes any number of list arguments // and returns the first one that isn't empty. var CoalesceListFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Returns the first of the given sequences that has a length greater than zero.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "vals", + Description: `List or tuple values to test in the given order.`, Type: cty.DynamicPseudoType, AllowUnknown: true, AllowDynamicType: true, @@ -270,6 +276,7 @@ var CoalesceListFunc = function.New(&function.Spec{ // CompactFunc is a function that takes a list of strings and returns a new list // with any empty string elements removed. var CompactFunc = function.New(&function.Spec{ + Description: `Removes all empty string elements from the given list of strings.`, Params: []function.Parameter{ { Name: "list", @@ -306,6 +313,7 @@ var CompactFunc = function.New(&function.Spec{ // ContainsFunc is a function that determines whether a given list or // set contains a given single value as one of its elements. var ContainsFunc = function.New(&function.Spec{ + Description: `Returns true if the given value is a value in the given list, tuple, or set, or false otherwise.`, Params: []function.Parameter{ { Name: "list", @@ -364,6 +372,7 @@ var ContainsFunc = function.New(&function.Spec{ // DistinctFunc is a function that takes a list and returns a new list // with any duplicate elements removed. var DistinctFunc = function.New(&function.Spec{ + Description: `Removes any duplicate values from the given list, preserving the order of remaining elements.`, Params: []function.Parameter{ { Name: "list", @@ -399,14 +408,17 @@ var DistinctFunc = function.New(&function.Spec{ // ChunklistFunc is a function that splits a single list into fixed-size chunks, // returning a list of lists. var ChunklistFunc = function.New(&function.Spec{ + Description: `Splits a single list into multiple lists where each has at most the given number of elements.`, Params: []function.Parameter{ { Name: "list", + Description: `The list to split into chunks.`, Type: cty.List(cty.DynamicPseudoType), AllowMarked: true, }, { Name: "size", + Description: `The maximum length of each chunk. All but the last element of the result is guaranteed to be of exactly this size.`, Type: cty.Number, AllowMarked: true, }, @@ -471,6 +483,7 @@ var ChunklistFunc = function.New(&function.Spec{ // FlattenFunc is a function that takes a list and replaces any elements // that are lists with a flattened sequence of the list contents. var FlattenFunc = function.New(&function.Spec{ + Description: `Transforms a list, set, or tuple value into a tuple by replacing any given elements that are themselves sequences with a flattened tuple of all of the nested elements concatenated together.`, Params: []function.Parameter{ { Name: "list", @@ -567,9 +580,11 @@ func flattener(flattenList cty.Value) ([]cty.Value, []cty.ValueMarks, bool) { // KeysFunc is a function that takes a map and returns a sorted list of the map keys. var KeysFunc = function.New(&function.Spec{ + Description: `Returns a list of the keys of the given map in lexicographical order.`, Params: []function.Parameter{ { Name: "inputMap", + Description: `The map to extract keys from. May instead be an object-typed value, in which case the result is a tuple of the object attributes.`, Type: cty.DynamicPseudoType, AllowUnknown: true, AllowMarked: true, @@ -642,6 +657,7 @@ var KeysFunc = function.New(&function.Spec{ // LookupFunc is a function that performs dynamic lookups of map types. var LookupFunc = function.New(&function.Spec{ + Description: `Returns the value of the element with the given key from the given map, or returns the default value if there is no such element.`, Params: []function.Parameter{ { Name: "inputMap", @@ -734,7 +750,8 @@ var LookupFunc = function.New(&function.Spec{ // If more than one given map or object defines the same key then the one that // is later in the argument sequence takes precedence. var MergeFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Merges all of the elements from the given maps into a single map, or the attributes from given objects into a single object.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "maps", Type: cty.DynamicPseudoType, @@ -850,6 +867,7 @@ var MergeFunc = function.New(&function.Spec{ // ReverseListFunc takes a sequence and produces a new sequence of the same length // with all of the same elements as the given sequence but in reverse order. var ReverseListFunc = function.New(&function.Spec{ + Description: `Returns the given list with its elements in reverse order.`, Params: []function.Parameter{ { Name: "list", @@ -898,9 +916,11 @@ var ReverseListFunc = function.New(&function.Spec{ // preserving the ordering of all of the input lists. Otherwise the result is a // set of tuples. var SetProductFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Calculates the cartesian product of two or more sets.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "sets", + Description: "The sets to consider. Also accepts lists and tuples, and if all arguments are of list or tuple type then the result will preserve the input ordering", Type: cty.DynamicPseudoType, AllowMarked: true, }, @@ -1038,6 +1058,7 @@ var SetProductFunc = function.New(&function.Spec{ // SliceFunc is a function that extracts some consecutive elements // from within a list. var SliceFunc = function.New(&function.Spec{ + Description: `Extracts a subslice of the given list or tuple value.`, Params: []function.Parameter{ { Name: "list", @@ -1159,9 +1180,10 @@ func sliceIndexes(args []cty.Value) (int, int, bool, error) { // ValuesFunc is a function that returns a list of the map values, // in the order of the sorted keys. var ValuesFunc = function.New(&function.Spec{ + Description: `Returns the values of elements of a given map, or the values of attributes of a given object, in lexicographic order by key or attribute name.`, Params: []function.Parameter{ { - Name: "values", + Name: "mapping", Type: cty.DynamicPseudoType, AllowMarked: true, }, @@ -1226,6 +1248,7 @@ var ValuesFunc = function.New(&function.Spec{ // ZipmapFunc is a function that constructs a map from a list of keys // and a corresponding list of values. var ZipmapFunc = function.New(&function.Spec{ + Description: `Constructs a map from a list of keys and a corresponding list of values, which must both be of the same length.`, Params: []function.Parameter{ { Name: "keys", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/conversion.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/conversion.go index 66eb97e25..f61b53409 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/conversion.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/conversion.go @@ -1,6 +1,7 @@ package stdlib import ( + "fmt" "strconv" "github.com/zclconf/go-cty/cty" @@ -18,6 +19,7 @@ import ( // a tuple. func MakeToFunc(wantTy cty.Type) function.Function { return function.New(&function.Spec{ + Description: fmt.Sprintf("Converts the given value to %s, or raises an error if that conversion is impossible.", wantTy.FriendlyName()), Params: []function.Parameter{ { Name: "v", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/csv.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/csv.go index 339d04dbd..20d82bcdb 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/csv.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/csv.go @@ -11,6 +11,7 @@ import ( ) var CSVDecodeFunc = function.New(&function.Spec{ + Description: `Parses the given string as Comma Separated Values (as defined by RFC 4180) and returns a map of objects representing the table of data, using the first row as a header row to define the object attributes.`, Params: []function.Parameter{ { Name: "str", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/datetime.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/datetime.go index 1ceffcf63..6c0ee05e9 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/datetime.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/datetime.go @@ -12,6 +12,7 @@ import ( ) var FormatDateFunc = function.New(&function.Spec{ + Description: `Formats a timestamp given in RFC 3339 syntax into another timestamp in some other machine-oriented time syntax, as described in the format string.`, Params: []function.Parameter{ { Name: "format", @@ -205,6 +206,7 @@ var FormatDateFunc = function.New(&function.Spec{ // TimeAddFunc is a function that adds a duration to a timestamp, returning a new timestamp. var TimeAddFunc = function.New(&function.Spec{ + Description: `Adds the duration represented by the given duration string to the given RFC 3339 timestamp string, returning another RFC 3339 timestamp.`, Params: []function.Parameter{ { Name: "timestamp", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/format.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/format.go index 8b1775895..ca163a876 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/format.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/format.go @@ -18,6 +18,7 @@ import ( //go:generate gofmt -w format_fsm.go var FormatFunc = function.New(&function.Spec{ + Description: `Constructs a string by applying formatting verbs to a series of arguments, using a similar syntax to the C function \"printf\".`, Params: []function.Parameter{ { Name: "format", @@ -45,6 +46,7 @@ var FormatFunc = function.New(&function.Spec{ }) var FormatListFunc = function.New(&function.Spec{ + Description: `Constructs a list of strings by applying formatting verbs to a series of arguments, using a similar syntax to the C function \"printf\".`, Params: []function.Parameter{ { Name: "format", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/general.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/general.go index 6b31f2661..4f70fff94 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/general.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/general.go @@ -9,6 +9,7 @@ import ( ) var EqualFunc = function.New(&function.Spec{ + Description: `Returns true if the two given values are equal, or false otherwise.`, Params: []function.Parameter{ { Name: "a", @@ -32,6 +33,7 @@ var EqualFunc = function.New(&function.Spec{ }) var NotEqualFunc = function.New(&function.Spec{ + Description: `Returns false if the two given values are equal, or true otherwise.`, Params: []function.Parameter{ { Name: "a", @@ -55,7 +57,8 @@ var NotEqualFunc = function.New(&function.Spec{ }) var CoalesceFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Returns the first of the given arguments that isn't null, or raises an error if there are no non-null arguments.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "vals", Type: cty.DynamicPseudoType, diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/json.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/json.go index 02770a652..63dd320e4 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/json.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/json.go @@ -7,6 +7,7 @@ import ( ) var JSONEncodeFunc = function.New(&function.Spec{ + Description: `Returns a string containing a JSON representation of the given value.`, Params: []function.Parameter{ { Name: "val", @@ -39,6 +40,7 @@ var JSONEncodeFunc = function.New(&function.Spec{ }) var JSONDecodeFunc = function.New(&function.Spec{ + Description: `Parses the given string as JSON and returns a value corresponding to what the JSON document describes.`, Params: []function.Parameter{ { Name: "str", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/number.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/number.go index 4effeb7bb..ce7375135 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/number.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/number.go @@ -11,6 +11,7 @@ import ( ) var AbsoluteFunc = function.New(&function.Spec{ + Description: `If the given number is negative then returns its positive equivalent, or otherwise returns the given number unchanged.`, Params: []function.Parameter{ { Name: "num", @@ -26,6 +27,7 @@ var AbsoluteFunc = function.New(&function.Spec{ }) var AddFunc = function.New(&function.Spec{ + Description: `Returns the sum of the two given numbers.`, Params: []function.Parameter{ { Name: "a", @@ -59,6 +61,7 @@ var AddFunc = function.New(&function.Spec{ }) var SubtractFunc = function.New(&function.Spec{ + Description: `Returns the difference between the two given numbers.`, Params: []function.Parameter{ { Name: "a", @@ -92,6 +95,7 @@ var SubtractFunc = function.New(&function.Spec{ }) var MultiplyFunc = function.New(&function.Spec{ + Description: `Returns the product of the two given numbers.`, Params: []function.Parameter{ { Name: "a", @@ -126,6 +130,7 @@ var MultiplyFunc = function.New(&function.Spec{ }) var DivideFunc = function.New(&function.Spec{ + Description: `Divides the first given number by the second.`, Params: []function.Parameter{ { Name: "a", @@ -160,6 +165,7 @@ var DivideFunc = function.New(&function.Spec{ }) var ModuloFunc = function.New(&function.Spec{ + Description: `Divides the first given number by the second and then returns the remainder.`, Params: []function.Parameter{ { Name: "a", @@ -194,6 +200,7 @@ var ModuloFunc = function.New(&function.Spec{ }) var GreaterThanFunc = function.New(&function.Spec{ + Description: `Returns true if and only if the second number is greater than the first.`, Params: []function.Parameter{ { Name: "a", @@ -215,6 +222,7 @@ var GreaterThanFunc = function.New(&function.Spec{ }) var GreaterThanOrEqualToFunc = function.New(&function.Spec{ + Description: `Returns true if and only if the second number is greater than or equal to the first.`, Params: []function.Parameter{ { Name: "a", @@ -236,6 +244,7 @@ var GreaterThanOrEqualToFunc = function.New(&function.Spec{ }) var LessThanFunc = function.New(&function.Spec{ + Description: `Returns true if and only if the second number is less than the first.`, Params: []function.Parameter{ { Name: "a", @@ -257,6 +266,7 @@ var LessThanFunc = function.New(&function.Spec{ }) var LessThanOrEqualToFunc = function.New(&function.Spec{ + Description: `Returns true if and only if the second number is less than or equal to the first.`, Params: []function.Parameter{ { Name: "a", @@ -278,6 +288,7 @@ var LessThanOrEqualToFunc = function.New(&function.Spec{ }) var NegateFunc = function.New(&function.Spec{ + Description: `Multiplies the given number by -1.`, Params: []function.Parameter{ { Name: "num", @@ -293,7 +304,8 @@ var NegateFunc = function.New(&function.Spec{ }) var MinFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Returns the numerically smallest of all of the given numbers.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "numbers", Type: cty.Number, @@ -317,7 +329,8 @@ var MinFunc = function.New(&function.Spec{ }) var MaxFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Returns the numerically greatest of all of the given numbers.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "numbers", Type: cty.Number, @@ -341,6 +354,7 @@ var MaxFunc = function.New(&function.Spec{ }) var IntFunc = function.New(&function.Spec{ + Description: `Discards any fractional portion of the given number.`, Params: []function.Parameter{ { Name: "num", @@ -363,6 +377,7 @@ var IntFunc = function.New(&function.Spec{ // CeilFunc is a function that returns the closest whole number greater // than or equal to the given value. var CeilFunc = function.New(&function.Spec{ + Description: `Returns the smallest whole number that is greater than or equal to the given value.`, Params: []function.Parameter{ { Name: "num", @@ -392,6 +407,7 @@ var CeilFunc = function.New(&function.Spec{ // FloorFunc is a function that returns the closest whole number lesser // than or equal to the given value. var FloorFunc = function.New(&function.Spec{ + Description: `Returns the greatest whole number that is less than or equal to the given value.`, Params: []function.Parameter{ { Name: "num", @@ -420,6 +436,7 @@ var FloorFunc = function.New(&function.Spec{ // LogFunc is a function that returns the logarithm of a given number in a given base. var LogFunc = function.New(&function.Spec{ + Description: `Returns the logarithm of the given number in the given base.`, Params: []function.Parameter{ { Name: "num", @@ -448,6 +465,7 @@ var LogFunc = function.New(&function.Spec{ // PowFunc is a function that returns the logarithm of a given number in a given base. var PowFunc = function.New(&function.Spec{ + Description: `Returns the given number raised to the given power (exponentiation).`, Params: []function.Parameter{ { Name: "num", @@ -477,6 +495,7 @@ var PowFunc = function.New(&function.Spec{ // SignumFunc is a function that determines the sign of a number, returning a // number between -1 and 1 to represent the sign.. var SignumFunc = function.New(&function.Spec{ + Description: `Returns 0 if the given number is zero, 1 if the given number is positive, or -1 if the given number is negative.`, Params: []function.Parameter{ { Name: "num", @@ -502,6 +521,7 @@ var SignumFunc = function.New(&function.Spec{ // ParseIntFunc is a function that parses a string argument and returns an integer of the specified base. var ParseIntFunc = function.New(&function.Spec{ + Description: `Parses the given string as a number of the given base, or raises an error if the string contains invalid characters.`, Params: []function.Parameter{ { Name: "number", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/regexp.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/regexp.go index 2dd6348a2..ab4257b67 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/regexp.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/regexp.go @@ -10,6 +10,7 @@ import ( ) var RegexFunc = function.New(&function.Spec{ + Description: `Applies the given regular expression pattern to the given string and returns information about a single match, or raises an error if there is no match.`, Params: []function.Parameter{ { Name: "pattern", @@ -54,6 +55,7 @@ var RegexFunc = function.New(&function.Spec{ }) var RegexAllFunc = function.New(&function.Spec{ + Description: `Applies the given regular expression pattern to the given string and returns a list of information about all non-overlapping matches, or an empty list if there are no matches.`, Params: []function.Parameter{ { Name: "pattern", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/sequence.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/sequence.go index 6a6f66b3f..6b2d97b4a 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/sequence.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/sequence.go @@ -9,7 +9,8 @@ import ( ) var ConcatFunc = function.New(&function.Spec{ - Params: []function.Parameter{}, + Description: `Concatenates together all of the given lists or tuples into a single sequence, preserving the input order.`, + Params: []function.Parameter{}, VarParam: &function.Parameter{ Name: "seqs", Type: cty.DynamicPseudoType, @@ -137,6 +138,7 @@ var ConcatFunc = function.New(&function.Spec{ }) var RangeFunc = function.New(&function.Spec{ + Description: `Returns a list of numbers spread evenly over a particular range.`, VarParam: &function.Parameter{ Name: "params", Type: cty.Number, diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/set.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/set.go index 29c425eaf..15f4c05e7 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/set.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/set.go @@ -10,6 +10,7 @@ import ( ) var SetHasElementFunc = function.New(&function.Spec{ + Description: `Returns true if the given set contains the given element, or false otherwise.`, Params: []function.Parameter{ { Name: "set", @@ -29,6 +30,7 @@ var SetHasElementFunc = function.New(&function.Spec{ }) var SetUnionFunc = function.New(&function.Spec{ + Description: `Returns the union of all given sets.`, Params: []function.Parameter{ { Name: "first_set", @@ -48,6 +50,7 @@ var SetUnionFunc = function.New(&function.Spec{ }) var SetIntersectionFunc = function.New(&function.Spec{ + Description: `Returns the intersection of all given sets.`, Params: []function.Parameter{ { Name: "first_set", @@ -67,6 +70,7 @@ var SetIntersectionFunc = function.New(&function.Spec{ }) var SetSubtractFunc = function.New(&function.Spec{ + Description: `Returns the relative complement of the two given sets.`, Params: []function.Parameter{ { Name: "a", @@ -86,6 +90,7 @@ var SetSubtractFunc = function.New(&function.Spec{ }) var SetSymmetricDifferenceFunc = function.New(&function.Spec{ + Description: `Returns the symmetric difference of the two given sets.`, Params: []function.Parameter{ { Name: "first_set", diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string.go index 43182dd5a..f340ef747 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string.go @@ -14,6 +14,7 @@ import ( ) var UpperFunc = function.New(&function.Spec{ + Description: "Returns the given string with all Unicode letters translated to their uppercase equivalents.", Params: []function.Parameter{ { Name: "str", @@ -30,6 +31,7 @@ var UpperFunc = function.New(&function.Spec{ }) var LowerFunc = function.New(&function.Spec{ + Description: "Returns the given string with all Unicode letters translated to their lowercase equivalents.", Params: []function.Parameter{ { Name: "str", @@ -46,6 +48,7 @@ var LowerFunc = function.New(&function.Spec{ }) var ReverseFunc = function.New(&function.Spec{ + Description: "Returns the given string with all of its Unicode characters in reverse order.", Params: []function.Parameter{ { Name: "str", @@ -73,6 +76,7 @@ var ReverseFunc = function.New(&function.Spec{ }) var StrlenFunc = function.New(&function.Spec{ + Description: "Returns the number of Unicode characters (technically: grapheme clusters) in the given string.", Params: []function.Parameter{ { Name: "str", @@ -97,19 +101,23 @@ var StrlenFunc = function.New(&function.Spec{ }) var SubstrFunc = function.New(&function.Spec{ + Description: "Extracts a substring from the given string.", Params: []function.Parameter{ { Name: "str", + Description: "The input string.", Type: cty.String, AllowDynamicType: true, }, { Name: "offset", + Description: "The starting offset in Unicode characters.", Type: cty.Number, AllowDynamicType: true, }, { Name: "length", + Description: "The maximum length of the result in Unicode characters.", Type: cty.Number, AllowDynamicType: true, }, @@ -197,15 +205,18 @@ var SubstrFunc = function.New(&function.Spec{ }) var JoinFunc = function.New(&function.Spec{ + Description: "Concatenates together the elements of all given lists with a delimiter, producing a single string.", Params: []function.Parameter{ { - Name: "separator", - Type: cty.String, + Name: "separator", + Description: "Delimiter to insert between the given strings.", + Type: cty.String, }, }, VarParam: &function.Parameter{ - Name: "lists", - Type: cty.List(cty.String), + Name: "lists", + Description: "One or more lists of strings to join.", + Type: cty.List(cty.String), }, Type: function.StaticReturnType(cty.String), Impl: func(args []cty.Value, retType cty.Type) (cty.Value, error) { @@ -244,6 +255,7 @@ var JoinFunc = function.New(&function.Spec{ }) var SortFunc = function.New(&function.Spec{ + Description: "Applies a lexicographic sort to the elements of the given list.", Params: []function.Parameter{ { Name: "list", @@ -282,14 +294,17 @@ var SortFunc = function.New(&function.Spec{ }) var SplitFunc = function.New(&function.Spec{ + Description: "Produces a list of one or more strings by splitting the given string at all instances of a given separator substring.", Params: []function.Parameter{ { - Name: "separator", - Type: cty.String, + Name: "separator", + Description: "The substring that delimits the result strings.", + Type: cty.String, }, { - Name: "str", - Type: cty.String, + Name: "str", + Description: "The string to split.", + Type: cty.String, }, }, Type: function.StaticReturnType(cty.List(cty.String)), @@ -311,6 +326,7 @@ var SplitFunc = function.New(&function.Spec{ // ChompFunc is a function that removes newline characters at the end of a // string. var ChompFunc = function.New(&function.Spec{ + Description: "Removes one or more newline characters from the end of the given string.", Params: []function.Parameter{ { Name: "str", @@ -327,14 +343,17 @@ var ChompFunc = function.New(&function.Spec{ // IndentFunc is a function that adds a given number of spaces to the // beginnings of all but the first line in a given multi-line string. var IndentFunc = function.New(&function.Spec{ + Description: "Adds a given number of spaces after each newline character in the given string.", Params: []function.Parameter{ { - Name: "spaces", - Type: cty.Number, + Name: "spaces", + Description: "Number of spaces to add after each newline character.", + Type: cty.Number, }, { - Name: "str", - Type: cty.String, + Name: "str", + Description: "The string to transform.", + Type: cty.String, }, }, Type: function.StaticReturnType(cty.String), @@ -352,6 +371,7 @@ var IndentFunc = function.New(&function.Spec{ // TitleFunc is a function that converts the first letter of each word in the // given string to uppercase. var TitleFunc = function.New(&function.Spec{ + Description: "Replaces one letter after each non-letter and non-digit character with its uppercase equivalent.", Params: []function.Parameter{ { Name: "str", @@ -367,6 +387,7 @@ var TitleFunc = function.New(&function.Spec{ // TrimSpaceFunc is a function that removes any space characters from the start // and end of the given string. var TrimSpaceFunc = function.New(&function.Spec{ + Description: "Removes any consecutive space characters (as defined by Unicode) from the start and end of the given string.", Params: []function.Parameter{ { Name: "str", @@ -382,20 +403,26 @@ var TrimSpaceFunc = function.New(&function.Spec{ // TrimFunc is a function that removes the specified characters from the start // and end of the given string. var TrimFunc = function.New(&function.Spec{ + Description: "Removes consecutive sequences of characters in \"cutset\" from the start and end of the given string.", Params: []function.Parameter{ { - Name: "str", - Type: cty.String, + Name: "str", + Description: "The string to trim.", + Type: cty.String, }, { - Name: "cutset", - Type: cty.String, + Name: "cutset", + Description: "A string containing all of the characters to trim. Each character is taken separately, so the order of characters is insignificant.", + Type: cty.String, }, }, Type: function.StaticReturnType(cty.String), Impl: func(args []cty.Value, retType cty.Type) (cty.Value, error) { str := args[0].AsString() cutset := args[1].AsString() + // NOTE: This doesn't properly handle any character that is encoded + // with multiple sequential code units, such as letters with + // combining diacritics and emoji modifier sequences. return cty.StringVal(strings.Trim(str, cutset)), nil }, }) @@ -403,14 +430,17 @@ var TrimFunc = function.New(&function.Spec{ // TrimPrefixFunc is a function that removes the specified characters from the // start the given string. var TrimPrefixFunc = function.New(&function.Spec{ + Description: "Removes the given prefix from the start of the given string, if present.", Params: []function.Parameter{ { - Name: "str", - Type: cty.String, + Name: "str", + Description: "The string to trim.", + Type: cty.String, }, { - Name: "prefix", - Type: cty.String, + Name: "prefix", + Description: "The prefix to remove, if present.", + Type: cty.String, }, }, Type: function.StaticReturnType(cty.String), @@ -424,14 +454,17 @@ var TrimPrefixFunc = function.New(&function.Spec{ // TrimSuffixFunc is a function that removes the specified characters from the // end of the given string. var TrimSuffixFunc = function.New(&function.Spec{ + Description: "Removes the given suffix from the start of the given string, if present.", Params: []function.Parameter{ { - Name: "str", - Type: cty.String, + Name: "str", + Description: "The string to trim.", + Type: cty.String, }, { - Name: "suffix", - Type: cty.String, + Name: "suffix", + Description: "The suffix to remove, if present.", + Type: cty.String, }, }, Type: function.StaticReturnType(cty.String), diff --git a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string_replace.go b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string_replace.go index f777ce5c3..573083bcf 100644 --- a/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string_replace.go +++ b/vendor/github.com/zclconf/go-cty/cty/function/stdlib/string_replace.go @@ -12,18 +12,22 @@ import ( // substring, and replaces each occurence with a given replacement string. // The substr argument is a simple string. var ReplaceFunc = function.New(&function.Spec{ + Description: `Replaces all instances of the given substring in the given string with the given replacement string.`, Params: []function.Parameter{ { - Name: "str", - Type: cty.String, + Name: "str", + Description: `The string to search within.`, + Type: cty.String, }, { - Name: "substr", - Type: cty.String, + Name: "substr", + Description: `The substring to search for.`, + Type: cty.String, }, { - Name: "replace", - Type: cty.String, + Name: "replace", + Description: `The new substring to replace substr with.`, + Type: cty.String, }, }, Type: function.StaticReturnType(cty.String), @@ -40,13 +44,14 @@ var ReplaceFunc = function.New(&function.Spec{ // given substring, and replaces each occurence with a given replacement // string. The substr argument must be a valid regular expression. var RegexReplaceFunc = function.New(&function.Spec{ + Description: `Applies the given regular expression pattern to the given string and replaces all matches with the given replacement string.`, Params: []function.Parameter{ { Name: "str", Type: cty.String, }, { - Name: "substr", + Name: "pattern", Type: cty.String, }, { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bson.go b/vendor/go.mongodb.org/mongo-driver/bson/bson.go index 95ffc1078..a0d818582 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bson.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bson.go @@ -27,7 +27,7 @@ type Zeroer interface { // // Example usage: // -// bson.D{{"foo", "bar"}, {"hello", "world"}, {"pi", 3.14159}} +// bson.D{{"foo", "bar"}, {"hello", "world"}, {"pi", 3.14159}} type D = primitive.D // E represents a BSON element for a D. It is usually used inside a D. @@ -39,12 +39,12 @@ type E = primitive.E // // Example usage: // -// bson.M{"foo": "bar", "hello": "world", "pi": 3.14159} +// bson.M{"foo": "bar", "hello": "world", "pi": 3.14159} type M = primitive.M // An A is an ordered representation of a BSON array. // // Example usage: // -// bson.A{"bar", "world", 3.14159, bson.D{{"qux", 12345}}} +// bson.A{"bar", "world", 3.14159, bson.D{{"qux", 12345}}} type A = primitive.A diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go index b0ae0e23f..5f903ebea 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/doc.go @@ -17,7 +17,7 @@ // 2) A Registry that holds these ValueEncoders and ValueDecoders and provides methods for // retrieving them. // -// ValueEncoders and ValueDecoders +// # ValueEncoders and ValueDecoders // // The ValueEncoder interface is implemented by types that can encode a provided Go type to BSON. // The value to encode is provided as a reflect.Value and a bsonrw.ValueWriter is used within the @@ -31,7 +31,7 @@ // allow the use of a function with the correct signature as a ValueDecoder. A DecodeContext // instance is provided and serves similar functionality to the EncodeContext. // -// Registry and RegistryBuilder +// # Registry and RegistryBuilder // // A Registry is an immutable store for ValueEncoders, ValueDecoders, and a type map. See the Registry type // documentation for examples of registering various custom encoders and decoders. A Registry can be constructed using a @@ -53,15 +53,15 @@ // values decode as Go int32 and int64 instances, respectively, when decoding into a bson.D. The following code would // change the behavior so these values decode as Go int instances instead: // -// intType := reflect.TypeOf(int(0)) -// registryBuilder.RegisterTypeMapEntry(bsontype.Int32, intType).RegisterTypeMapEntry(bsontype.Int64, intType) +// intType := reflect.TypeOf(int(0)) +// registryBuilder.RegisterTypeMapEntry(bsontype.Int32, intType).RegisterTypeMapEntry(bsontype.Int64, intType) // // 4. Kind encoder/decoders - These can be registered using the RegisterDefaultEncoder and RegisterDefaultDecoder // methods. The registered codec will be invoked when encoding or decoding values whose reflect.Kind matches the // registered reflect.Kind as long as the value's type doesn't match a registered type or hook encoder/decoder first. // These methods should be used to change the behavior for all values for a specific kind. // -// Registry Lookup Procedure +// # Registry Lookup Procedure // // When looking up an encoder in a Registry, the precedence rules are as follows: // @@ -79,7 +79,7 @@ // rules apply for decoders, with the exception that an error of type ErrNoDecoder will be returned if no decoder is // found. // -// DefaultValueEncoders and DefaultValueDecoders +// # DefaultValueEncoders and DefaultValueDecoders // // The DefaultValueEncoders and DefaultValueDecoders types provide a full set of ValueEncoders and // ValueDecoders for handling a wide range of Go types, including all of the types within the diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go index f6f3800d4..80644023c 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/registry.go @@ -254,6 +254,7 @@ func (rb *RegistryBuilder) RegisterDefaultDecoder(kind reflect.Kind, dec ValueDe // By default, BSON documents will decode into interface{} values as bson.D. To change the default type for BSON // documents, a type map entry for bsontype.EmbeddedDocument should be registered. For example, to force BSON documents // to decode to bson.Raw, use the following code: +// // rb.RegisterTypeMapEntry(bsontype.EmbeddedDocument, reflect.TypeOf(bson.Raw{})) func (rb *RegistryBuilder) RegisterTypeMapEntry(bt bsontype.Type, rt reflect.Type) *RegistryBuilder { rb.typeMap[bt] = rt diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go index 6f406c162..62708c5c7 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsoncodec/struct_tag_parser.go @@ -34,21 +34,21 @@ func (stpf StructTagParserFunc) ParseStructTags(sf reflect.StructField) (StructT // // The properties are defined below: // -// OmitEmpty Only include the field if it's not set to the zero value for the type or to -// empty slices or maps. +// OmitEmpty Only include the field if it's not set to the zero value for the type or to +// empty slices or maps. // -// MinSize Marshal an integer of a type larger than 32 bits value as an int32, if that's -// feasible while preserving the numeric value. +// MinSize Marshal an integer of a type larger than 32 bits value as an int32, if that's +// feasible while preserving the numeric value. // -// Truncate When unmarshaling a BSON double, it is permitted to lose precision to fit within -// a float32. +// Truncate When unmarshaling a BSON double, it is permitted to lose precision to fit within +// a float32. // -// Inline Inline the field, which must be a struct or a map, causing all of its fields -// or keys to be processed as if they were part of the outer struct. For maps, -// keys must not conflict with the bson keys of other struct fields. +// Inline Inline the field, which must be a struct or a map, causing all of its fields +// or keys to be processed as if they were part of the outer struct. For maps, +// keys must not conflict with the bson keys of other struct fields. // -// Skip This struct field should be skipped. This is usually denoted by parsing a "-" -// for the name. +// Skip This struct field should be skipped. This is usually denoted by parsing a "-" +// for the name. // // TODO(skriptble): Add tags for undefined as nil and for null as nil. type StructTags struct { @@ -67,20 +67,20 @@ type StructTags struct { // If there is no name in the struct tag fields, the struct field name is lowercased. // The tag formats accepted are: // -// "[][,[,]]" +// "[][,[,]]" // -// `(...) bson:"[][,[,]]" (...)` +// `(...) bson:"[][,[,]]" (...)` // // An example: // -// type T struct { -// A bool -// B int "myb" -// C string "myc,omitempty" -// D string `bson:",omitempty" json:"jsonkey"` -// E int64 ",minsize" -// F int64 "myf,omitempty,minsize" -// } +// type T struct { +// A bool +// B int "myb" +// C string "myc,omitempty" +// D string `bson:",omitempty" json:"jsonkey"` +// E int64 ",minsize" +// F int64 "myf,omitempty,minsize" +// } // // A struct tag either consisting entirely of '-' or with a bson key with a // value consisting entirely of '-' will return a StructTags with Skip true and diff --git a/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/doc.go b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/doc.go new file mode 100644 index 000000000..c40973c8d --- /dev/null +++ b/vendor/go.mongodb.org/mongo-driver/bson/bsonoptions/doc.go @@ -0,0 +1,8 @@ +// Copyright (C) MongoDB, Inc. 2022-present. +// +// Licensed under the Apache License, Version 2.0 (the "License"); you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 + +// Package bsonoptions defines the optional configurations for the BSON codecs. +package bsonoptions diff --git a/vendor/go.mongodb.org/mongo-driver/bson/doc.go b/vendor/go.mongodb.org/mongo-driver/bson/doc.go index 5e3825a23..0134006d8 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/doc.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/doc.go @@ -9,21 +9,22 @@ // The BSON library handles marshalling and unmarshalling of values through a configurable codec system. For a description // of the codec system and examples of registering custom codecs, see the bsoncodec package. // -// Raw BSON +// # Raw BSON // // The Raw family of types is used to validate and retrieve elements from a slice of bytes. This // type is most useful when you want do lookups on BSON bytes without unmarshaling it into another // type. // // Example: -// var raw bson.Raw = ... // bytes from somewhere -// err := raw.Validate() -// if err != nil { return err } -// val := raw.Lookup("foo") -// i32, ok := val.Int32OK() -// // do something with i32... // -// Native Go Types +// var raw bson.Raw = ... // bytes from somewhere +// err := raw.Validate() +// if err != nil { return err } +// val := raw.Lookup("foo") +// i32, ok := val.Int32OK() +// // do something with i32... +// +// # Native Go Types // // The D and M types defined in this package can be used to build representations of BSON using native Go types. D is a // slice and M is a map. For more information about the use cases for these types, see the documentation on the type @@ -32,63 +33,64 @@ // Note that a D should not be constructed with duplicate key names, as that can cause undefined server behavior. // // Example: -// bson.D{{"foo", "bar"}, {"hello", "world"}, {"pi", 3.14159}} -// bson.M{"foo": "bar", "hello": "world", "pi": 3.14159} +// +// bson.D{{"foo", "bar"}, {"hello", "world"}, {"pi", 3.14159}} +// bson.M{"foo": "bar", "hello": "world", "pi": 3.14159} // // When decoding BSON to a D or M, the following type mappings apply when unmarshalling: // -// 1. BSON int32 unmarshals to an int32. -// 2. BSON int64 unmarshals to an int64. -// 3. BSON double unmarshals to a float64. -// 4. BSON string unmarshals to a string. -// 5. BSON boolean unmarshals to a bool. -// 6. BSON embedded document unmarshals to the parent type (i.e. D for a D, M for an M). -// 7. BSON array unmarshals to a bson.A. -// 8. BSON ObjectId unmarshals to a primitive.ObjectID. -// 9. BSON datetime unmarshals to a primitive.DateTime. -// 10. BSON binary unmarshals to a primitive.Binary. -// 11. BSON regular expression unmarshals to a primitive.Regex. -// 12. BSON JavaScript unmarshals to a primitive.JavaScript. -// 13. BSON code with scope unmarshals to a primitive.CodeWithScope. -// 14. BSON timestamp unmarshals to an primitive.Timestamp. -// 15. BSON 128-bit decimal unmarshals to an primitive.Decimal128. -// 16. BSON min key unmarshals to an primitive.MinKey. -// 17. BSON max key unmarshals to an primitive.MaxKey. -// 18. BSON undefined unmarshals to a primitive.Undefined. -// 19. BSON null unmarshals to nil. -// 20. BSON DBPointer unmarshals to a primitive.DBPointer. -// 21. BSON symbol unmarshals to a primitive.Symbol. +// 1. BSON int32 unmarshals to an int32. +// 2. BSON int64 unmarshals to an int64. +// 3. BSON double unmarshals to a float64. +// 4. BSON string unmarshals to a string. +// 5. BSON boolean unmarshals to a bool. +// 6. BSON embedded document unmarshals to the parent type (i.e. D for a D, M for an M). +// 7. BSON array unmarshals to a bson.A. +// 8. BSON ObjectId unmarshals to a primitive.ObjectID. +// 9. BSON datetime unmarshals to a primitive.DateTime. +// 10. BSON binary unmarshals to a primitive.Binary. +// 11. BSON regular expression unmarshals to a primitive.Regex. +// 12. BSON JavaScript unmarshals to a primitive.JavaScript. +// 13. BSON code with scope unmarshals to a primitive.CodeWithScope. +// 14. BSON timestamp unmarshals to an primitive.Timestamp. +// 15. BSON 128-bit decimal unmarshals to an primitive.Decimal128. +// 16. BSON min key unmarshals to an primitive.MinKey. +// 17. BSON max key unmarshals to an primitive.MaxKey. +// 18. BSON undefined unmarshals to a primitive.Undefined. +// 19. BSON null unmarshals to nil. +// 20. BSON DBPointer unmarshals to a primitive.DBPointer. +// 21. BSON symbol unmarshals to a primitive.Symbol. // // The above mappings also apply when marshalling a D or M to BSON. Some other useful marshalling mappings are: // -// 1. time.Time marshals to a BSON datetime. -// 2. int8, int16, and int32 marshal to a BSON int32. -// 3. int marshals to a BSON int32 if the value is between math.MinInt32 and math.MaxInt32, inclusive, and a BSON int64 -// otherwise. -// 4. int64 marshals to BSON int64. -// 5. uint8 and uint16 marshal to a BSON int32. -// 6. uint, uint32, and uint64 marshal to a BSON int32 if the value is between math.MinInt32 and math.MaxInt32, -// inclusive, and BSON int64 otherwise. -// 7. BSON null and undefined values will unmarshal into the zero value of a field (e.g. unmarshalling a BSON null or -// undefined value into a string will yield the empty string.). +// 1. time.Time marshals to a BSON datetime. +// 2. int8, int16, and int32 marshal to a BSON int32. +// 3. int marshals to a BSON int32 if the value is between math.MinInt32 and math.MaxInt32, inclusive, and a BSON int64 +// otherwise. +// 4. int64 marshals to BSON int64. +// 5. uint8 and uint16 marshal to a BSON int32. +// 6. uint, uint32, and uint64 marshal to a BSON int32 if the value is between math.MinInt32 and math.MaxInt32, +// inclusive, and BSON int64 otherwise. +// 7. BSON null and undefined values will unmarshal into the zero value of a field (e.g. unmarshalling a BSON null or +// undefined value into a string will yield the empty string.). // -// Structs +// # Structs // // Structs can be marshalled/unmarshalled to/from BSON or Extended JSON. When transforming structs to/from BSON or Extended // JSON, the following rules apply: // -// 1. Only exported fields in structs will be marshalled or unmarshalled. +// 1. Only exported fields in structs will be marshalled or unmarshalled. // -// 2. When marshalling a struct, each field will be lowercased to generate the key for the corresponding BSON element. +// 2. When marshalling a struct, each field will be lowercased to generate the key for the corresponding BSON element. // For example, a struct field named "Foo" will generate key "foo". This can be overridden via a struct tag (e.g. // `bson:"fooField"` to generate key "fooField" instead). // -// 3. An embedded struct field is marshalled as a subdocument. The key will be the lowercased name of the field's type. +// 3. An embedded struct field is marshalled as a subdocument. The key will be the lowercased name of the field's type. // -// 4. A pointer field is marshalled as the underlying type if the pointer is non-nil. If the pointer is nil, it is +// 4. A pointer field is marshalled as the underlying type if the pointer is non-nil. If the pointer is nil, it is // marshalled as a BSON null value. // -// 5. When unmarshalling, a field of type interface{} will follow the D/M type mappings listed above. BSON documents +// 5. When unmarshalling, a field of type interface{} will follow the D/M type mappings listed above. BSON documents // unmarshalled into an interface{} field will be unmarshalled as a D. // // The encoding of each struct field can be customized by the "bson" struct tag. @@ -98,13 +100,14 @@ // are not honored, but that can be enabled by creating a StructCodec with JSONFallbackStructTagParser, like below: // // Example: -// structcodec, _ := bsoncodec.NewStructCodec(bsoncodec.JSONFallbackStructTagParser) +// +// structcodec, _ := bsoncodec.NewStructCodec(bsoncodec.JSONFallbackStructTagParser) // // The bson tag gives the name of the field, possibly followed by a comma-separated list of options. // The name may be empty in order to specify options without overriding the default field name. The following options can be used // to configure behavior: // -// 1. omitempty: If the omitempty struct tag is specified on a field, the field will not be marshalled if it is set to +// 1. omitempty: If the omitempty struct tag is specified on a field, the field will not be marshalled if it is set to // the zero value. Fields with language primitive types such as integers, booleans, and strings are considered empty if // their value is equal to the zero value for the type (i.e. 0 for integers, false for booleans, and "" for strings). // Slices, maps, and arrays are considered empty if they are of length zero. Interfaces and pointers are considered @@ -113,16 +116,16 @@ // never considered empty and will be marshalled as embedded documents. // NOTE: It is recommended that this tag be used for all slice and map fields. // -// 2. minsize: If the minsize struct tag is specified on a field of type int64, uint, uint32, or uint64 and the value of +// 2. minsize: If the minsize struct tag is specified on a field of type int64, uint, uint32, or uint64 and the value of // the field can fit in a signed int32, the field will be serialized as a BSON int32 rather than a BSON int64. For other // types, this tag is ignored. // -// 3. truncate: If the truncate struct tag is specified on a field with a non-float numeric type, BSON doubles unmarshalled +// 3. truncate: If the truncate struct tag is specified on a field with a non-float numeric type, BSON doubles unmarshalled // into that field will be truncated at the decimal point. For example, if 3.14 is unmarshalled into a field of type int, // it will be unmarshalled as 3. If this tag is not specified, the decoder will throw an error if the value cannot be // decoded without losing precision. For float64 or non-numeric types, this tag is ignored. // -// 4. inline: If the inline struct tag is specified for a struct or map field, the field will be "flattened" when +// 4. inline: If the inline struct tag is specified for a struct or map field, the field will be "flattened" when // marshalling and "un-flattened" when unmarshalling. This means that all of the fields in that struct/map will be // pulled up one level and will become top-level fields rather than being fields in a nested document. For example, if a // map field named "Map" with value map[string]interface{}{"foo": "bar"} is inlined, the resulting document will be @@ -132,7 +135,7 @@ // This tag can be used with fields that are pointers to structs. If an inlined pointer field is nil, it will not be // marshalled. For fields that are not maps or structs, this tag is ignored. // -// Marshalling and Unmarshalling +// # Marshalling and Unmarshalling // // Manually marshalling and unmarshalling can be done with the Marshal and Unmarshal family of functions. package bson diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go index ffe4eed07..ba7c9112e 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive/decimal.go @@ -191,10 +191,9 @@ func (d Decimal128) IsNaN() bool { // IsInf returns: // -// +1 d == Infinity -// 0 other case -// -1 d == -Infinity -// +// +1 d == Infinity +// 0 other case +// -1 d == -Infinity func (d Decimal128) IsInf() int { if d.h>>58&(1<<5-1) != 0x1E { return 0 diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go index 652898fea..ded367316 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive/objectid.go @@ -61,7 +61,9 @@ func (id ObjectID) Timestamp() time.Time { // Hex returns the hex encoding of the ObjectID as a string. func (id ObjectID) Hex() string { - return hex.EncodeToString(id[:]) + var buf [24]byte + hex.Encode(buf[:], id[:]) + return string(buf[:]) } func (id ObjectID) String() string { diff --git a/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go b/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go index b3cba1bf9..c72ccc1c4 100644 --- a/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go +++ b/vendor/go.mongodb.org/mongo-driver/bson/primitive/primitive.go @@ -182,7 +182,7 @@ type MaxKey struct{} // // Example usage: // -// bson.D{{"foo", "bar"}, {"hello", "world"}, {"pi", 3.14159}} +// bson.D{{"foo", "bar"}, {"hello", "world"}, {"pi", 3.14159}} type D []E // Map creates a map from the elements of the D. @@ -206,12 +206,12 @@ type E struct { // // Example usage: // -// bson.M{"foo": "bar", "hello": "world", "pi": 3.14159} +// bson.M{"foo": "bar", "hello": "world", "pi": 3.14159} type M map[string]interface{} // An A is an ordered representation of a BSON array. // // Example usage: // -// bson.A{"bar", "world", 3.14159, bson.D{{"qux", 12345}}} +// bson.A{"bar", "world", 3.14159, bson.D{{"qux", 12345}}} type A []interface{} diff --git a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document_sequence.go b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document_sequence.go index 6c858a010..e35bd0cd9 100644 --- a/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document_sequence.go +++ b/vendor/go.mongodb.org/mongo-driver/x/bsonx/bsoncore/document_sequence.go @@ -96,8 +96,8 @@ func (ds *DocumentSequence) Empty() bool { } } -//ResetIterator resets the iteration point for the Next method to the beginning of the document -//sequence. +// ResetIterator resets the iteration point for the Next method to the beginning of the document +// sequence. func (ds *DocumentSequence) ResetIterator() { if ds == nil { return diff --git a/vendor/golang.org/x/crypto/AUTHORS b/vendor/golang.org/x/crypto/AUTHORS deleted file mode 100644 index 2b00ddba0..000000000 --- a/vendor/golang.org/x/crypto/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at https://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/crypto/CONTRIBUTORS b/vendor/golang.org/x/crypto/CONTRIBUTORS deleted file mode 100644 index 1fbd3e976..000000000 --- a/vendor/golang.org/x/crypto/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at https://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/crypto/cast5/cast5.go b/vendor/golang.org/x/crypto/cast5/cast5.go index ddcbeb6f2..425e8eecb 100644 --- a/vendor/golang.org/x/crypto/cast5/cast5.go +++ b/vendor/golang.org/x/crypto/cast5/cast5.go @@ -13,7 +13,10 @@ // golang.org/x/crypto/chacha20poly1305). package cast5 // import "golang.org/x/crypto/cast5" -import "errors" +import ( + "errors" + "math/bits" +) const BlockSize = 8 const KeySize = 16 @@ -241,19 +244,19 @@ func (c *Cipher) keySchedule(in []byte) { // These are the three 'f' functions. See RFC 2144, section 2.2. func f1(d, m uint32, r uint8) uint32 { t := m + d - I := (t << r) | (t >> (32 - r)) + I := bits.RotateLeft32(t, int(r)) return ((sBox[0][I>>24] ^ sBox[1][(I>>16)&0xff]) - sBox[2][(I>>8)&0xff]) + sBox[3][I&0xff] } func f2(d, m uint32, r uint8) uint32 { t := m ^ d - I := (t << r) | (t >> (32 - r)) + I := bits.RotateLeft32(t, int(r)) return ((sBox[0][I>>24] - sBox[1][(I>>16)&0xff]) + sBox[2][(I>>8)&0xff]) ^ sBox[3][I&0xff] } func f3(d, m uint32, r uint8) uint32 { t := m - d - I := (t << r) | (t >> (32 - r)) + I := bits.RotateLeft32(t, int(r)) return ((sBox[0][I>>24] + sBox[1][(I>>16)&0xff]) ^ sBox[2][(I>>8)&0xff]) - sBox[3][I&0xff] } diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_generic.go b/vendor/golang.org/x/crypto/chacha20/chacha_generic.go index a2ecf5c32..93eb5ae6d 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_generic.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_generic.go @@ -12,7 +12,7 @@ import ( "errors" "math/bits" - "golang.org/x/crypto/internal/subtle" + "golang.org/x/crypto/internal/alias" ) const ( @@ -189,7 +189,7 @@ func (s *Cipher) XORKeyStream(dst, src []byte) { panic("chacha20: output smaller than input") } dst = dst[:len(src)] - if subtle.InexactOverlap(dst, src) { + if alias.InexactOverlap(dst, src) { panic("chacha20: invalid buffer overlap") } diff --git a/vendor/golang.org/x/crypto/internal/subtle/aliasing.go b/vendor/golang.org/x/crypto/internal/alias/alias.go similarity index 84% rename from vendor/golang.org/x/crypto/internal/subtle/aliasing.go rename to vendor/golang.org/x/crypto/internal/alias/alias.go index 4fad24f8d..69c17f822 100644 --- a/vendor/golang.org/x/crypto/internal/subtle/aliasing.go +++ b/vendor/golang.org/x/crypto/internal/alias/alias.go @@ -5,9 +5,8 @@ //go:build !purego // +build !purego -// Package subtle implements functions that are often useful in cryptographic -// code but require careful thought to use correctly. -package subtle // import "golang.org/x/crypto/internal/subtle" +// Package alias implements memory aliasing tests. +package alias import "unsafe" diff --git a/vendor/golang.org/x/crypto/internal/subtle/aliasing_purego.go b/vendor/golang.org/x/crypto/internal/alias/alias_purego.go similarity index 86% rename from vendor/golang.org/x/crypto/internal/subtle/aliasing_purego.go rename to vendor/golang.org/x/crypto/internal/alias/alias_purego.go index 80ccbed2c..4775b0a43 100644 --- a/vendor/golang.org/x/crypto/internal/subtle/aliasing_purego.go +++ b/vendor/golang.org/x/crypto/internal/alias/alias_purego.go @@ -5,9 +5,8 @@ //go:build purego // +build purego -// Package subtle implements functions that are often useful in cryptographic -// code but require careful thought to use correctly. -package subtle // import "golang.org/x/crypto/internal/subtle" +// Package alias implements memory aliasing tests. +package alias // This is the Google App Engine standard variant based on reflect // because the unsafe package and cgo are disallowed. diff --git a/vendor/golang.org/x/crypto/openpgp/packet/opaque.go b/vendor/golang.org/x/crypto/openpgp/packet/opaque.go index 456d807f2..398447731 100644 --- a/vendor/golang.org/x/crypto/openpgp/packet/opaque.go +++ b/vendor/golang.org/x/crypto/openpgp/packet/opaque.go @@ -7,7 +7,6 @@ package packet import ( "bytes" "io" - "io/ioutil" "golang.org/x/crypto/openpgp/errors" ) @@ -26,7 +25,7 @@ type OpaquePacket struct { } func (op *OpaquePacket) parse(r io.Reader) (err error) { - op.Contents, err = ioutil.ReadAll(r) + op.Contents, err = io.ReadAll(r) return } diff --git a/vendor/golang.org/x/crypto/openpgp/packet/private_key.go b/vendor/golang.org/x/crypto/openpgp/packet/private_key.go index 81abb7cef..192aac376 100644 --- a/vendor/golang.org/x/crypto/openpgp/packet/private_key.go +++ b/vendor/golang.org/x/crypto/openpgp/packet/private_key.go @@ -13,7 +13,6 @@ import ( "crypto/rsa" "crypto/sha1" "io" - "io/ioutil" "math/big" "strconv" "time" @@ -133,7 +132,7 @@ func (pk *PrivateKey) parse(r io.Reader) (err error) { } } - pk.encryptedData, err = ioutil.ReadAll(r) + pk.encryptedData, err = io.ReadAll(r) if err != nil { return } diff --git a/vendor/golang.org/x/crypto/openpgp/packet/symmetrically_encrypted.go b/vendor/golang.org/x/crypto/openpgp/packet/symmetrically_encrypted.go index 6126030eb..1a1a62964 100644 --- a/vendor/golang.org/x/crypto/openpgp/packet/symmetrically_encrypted.go +++ b/vendor/golang.org/x/crypto/openpgp/packet/symmetrically_encrypted.go @@ -236,7 +236,7 @@ func (w *seMDCWriter) Close() (err error) { return w.w.Close() } -// noOpCloser is like an ioutil.NopCloser, but for an io.Writer. +// noOpCloser is like an io.NopCloser, but for an io.Writer. type noOpCloser struct { w io.Writer } diff --git a/vendor/golang.org/x/crypto/openpgp/packet/userattribute.go b/vendor/golang.org/x/crypto/openpgp/packet/userattribute.go index d19ffbc78..ff7ef5307 100644 --- a/vendor/golang.org/x/crypto/openpgp/packet/userattribute.go +++ b/vendor/golang.org/x/crypto/openpgp/packet/userattribute.go @@ -9,7 +9,6 @@ import ( "image" "image/jpeg" "io" - "io/ioutil" ) const UserAttrImageSubpacket = 1 @@ -56,7 +55,7 @@ func NewUserAttribute(contents ...*OpaqueSubpacket) *UserAttribute { func (uat *UserAttribute) parse(r io.Reader) (err error) { // RFC 4880, section 5.13 - b, err := ioutil.ReadAll(r) + b, err := io.ReadAll(r) if err != nil { return } diff --git a/vendor/golang.org/x/crypto/openpgp/packet/userid.go b/vendor/golang.org/x/crypto/openpgp/packet/userid.go index d6bea7d4a..359a462eb 100644 --- a/vendor/golang.org/x/crypto/openpgp/packet/userid.go +++ b/vendor/golang.org/x/crypto/openpgp/packet/userid.go @@ -6,7 +6,6 @@ package packet import ( "io" - "io/ioutil" "strings" ) @@ -66,7 +65,7 @@ func NewUserId(name, comment, email string) *UserId { func (uid *UserId) parse(r io.Reader) (err error) { // RFC 4880, section 5.11 - b, err := ioutil.ReadAll(r) + b, err := io.ReadAll(r) if err != nil { return } diff --git a/vendor/golang.org/x/crypto/openpgp/s2k/s2k.go b/vendor/golang.org/x/crypto/openpgp/s2k/s2k.go index 9de04958e..f53244a1c 100644 --- a/vendor/golang.org/x/crypto/openpgp/s2k/s2k.go +++ b/vendor/golang.org/x/crypto/openpgp/s2k/s2k.go @@ -268,7 +268,7 @@ func HashIdToString(id byte) (name string, ok bool) { return "", false } -// HashIdToHash returns an OpenPGP hash id which corresponds the given Hash. +// HashToHashId returns an OpenPGP hash id which corresponds the given Hash. func HashToHashId(h crypto.Hash) (id byte, ok bool) { for _, m := range hashToHashIdMapping { if m.hash == h { diff --git a/vendor/golang.org/x/crypto/openpgp/write.go b/vendor/golang.org/x/crypto/openpgp/write.go index 4ee71784e..b89d48b81 100644 --- a/vendor/golang.org/x/crypto/openpgp/write.go +++ b/vendor/golang.org/x/crypto/openpgp/write.go @@ -402,7 +402,7 @@ func (s signatureWriter) Close() error { return s.encryptedData.Close() } -// noOpCloser is like an ioutil.NopCloser, but for an io.Writer. +// noOpCloser is like an io.NopCloser, but for an io.Writer. // TODO: we have two of these in OpenPGP packages alone. This probably needs // to be promoted somewhere more common. type noOpCloser struct { diff --git a/vendor/golang.org/x/crypto/ssh/certs.go b/vendor/golang.org/x/crypto/ssh/certs.go index 4600c2077..fc04d03e1 100644 --- a/vendor/golang.org/x/crypto/ssh/certs.go +++ b/vendor/golang.org/x/crypto/ssh/certs.go @@ -251,7 +251,7 @@ type algorithmOpenSSHCertSigner struct { // private key is held by signer. It returns an error if the public key in cert // doesn't match the key used by signer. func NewCertSigner(cert *Certificate, signer Signer) (Signer, error) { - if bytes.Compare(cert.Key.Marshal(), signer.PublicKey().Marshal()) != 0 { + if !bytes.Equal(cert.Key.Marshal(), signer.PublicKey().Marshal()) { return nil, errors.New("ssh: signer and cert have different public key") } diff --git a/vendor/golang.org/x/crypto/ssh/cipher.go b/vendor/golang.org/x/crypto/ssh/cipher.go index 770e8a663..87f48552c 100644 --- a/vendor/golang.org/x/crypto/ssh/cipher.go +++ b/vendor/golang.org/x/crypto/ssh/cipher.go @@ -15,7 +15,6 @@ import ( "fmt" "hash" "io" - "io/ioutil" "golang.org/x/crypto/chacha20" "golang.org/x/crypto/internal/poly1305" @@ -97,13 +96,13 @@ func streamCipherMode(skip int, createFunc func(key, iv []byte) (cipher.Stream, // are not supported and will not be negotiated, even if explicitly requested in // ClientConfig.Crypto.Ciphers. var cipherModes = map[string]*cipherMode{ - // Ciphers from RFC4344, which introduced many CTR-based ciphers. Algorithms + // Ciphers from RFC 4344, which introduced many CTR-based ciphers. Algorithms // are defined in the order specified in the RFC. "aes128-ctr": {16, aes.BlockSize, streamCipherMode(0, newAESCTR)}, "aes192-ctr": {24, aes.BlockSize, streamCipherMode(0, newAESCTR)}, "aes256-ctr": {32, aes.BlockSize, streamCipherMode(0, newAESCTR)}, - // Ciphers from RFC4345, which introduces security-improved arcfour ciphers. + // Ciphers from RFC 4345, which introduces security-improved arcfour ciphers. // They are defined in the order specified in the RFC. "arcfour128": {16, 0, streamCipherMode(1536, newRC4)}, "arcfour256": {32, 0, streamCipherMode(1536, newRC4)}, @@ -111,7 +110,7 @@ var cipherModes = map[string]*cipherMode{ // Cipher defined in RFC 4253, which describes SSH Transport Layer Protocol. // Note that this cipher is not safe, as stated in RFC 4253: "Arcfour (and // RC4) has problems with weak keys, and should be used with caution." - // RFC4345 introduces improved versions of Arcfour. + // RFC 4345 introduces improved versions of Arcfour. "arcfour": {16, 0, streamCipherMode(0, newRC4)}, // AEAD ciphers @@ -497,7 +496,7 @@ func (c *cbcCipher) readCipherPacket(seqNum uint32, r io.Reader) ([]byte, error) // data, to make distinguishing between // failing MAC and failing length check more // difficult. - io.CopyN(ioutil.Discard, r, int64(c.oracleCamouflage)) + io.CopyN(io.Discard, r, int64(c.oracleCamouflage)) } } return p, err @@ -642,7 +641,7 @@ const chacha20Poly1305ID = "chacha20-poly1305@openssh.com" // // https://tools.ietf.org/html/draft-josefsson-ssh-chacha20-poly1305-openssh-00 // -// the methods here also implement padding, which RFC4253 Section 6 +// the methods here also implement padding, which RFC 4253 Section 6 // also requires of stream ciphers. type chacha20Poly1305Cipher struct { lengthKey [32]byte diff --git a/vendor/golang.org/x/crypto/ssh/common.go b/vendor/golang.org/x/crypto/ssh/common.go index 2a47a61de..7a5ff2d2e 100644 --- a/vendor/golang.org/x/crypto/ssh/common.go +++ b/vendor/golang.org/x/crypto/ssh/common.go @@ -149,7 +149,7 @@ type directionAlgorithms struct { // rekeyBytes returns a rekeying intervals in bytes. func (a *directionAlgorithms) rekeyBytes() int64 { - // According to RFC4344 block ciphers should rekey after + // According to RFC 4344 block ciphers should rekey after // 2^(BLOCKSIZE/4) blocks. For all AES flavors BLOCKSIZE is // 128. switch a.Cipher { @@ -158,7 +158,7 @@ func (a *directionAlgorithms) rekeyBytes() int64 { } - // For others, stick with RFC4253 recommendation to rekey after 1 Gb of data. + // For others, stick with RFC 4253 recommendation to rekey after 1 Gb of data. return 1 << 30 } diff --git a/vendor/golang.org/x/crypto/ssh/connection.go b/vendor/golang.org/x/crypto/ssh/connection.go index fd6b0681b..35661a52b 100644 --- a/vendor/golang.org/x/crypto/ssh/connection.go +++ b/vendor/golang.org/x/crypto/ssh/connection.go @@ -52,7 +52,7 @@ type Conn interface { // SendRequest sends a global request, and returns the // reply. If wantReply is true, it returns the response status - // and payload. See also RFC4254, section 4. + // and payload. See also RFC 4254, section 4. SendRequest(name string, wantReply bool, payload []byte) (bool, []byte, error) // OpenChannel tries to open an channel. If the request is diff --git a/vendor/golang.org/x/crypto/ssh/keys.go b/vendor/golang.org/x/crypto/ssh/keys.go index 1c7de1a6d..729698041 100644 --- a/vendor/golang.org/x/crypto/ssh/keys.go +++ b/vendor/golang.org/x/crypto/ssh/keys.go @@ -184,7 +184,7 @@ func ParseKnownHosts(in []byte) (marker string, hosts []string, pubKey PublicKey return "", nil, nil, "", nil, io.EOF } -// ParseAuthorizedKeys parses a public key from an authorized_keys +// ParseAuthorizedKey parses a public key from an authorized_keys // file used in OpenSSH according to the sshd(8) manual page. func ParseAuthorizedKey(in []byte) (out PublicKey, comment string, options []string, rest []byte, err error) { for len(in) > 0 { diff --git a/vendor/golang.org/x/crypto/ssh/messages.go b/vendor/golang.org/x/crypto/ssh/messages.go index 19bc67c46..922032d95 100644 --- a/vendor/golang.org/x/crypto/ssh/messages.go +++ b/vendor/golang.org/x/crypto/ssh/messages.go @@ -68,7 +68,7 @@ type kexInitMsg struct { // See RFC 4253, section 8. -// Diffie-Helman +// Diffie-Hellman const msgKexDHInit = 30 type kexDHInitMsg struct { diff --git a/vendor/golang.org/x/crypto/ssh/server.go b/vendor/golang.org/x/crypto/ssh/server.go index 70045bdfd..2260b20af 100644 --- a/vendor/golang.org/x/crypto/ssh/server.go +++ b/vendor/golang.org/x/crypto/ssh/server.go @@ -68,8 +68,16 @@ type ServerConfig struct { // NoClientAuth is true if clients are allowed to connect without // authenticating. + // To determine NoClientAuth at runtime, set NoClientAuth to true + // and the optional NoClientAuthCallback to a non-nil value. NoClientAuth bool + // NoClientAuthCallback, if non-nil, is called when a user + // attempts to authenticate with auth method "none". + // NoClientAuth must also be set to true for this be used, or + // this func is unused. + NoClientAuthCallback func(ConnMetadata) (*Permissions, error) + // MaxAuthTries specifies the maximum number of authentication attempts // permitted per connection. If set to a negative number, the number of // attempts are unlimited. If set to zero, the number of attempts are limited @@ -455,7 +463,11 @@ userAuthLoop: switch userAuthReq.Method { case "none": if config.NoClientAuth { - authErr = nil + if config.NoClientAuthCallback != nil { + perms, authErr = config.NoClientAuthCallback(s) + } else { + authErr = nil + } } // allow initial attempt of 'none' without penalty diff --git a/vendor/golang.org/x/crypto/ssh/session.go b/vendor/golang.org/x/crypto/ssh/session.go index eca31a22d..acef62259 100644 --- a/vendor/golang.org/x/crypto/ssh/session.go +++ b/vendor/golang.org/x/crypto/ssh/session.go @@ -13,7 +13,6 @@ import ( "errors" "fmt" "io" - "io/ioutil" "sync" ) @@ -124,7 +123,7 @@ type Session struct { // output and error. // // If either is nil, Run connects the corresponding file - // descriptor to an instance of ioutil.Discard. There is a + // descriptor to an instance of io.Discard. There is a // fixed amount of buffering that is shared for the two streams. // If either blocks it may eventually cause the remote // command to block. @@ -506,7 +505,7 @@ func (s *Session) stdout() { return } if s.Stdout == nil { - s.Stdout = ioutil.Discard + s.Stdout = io.Discard } s.copyFuncs = append(s.copyFuncs, func() error { _, err := io.Copy(s.Stdout, s.ch) @@ -519,7 +518,7 @@ func (s *Session) stderr() { return } if s.Stderr == nil { - s.Stderr = ioutil.Discard + s.Stderr = io.Discard } s.copyFuncs = append(s.copyFuncs, func() error { _, err := io.Copy(s.Stderr, s.ch.Stderr()) diff --git a/vendor/golang.org/x/net/context/go17.go b/vendor/golang.org/x/net/context/go17.go index 0a54bdbcc..2cb9c408f 100644 --- a/vendor/golang.org/x/net/context/go17.go +++ b/vendor/golang.org/x/net/context/go17.go @@ -32,7 +32,7 @@ var DeadlineExceeded = context.DeadlineExceeded // call cancel as soon as the operations running in this Context complete. func WithCancel(parent Context) (ctx Context, cancel CancelFunc) { ctx, f := context.WithCancel(parent) - return ctx, CancelFunc(f) + return ctx, f } // WithDeadline returns a copy of the parent context with the deadline adjusted @@ -46,7 +46,7 @@ func WithCancel(parent Context) (ctx Context, cancel CancelFunc) { // call cancel as soon as the operations running in this Context complete. func WithDeadline(parent Context, deadline time.Time) (Context, CancelFunc) { ctx, f := context.WithDeadline(parent, deadline) - return ctx, CancelFunc(f) + return ctx, f } // WithTimeout returns WithDeadline(parent, time.Now().Add(timeout)). diff --git a/vendor/golang.org/x/net/http2/headermap.go b/vendor/golang.org/x/net/http2/headermap.go index 9e12941da..149b3dd20 100644 --- a/vendor/golang.org/x/net/http2/headermap.go +++ b/vendor/golang.org/x/net/http2/headermap.go @@ -27,7 +27,14 @@ func buildCommonHeaderMaps() { "accept-language", "accept-ranges", "age", + "access-control-allow-credentials", + "access-control-allow-headers", + "access-control-allow-methods", "access-control-allow-origin", + "access-control-expose-headers", + "access-control-max-age", + "access-control-request-headers", + "access-control-request-method", "allow", "authorization", "cache-control", @@ -53,6 +60,7 @@ func buildCommonHeaderMaps() { "link", "location", "max-forwards", + "origin", "proxy-authenticate", "proxy-authorization", "range", @@ -68,6 +76,8 @@ func buildCommonHeaderMaps() { "vary", "via", "www-authenticate", + "x-forwarded-for", + "x-forwarded-proto", } commonLowerHeader = make(map[string]string, len(common)) commonCanonHeader = make(map[string]string, len(common)) @@ -85,3 +95,11 @@ func lowerHeader(v string) (lower string, ascii bool) { } return asciiToLower(v) } + +func canonicalHeader(v string) string { + buildCommonHeaderMapsOnce() + if s, ok := commonCanonHeader[v]; ok { + return s + } + return http.CanonicalHeaderKey(v) +} diff --git a/vendor/golang.org/x/net/http2/hpack/static_table.go b/vendor/golang.org/x/net/http2/hpack/static_table.go new file mode 100644 index 000000000..754a1eb91 --- /dev/null +++ b/vendor/golang.org/x/net/http2/hpack/static_table.go @@ -0,0 +1,188 @@ +// go generate gen.go +// Code generated by the command above; DO NOT EDIT. + +package hpack + +var staticTable = &headerFieldTable{ + evictCount: 0, + byName: map[string]uint64{ + ":authority": 1, + ":method": 3, + ":path": 5, + ":scheme": 7, + ":status": 14, + "accept-charset": 15, + "accept-encoding": 16, + "accept-language": 17, + "accept-ranges": 18, + "accept": 19, + "access-control-allow-origin": 20, + "age": 21, + "allow": 22, + "authorization": 23, + "cache-control": 24, + "content-disposition": 25, + "content-encoding": 26, + "content-language": 27, + "content-length": 28, + "content-location": 29, + "content-range": 30, + "content-type": 31, + "cookie": 32, + "date": 33, + "etag": 34, + "expect": 35, + "expires": 36, + "from": 37, + "host": 38, + "if-match": 39, + "if-modified-since": 40, + "if-none-match": 41, + "if-range": 42, + "if-unmodified-since": 43, + "last-modified": 44, + "link": 45, + "location": 46, + "max-forwards": 47, + "proxy-authenticate": 48, + "proxy-authorization": 49, + "range": 50, + "referer": 51, + "refresh": 52, + "retry-after": 53, + "server": 54, + "set-cookie": 55, + "strict-transport-security": 56, + "transfer-encoding": 57, + "user-agent": 58, + "vary": 59, + "via": 60, + "www-authenticate": 61, + }, + byNameValue: map[pairNameValue]uint64{ + {name: ":authority", value: ""}: 1, + {name: ":method", value: "GET"}: 2, + {name: ":method", value: "POST"}: 3, + {name: ":path", value: "/"}: 4, + {name: ":path", value: "/index.html"}: 5, + {name: ":scheme", value: "http"}: 6, + {name: ":scheme", value: "https"}: 7, + {name: ":status", value: "200"}: 8, + {name: ":status", value: "204"}: 9, + {name: ":status", value: "206"}: 10, + {name: ":status", value: "304"}: 11, + {name: ":status", value: "400"}: 12, + {name: ":status", value: "404"}: 13, + {name: ":status", value: "500"}: 14, + {name: "accept-charset", value: ""}: 15, + {name: "accept-encoding", value: "gzip, deflate"}: 16, + {name: "accept-language", value: ""}: 17, + {name: "accept-ranges", value: ""}: 18, + {name: "accept", value: ""}: 19, + {name: "access-control-allow-origin", value: ""}: 20, + {name: "age", value: ""}: 21, + {name: "allow", value: ""}: 22, + {name: "authorization", value: ""}: 23, + {name: "cache-control", value: ""}: 24, + {name: "content-disposition", value: ""}: 25, + {name: "content-encoding", value: ""}: 26, + {name: "content-language", value: ""}: 27, + {name: "content-length", value: ""}: 28, + {name: "content-location", value: ""}: 29, + {name: "content-range", value: ""}: 30, + {name: "content-type", value: ""}: 31, + {name: "cookie", value: ""}: 32, + {name: "date", value: ""}: 33, + {name: "etag", value: ""}: 34, + {name: "expect", value: ""}: 35, + {name: "expires", value: ""}: 36, + {name: "from", value: ""}: 37, + {name: "host", value: ""}: 38, + {name: "if-match", value: ""}: 39, + {name: "if-modified-since", value: ""}: 40, + {name: "if-none-match", value: ""}: 41, + {name: "if-range", value: ""}: 42, + {name: "if-unmodified-since", value: ""}: 43, + {name: "last-modified", value: ""}: 44, + {name: "link", value: ""}: 45, + {name: "location", value: ""}: 46, + {name: "max-forwards", value: ""}: 47, + {name: "proxy-authenticate", value: ""}: 48, + {name: "proxy-authorization", value: ""}: 49, + {name: "range", value: ""}: 50, + {name: "referer", value: ""}: 51, + {name: "refresh", value: ""}: 52, + {name: "retry-after", value: ""}: 53, + {name: "server", value: ""}: 54, + {name: "set-cookie", value: ""}: 55, + {name: "strict-transport-security", value: ""}: 56, + {name: "transfer-encoding", value: ""}: 57, + {name: "user-agent", value: ""}: 58, + {name: "vary", value: ""}: 59, + {name: "via", value: ""}: 60, + {name: "www-authenticate", value: ""}: 61, + }, + ents: []HeaderField{ + {Name: ":authority", Value: "", Sensitive: false}, + {Name: ":method", Value: "GET", Sensitive: false}, + {Name: ":method", Value: "POST", Sensitive: false}, + {Name: ":path", Value: "/", Sensitive: false}, + {Name: ":path", Value: "/index.html", Sensitive: false}, + {Name: ":scheme", Value: "http", Sensitive: false}, + {Name: ":scheme", Value: "https", Sensitive: false}, + {Name: ":status", Value: "200", Sensitive: false}, + {Name: ":status", Value: "204", Sensitive: false}, + {Name: ":status", Value: "206", Sensitive: false}, + {Name: ":status", Value: "304", Sensitive: false}, + {Name: ":status", Value: "400", Sensitive: false}, + {Name: ":status", Value: "404", Sensitive: false}, + {Name: ":status", Value: "500", Sensitive: false}, + {Name: "accept-charset", Value: "", Sensitive: false}, + {Name: "accept-encoding", Value: "gzip, deflate", Sensitive: false}, + {Name: "accept-language", Value: "", Sensitive: false}, + {Name: "accept-ranges", Value: "", Sensitive: false}, + {Name: "accept", Value: "", Sensitive: false}, + {Name: "access-control-allow-origin", Value: "", Sensitive: false}, + {Name: "age", Value: "", Sensitive: false}, + {Name: "allow", Value: "", Sensitive: false}, + {Name: "authorization", Value: "", Sensitive: false}, + {Name: "cache-control", Value: "", Sensitive: false}, + {Name: "content-disposition", Value: "", Sensitive: false}, + {Name: "content-encoding", Value: "", Sensitive: false}, + {Name: "content-language", Value: "", Sensitive: false}, + {Name: "content-length", Value: "", Sensitive: false}, + {Name: "content-location", Value: "", Sensitive: false}, + {Name: "content-range", Value: "", Sensitive: false}, + {Name: "content-type", Value: "", Sensitive: false}, + {Name: "cookie", Value: "", Sensitive: false}, + {Name: "date", Value: "", Sensitive: false}, + {Name: "etag", Value: "", Sensitive: false}, + {Name: "expect", Value: "", Sensitive: false}, + {Name: "expires", Value: "", Sensitive: false}, + {Name: "from", Value: "", Sensitive: false}, + {Name: "host", Value: "", Sensitive: false}, + {Name: "if-match", Value: "", Sensitive: false}, + {Name: "if-modified-since", Value: "", Sensitive: false}, + {Name: "if-none-match", Value: "", Sensitive: false}, + {Name: "if-range", Value: "", Sensitive: false}, + {Name: "if-unmodified-since", Value: "", Sensitive: false}, + {Name: "last-modified", Value: "", Sensitive: false}, + {Name: "link", Value: "", Sensitive: false}, + {Name: "location", Value: "", Sensitive: false}, + {Name: "max-forwards", Value: "", Sensitive: false}, + {Name: "proxy-authenticate", Value: "", Sensitive: false}, + {Name: "proxy-authorization", Value: "", Sensitive: false}, + {Name: "range", Value: "", Sensitive: false}, + {Name: "referer", Value: "", Sensitive: false}, + {Name: "refresh", Value: "", Sensitive: false}, + {Name: "retry-after", Value: "", Sensitive: false}, + {Name: "server", Value: "", Sensitive: false}, + {Name: "set-cookie", Value: "", Sensitive: false}, + {Name: "strict-transport-security", Value: "", Sensitive: false}, + {Name: "transfer-encoding", Value: "", Sensitive: false}, + {Name: "user-agent", Value: "", Sensitive: false}, + {Name: "vary", Value: "", Sensitive: false}, + {Name: "via", Value: "", Sensitive: false}, + {Name: "www-authenticate", Value: "", Sensitive: false}, + }, +} diff --git a/vendor/golang.org/x/net/http2/hpack/tables.go b/vendor/golang.org/x/net/http2/hpack/tables.go index a66cfbea6..8cbdf3f01 100644 --- a/vendor/golang.org/x/net/http2/hpack/tables.go +++ b/vendor/golang.org/x/net/http2/hpack/tables.go @@ -96,8 +96,7 @@ func (t *headerFieldTable) evictOldest(n int) { // meaning t.ents is reversed for dynamic tables. Hence, when t is a dynamic // table, the return value i actually refers to the entry t.ents[t.len()-i]. // -// All tables are assumed to be a dynamic tables except for the global -// staticTable pointer. +// All tables are assumed to be a dynamic tables except for the global staticTable. // // See Section 2.3.3. func (t *headerFieldTable) search(f HeaderField) (i uint64, nameValueMatch bool) { @@ -125,81 +124,6 @@ func (t *headerFieldTable) idToIndex(id uint64) uint64 { return k + 1 } -// http://tools.ietf.org/html/draft-ietf-httpbis-header-compression-07#appendix-B -var staticTable = newStaticTable() -var staticTableEntries = [...]HeaderField{ - {Name: ":authority"}, - {Name: ":method", Value: "GET"}, - {Name: ":method", Value: "POST"}, - {Name: ":path", Value: "/"}, - {Name: ":path", Value: "/index.html"}, - {Name: ":scheme", Value: "http"}, - {Name: ":scheme", Value: "https"}, - {Name: ":status", Value: "200"}, - {Name: ":status", Value: "204"}, - {Name: ":status", Value: "206"}, - {Name: ":status", Value: "304"}, - {Name: ":status", Value: "400"}, - {Name: ":status", Value: "404"}, - {Name: ":status", Value: "500"}, - {Name: "accept-charset"}, - {Name: "accept-encoding", Value: "gzip, deflate"}, - {Name: "accept-language"}, - {Name: "accept-ranges"}, - {Name: "accept"}, - {Name: "access-control-allow-origin"}, - {Name: "age"}, - {Name: "allow"}, - {Name: "authorization"}, - {Name: "cache-control"}, - {Name: "content-disposition"}, - {Name: "content-encoding"}, - {Name: "content-language"}, - {Name: "content-length"}, - {Name: "content-location"}, - {Name: "content-range"}, - {Name: "content-type"}, - {Name: "cookie"}, - {Name: "date"}, - {Name: "etag"}, - {Name: "expect"}, - {Name: "expires"}, - {Name: "from"}, - {Name: "host"}, - {Name: "if-match"}, - {Name: "if-modified-since"}, - {Name: "if-none-match"}, - {Name: "if-range"}, - {Name: "if-unmodified-since"}, - {Name: "last-modified"}, - {Name: "link"}, - {Name: "location"}, - {Name: "max-forwards"}, - {Name: "proxy-authenticate"}, - {Name: "proxy-authorization"}, - {Name: "range"}, - {Name: "referer"}, - {Name: "refresh"}, - {Name: "retry-after"}, - {Name: "server"}, - {Name: "set-cookie"}, - {Name: "strict-transport-security"}, - {Name: "transfer-encoding"}, - {Name: "user-agent"}, - {Name: "vary"}, - {Name: "via"}, - {Name: "www-authenticate"}, -} - -func newStaticTable() *headerFieldTable { - t := &headerFieldTable{} - t.init() - for _, e := range staticTableEntries[:] { - t.addEntry(e) - } - return t -} - var huffmanCodes = [256]uint32{ 0x1ff8, 0x7fffd8, diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index aa3b0864e..d8a17aa9b 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -143,7 +143,7 @@ type Server struct { } func (s *Server) initialConnRecvWindowSize() int32 { - if s.MaxUploadBufferPerConnection > initialWindowSize { + if s.MaxUploadBufferPerConnection >= initialWindowSize { return s.MaxUploadBufferPerConnection } return 1 << 20 @@ -622,7 +622,9 @@ type stream struct { resetQueued bool // RST_STREAM queued for write; set by sc.resetStream gotTrailerHeader bool // HEADER frame for trailers was seen wroteHeaders bool // whether we wrote headers (not status 100) + readDeadline *time.Timer // nil if unused writeDeadline *time.Timer // nil if unused + closeErr error // set before cw is closed trailer http.Header // accumulated trailers reqTrailer http.Header // handler's Request.Trailer @@ -948,6 +950,8 @@ func (sc *serverConn) serve() { } case *startPushRequest: sc.startPush(v) + case func(*serverConn): + v(sc) default: panic(fmt.Sprintf("unexpected type %T", v)) } @@ -1371,6 +1375,9 @@ func (sc *serverConn) startGracefulShutdownInternal() { func (sc *serverConn) goAway(code ErrCode) { sc.serveG.check() if sc.inGoAway { + if sc.goAwayCode == ErrCodeNo { + sc.goAwayCode = code + } return } sc.inGoAway = true @@ -1458,6 +1465,21 @@ func (sc *serverConn) processFrame(f Frame) error { sc.sawFirstSettings = true } + // Discard frames for streams initiated after the identified last + // stream sent in a GOAWAY, or all frames after sending an error. + // We still need to return connection-level flow control for DATA frames. + // RFC 9113 Section 6.8. + if sc.inGoAway && (sc.goAwayCode != ErrCodeNo || f.Header().StreamID > sc.maxClientStreamID) { + + if f, ok := f.(*DataFrame); ok { + if sc.inflow.available() < int32(f.Length) { + return sc.countError("data_flow", streamError(f.Header().StreamID, ErrCodeFlowControl)) + } + sc.sendWindowUpdate(nil, int(f.Length)) // conn-level + } + return nil + } + switch f := f.(type) { case *SettingsFrame: return sc.processSettings(f) @@ -1500,9 +1522,6 @@ func (sc *serverConn) processPing(f *PingFrame) error { // PROTOCOL_ERROR." return sc.countError("ping_on_stream", ConnectionError(ErrCodeProtocol)) } - if sc.inGoAway && sc.goAwayCode != ErrCodeNo { - return nil - } sc.writeFrame(FrameWriteRequest{write: writePingAck{f}}) return nil } @@ -1564,6 +1583,9 @@ func (sc *serverConn) closeStream(st *stream, err error) { panic(fmt.Sprintf("invariant; can't close stream in state %v", st.state)) } st.state = stateClosed + if st.readDeadline != nil { + st.readDeadline.Stop() + } if st.writeDeadline != nil { st.writeDeadline.Stop() } @@ -1589,6 +1611,14 @@ func (sc *serverConn) closeStream(st *stream, err error) { p.CloseWithError(err) } + if e, ok := err.(StreamError); ok { + if e.Cause != nil { + err = e.Cause + } else { + err = errStreamClosed + } + } + st.closeErr = err st.cw.Close() // signals Handler's CloseNotifier, unblocks writes, etc sc.writeSched.CloseStream(st.id) } @@ -1685,16 +1715,6 @@ func (sc *serverConn) processSettingInitialWindowSize(val uint32) error { func (sc *serverConn) processData(f *DataFrame) error { sc.serveG.check() id := f.Header().StreamID - if sc.inGoAway && (sc.goAwayCode != ErrCodeNo || id > sc.maxClientStreamID) { - // Discard all DATA frames if the GOAWAY is due to an - // error, or: - // - // Section 6.8: After sending a GOAWAY frame, the sender - // can discard frames for streams initiated by the - // receiver with identifiers higher than the identified - // last stream. - return nil - } data := f.Data() state, st := sc.state(id) @@ -1837,19 +1857,27 @@ func (st *stream) copyTrailersToHandlerRequest() { } } +// onReadTimeout is run on its own goroutine (from time.AfterFunc) +// when the stream's ReadTimeout has fired. +func (st *stream) onReadTimeout() { + // Wrap the ErrDeadlineExceeded to avoid callers depending on us + // returning the bare error. + st.body.CloseWithError(fmt.Errorf("%w", os.ErrDeadlineExceeded)) +} + // onWriteTimeout is run on its own goroutine (from time.AfterFunc) // when the stream's WriteTimeout has fired. func (st *stream) onWriteTimeout() { - st.sc.writeFrameFromHandler(FrameWriteRequest{write: streamError(st.id, ErrCodeInternal)}) + st.sc.writeFrameFromHandler(FrameWriteRequest{write: StreamError{ + StreamID: st.id, + Code: ErrCodeInternal, + Cause: os.ErrDeadlineExceeded, + }}) } func (sc *serverConn) processHeaders(f *MetaHeadersFrame) error { sc.serveG.check() id := f.StreamID - if sc.inGoAway { - // Ignore. - return nil - } // http://tools.ietf.org/html/rfc7540#section-5.1.1 // Streams initiated by a client MUST use odd-numbered stream // identifiers. [...] An endpoint that receives an unexpected @@ -1952,6 +1980,9 @@ func (sc *serverConn) processHeaders(f *MetaHeadersFrame) error { // (in Go 1.8), though. That's a more sane option anyway. if sc.hs.ReadTimeout != 0 { sc.conn.SetReadDeadline(time.Time{}) + if st.body != nil { + st.readDeadline = time.AfterFunc(sc.hs.ReadTimeout, st.onReadTimeout) + } } go sc.runHandler(rw, req, handler) @@ -2020,9 +2051,6 @@ func (sc *serverConn) checkPriority(streamID uint32, p PriorityParam) error { } func (sc *serverConn) processPriority(f *PriorityFrame) error { - if sc.inGoAway { - return nil - } if err := sc.checkPriority(f.StreamID, f.PriorityParam); err != nil { return err } @@ -2096,12 +2124,6 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res return nil, nil, sc.countError("bad_path_method", streamError(f.StreamID, ErrCodeProtocol)) } - bodyOpen := !f.StreamEnded() - if rp.method == "HEAD" && bodyOpen { - // HEAD requests can't have bodies - return nil, nil, sc.countError("head_body", streamError(f.StreamID, ErrCodeProtocol)) - } - rp.header = make(http.Header) for _, hf := range f.RegularFields() { rp.header.Add(sc.canonicalHeader(hf.Name), hf.Value) @@ -2114,6 +2136,7 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res if err != nil { return nil, nil, err } + bodyOpen := !f.StreamEnded() if bodyOpen { if vv, ok := rp.header["Content-Length"]; ok { if cl, err := strconv.ParseUint(vv[0], 10, 63); err == nil { @@ -2343,7 +2366,7 @@ func (sc *serverConn) sendWindowUpdate(st *stream, n int) { // a larger Read than this. Very unlikely, but we handle it here // rather than elsewhere for now. const maxUint31 = 1<<31 - 1 - for n >= maxUint31 { + for n > maxUint31 { sc.sendWindowUpdate32(st, maxUint31) n -= maxUint31 } @@ -2463,7 +2486,15 @@ type responseWriterState struct { type chunkWriter struct{ rws *responseWriterState } -func (cw chunkWriter) Write(p []byte) (n int, err error) { return cw.rws.writeChunk(p) } +func (cw chunkWriter) Write(p []byte) (n int, err error) { + n, err = cw.rws.writeChunk(p) + if err == errStreamClosed { + // If writing failed because the stream has been closed, + // return the reason it was closed. + err = cw.rws.stream.closeErr + } + return n, err +} func (rws *responseWriterState) hasTrailers() bool { return len(rws.trailers) > 0 } @@ -2502,6 +2533,10 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { rws.writeHeader(200) } + if rws.handlerDone { + rws.promoteUndeclaredTrailers() + } + isHeadResp := rws.req.Method == "HEAD" if !rws.sentHeader { rws.sentHeader = true @@ -2573,10 +2608,6 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { return 0, nil } - if rws.handlerDone { - rws.promoteUndeclaredTrailers() - } - // only send trailers if they have actually been defined by the // server handler. hasNonemptyTrailers := rws.hasNonemptyTrailers() @@ -2657,23 +2688,85 @@ func (rws *responseWriterState) promoteUndeclaredTrailers() { } } +func (w *responseWriter) SetReadDeadline(deadline time.Time) error { + st := w.rws.stream + if !deadline.IsZero() && deadline.Before(time.Now()) { + // If we're setting a deadline in the past, reset the stream immediately + // so writes after SetWriteDeadline returns will fail. + st.onReadTimeout() + return nil + } + w.rws.conn.sendServeMsg(func(sc *serverConn) { + if st.readDeadline != nil { + if !st.readDeadline.Stop() { + // Deadline already exceeded, or stream has been closed. + return + } + } + if deadline.IsZero() { + st.readDeadline = nil + } else if st.readDeadline == nil { + st.readDeadline = time.AfterFunc(deadline.Sub(time.Now()), st.onReadTimeout) + } else { + st.readDeadline.Reset(deadline.Sub(time.Now())) + } + }) + return nil +} + +func (w *responseWriter) SetWriteDeadline(deadline time.Time) error { + st := w.rws.stream + if !deadline.IsZero() && deadline.Before(time.Now()) { + // If we're setting a deadline in the past, reset the stream immediately + // so writes after SetWriteDeadline returns will fail. + st.onWriteTimeout() + return nil + } + w.rws.conn.sendServeMsg(func(sc *serverConn) { + if st.writeDeadline != nil { + if !st.writeDeadline.Stop() { + // Deadline already exceeded, or stream has been closed. + return + } + } + if deadline.IsZero() { + st.writeDeadline = nil + } else if st.writeDeadline == nil { + st.writeDeadline = time.AfterFunc(deadline.Sub(time.Now()), st.onWriteTimeout) + } else { + st.writeDeadline.Reset(deadline.Sub(time.Now())) + } + }) + return nil +} + func (w *responseWriter) Flush() { + w.FlushError() +} + +func (w *responseWriter) FlushError() error { rws := w.rws if rws == nil { panic("Header called after Handler finished") } + var err error if rws.bw.Buffered() > 0 { - if err := rws.bw.Flush(); err != nil { - // Ignore the error. The frame writer already knows. - return - } + err = rws.bw.Flush() } else { // The bufio.Writer won't call chunkWriter.Write // (writeChunk with zero bytes, so we have to do it // ourselves to force the HTTP response header and/or // final DATA frame (with END_STREAM) to be sent. - rws.writeChunk(nil) + _, err = chunkWriter{rws}.Write(nil) + if err == nil { + select { + case <-rws.stream.cw: + err = rws.stream.closeErr + default: + } + } } + return err } func (w *responseWriter) CloseNotify() <-chan bool { diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 90fdc28cf..46dda4dc3 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -16,6 +16,7 @@ import ( "errors" "fmt" "io" + "io/fs" "log" "math" mathrand "math/rand" @@ -258,7 +259,8 @@ func (t *Transport) initConnPool() { // HTTP/2 server. type ClientConn struct { t *Transport - tconn net.Conn // usually *tls.Conn, except specialized impls + tconn net.Conn // usually *tls.Conn, except specialized impls + tconnClosed bool tlsState *tls.ConnectionState // nil only for specialized impls reused uint32 // whether conn is being reused; atomic singleUse bool // whether being used for a single http.Request @@ -344,8 +346,8 @@ type clientStream struct { readErr error // sticky read error; owned by transportResponseBody.Read reqBody io.ReadCloser - reqBodyContentLength int64 // -1 means unknown - reqBodyClosed bool // body has been closed; guarded by cc.mu + reqBodyContentLength int64 // -1 means unknown + reqBodyClosed chan struct{} // guarded by cc.mu; non-nil on Close, closed when done // owned by writeRequest: sentEndStream bool // sent an END_STREAM flag to the peer @@ -385,9 +387,8 @@ func (cs *clientStream) abortStreamLocked(err error) { cs.abortErr = err close(cs.abort) }) - if cs.reqBody != nil && !cs.reqBodyClosed { - cs.reqBody.Close() - cs.reqBodyClosed = true + if cs.reqBody != nil { + cs.closeReqBodyLocked() } // TODO(dneil): Clean up tests where cs.cc.cond is nil. if cs.cc.cond != nil { @@ -400,13 +401,24 @@ func (cs *clientStream) abortRequestBodyWrite() { cc := cs.cc cc.mu.Lock() defer cc.mu.Unlock() - if cs.reqBody != nil && !cs.reqBodyClosed { - cs.reqBody.Close() - cs.reqBodyClosed = true + if cs.reqBody != nil && cs.reqBodyClosed == nil { + cs.closeReqBodyLocked() cc.cond.Broadcast() } } +func (cs *clientStream) closeReqBodyLocked() { + if cs.reqBodyClosed != nil { + return + } + cs.reqBodyClosed = make(chan struct{}) + reqBodyClosed := cs.reqBodyClosed + go func() { + cs.reqBody.Close() + close(reqBodyClosed) + }() +} + type stickyErrWriter struct { conn net.Conn timeout time.Duration @@ -490,6 +502,15 @@ func authorityAddr(scheme string, authority string) (addr string) { return net.JoinHostPort(host, port) } +var retryBackoffHook func(time.Duration) *time.Timer + +func backoffNewTimer(d time.Duration) *time.Timer { + if retryBackoffHook != nil { + return retryBackoffHook(d) + } + return time.NewTimer(d) +} + // RoundTripOpt is like RoundTrip, but takes options. func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Response, error) { if !(req.URL.Scheme == "https" || (req.URL.Scheme == "http" && t.AllowHTTP)) { @@ -515,11 +536,14 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res } backoff := float64(uint(1) << (uint(retry) - 1)) backoff += backoff * (0.1 * mathrand.Float64()) + d := time.Second * time.Duration(backoff) + timer := backoffNewTimer(d) select { - case <-time.After(time.Second * time.Duration(backoff)): + case <-timer.C: t.vlogf("RoundTrip retrying after failure: %v", err) continue case <-req.Context().Done(): + timer.Stop() err = req.Context().Err() } } @@ -921,10 +945,10 @@ func (cc *ClientConn) onIdleTimeout() { cc.closeIfIdle() } -func (cc *ClientConn) closeConn() error { +func (cc *ClientConn) closeConn() { t := time.AfterFunc(250*time.Millisecond, cc.forceCloseConn) defer t.Stop() - return cc.tconn.Close() + cc.tconn.Close() } // A tls.Conn.Close can hang for a long time if the peer is unresponsive. @@ -990,7 +1014,8 @@ func (cc *ClientConn) Shutdown(ctx context.Context) error { shutdownEnterWaitStateHook() select { case <-done: - return cc.closeConn() + cc.closeConn() + return nil case <-ctx.Done(): cc.mu.Lock() // Free the goroutine above @@ -1027,7 +1052,7 @@ func (cc *ClientConn) sendGoAway() error { // closes the client connection immediately. In-flight requests are interrupted. // err is sent to streams. -func (cc *ClientConn) closeForError(err error) error { +func (cc *ClientConn) closeForError(err error) { cc.mu.Lock() cc.closed = true for _, cs := range cc.streams { @@ -1035,7 +1060,7 @@ func (cc *ClientConn) closeForError(err error) error { } cc.cond.Broadcast() cc.mu.Unlock() - return cc.closeConn() + cc.closeConn() } // Close closes the client connection immediately. @@ -1043,16 +1068,17 @@ func (cc *ClientConn) closeForError(err error) error { // In-flight requests are interrupted. For a graceful shutdown, use Shutdown instead. func (cc *ClientConn) Close() error { err := errors.New("http2: client connection force closed via ClientConn.Close") - return cc.closeForError(err) + cc.closeForError(err) + return nil } // closes the client connection immediately. In-flight requests are interrupted. -func (cc *ClientConn) closeForLostPing() error { +func (cc *ClientConn) closeForLostPing() { err := errors.New("http2: client connection lost") if f := cc.t.CountError; f != nil { f("conn_close_lost_ping") } - return cc.closeForError(err) + cc.closeForError(err) } // errRequestCanceled is a copy of net/http's errRequestCanceled because it's not @@ -1062,7 +1088,7 @@ var errRequestCanceled = errors.New("net/http: request canceled") func commaSeparatedTrailers(req *http.Request) (string, error) { keys := make([]string, 0, len(req.Trailer)) for k := range req.Trailer { - k = http.CanonicalHeaderKey(k) + k = canonicalHeader(k) switch k { case "Transfer-Encoding", "Trailer", "Content-Length": return "", fmt.Errorf("invalid Trailer key %q", k) @@ -1430,11 +1456,19 @@ func (cs *clientStream) cleanupWriteRequest(err error) { // and in multiple cases: server replies <=299 and >299 // while still writing request body cc.mu.Lock() + mustCloseBody := false + if cs.reqBody != nil && cs.reqBodyClosed == nil { + mustCloseBody = true + cs.reqBodyClosed = make(chan struct{}) + } bodyClosed := cs.reqBodyClosed - cs.reqBodyClosed = true cc.mu.Unlock() - if !bodyClosed && cs.reqBody != nil { + if mustCloseBody { cs.reqBody.Close() + close(bodyClosed) + } + if bodyClosed != nil { + <-bodyClosed } if err != nil && cs.sentEndStream { @@ -1591,7 +1625,7 @@ func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { var sawEOF bool for !sawEOF { - n, err := body.Read(buf[:len(buf)]) + n, err := body.Read(buf) if hasContentLen { remainLen -= int64(n) if remainLen == 0 && err == nil { @@ -1614,7 +1648,7 @@ func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { } if err != nil { cc.mu.Lock() - bodyClosed := cs.reqBodyClosed + bodyClosed := cs.reqBodyClosed != nil cc.mu.Unlock() switch { case bodyClosed: @@ -1709,7 +1743,7 @@ func (cs *clientStream) awaitFlowControl(maxBytes int) (taken int32, err error) if cc.closed { return 0, errClientConnClosed } - if cs.reqBodyClosed { + if cs.reqBodyClosed != nil { return 0, errStopReqBodyWrite } select { @@ -1894,7 +1928,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail // Header list size is ok. Write the headers. enumerateHeaders(func(name, value string) { - name, ascii := asciiToLower(name) + name, ascii := lowerHeader(name) if !ascii { // Skip writing invalid headers. Per RFC 7540, Section 8.1.2, header // field names have to be ASCII characters (just as in HTTP/1.x). @@ -1947,7 +1981,7 @@ func (cc *ClientConn) encodeTrailers(trailer http.Header) ([]byte, error) { } for k, vv := range trailer { - lowKey, ascii := asciiToLower(k) + lowKey, ascii := lowerHeader(k) if !ascii { // Skip writing invalid headers. Per RFC 7540, Section 8.1.2, header // field names have to be ASCII characters (just as in HTTP/1.x). @@ -2005,7 +2039,7 @@ func (cc *ClientConn) forgetStreamID(id uint32) { // wake up RoundTrip if there is a pending request. cc.cond.Broadcast() - closeOnIdle := cc.singleUse || cc.doNotReuse || cc.t.disableKeepAlives() + closeOnIdle := cc.singleUse || cc.doNotReuse || cc.t.disableKeepAlives() || cc.goAway != nil if closeOnIdle && cc.streamsReserved == 0 && len(cc.streams) == 0 { if VerboseLogs { cc.vlogf("http2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)", cc, cc.singleUse, cc.nextStreamID-2) @@ -2081,6 +2115,7 @@ func (rl *clientConnReadLoop) cleanup() { err = io.ErrUnexpectedEOF } cc.closed = true + for _, cs := range cc.streams { select { case <-cs.peerClosed: @@ -2279,7 +2314,7 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra Status: status + " " + http.StatusText(statusCode), } for _, hf := range regularFields { - key := http.CanonicalHeaderKey(hf.Name) + key := canonicalHeader(hf.Name) if key == "Trailer" { t := res.Trailer if t == nil { @@ -2287,7 +2322,7 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra res.Trailer = t } foreachHeaderElement(hf.Value, func(v string) { - t[http.CanonicalHeaderKey(v)] = nil + t[canonicalHeader(v)] = nil }) } else { vv := header[key] @@ -2392,7 +2427,7 @@ func (rl *clientConnReadLoop) processTrailers(cs *clientStream, f *MetaHeadersFr trailer := make(http.Header) for _, hf := range f.RegularFields() { - key := http.CanonicalHeaderKey(hf.Name) + key := canonicalHeader(hf.Name) trailer[key] = append(trailer[key], hf.Value) } cs.trailer = trailer @@ -2674,7 +2709,6 @@ func (rl *clientConnReadLoop) processGoAway(f *GoAwayFrame) error { if fn := cc.t.CountError; fn != nil { fn("recv_goaway_" + f.ErrCode.stringToken()) } - } cc.setGoAway(f) return nil @@ -2964,7 +2998,11 @@ func (gz *gzipReader) Read(p []byte) (n int, err error) { } func (gz *gzipReader) Close() error { - return gz.body.Close() + if err := gz.body.Close(); err != nil { + return err + } + gz.zerr = fs.ErrClosed + return nil } type errorReader struct{ err error } @@ -3028,7 +3066,7 @@ func traceGotConn(req *http.Request, cc *ClientConn, reused bool) { cc.mu.Lock() ci.WasIdle = len(cc.streams) == 0 && reused if ci.WasIdle && !cc.lastActive.IsZero() { - ci.IdleTime = time.Now().Sub(cc.lastActive) + ci.IdleTime = time.Since(cc.lastActive) } cc.mu.Unlock() diff --git a/vendor/golang.org/x/net/trace/trace.go b/vendor/golang.org/x/net/trace/trace.go index 3ebf6f2da..eae2a99f5 100644 --- a/vendor/golang.org/x/net/trace/trace.go +++ b/vendor/golang.org/x/net/trace/trace.go @@ -395,7 +395,7 @@ func New(family, title string) Trace { } func (tr *trace) Finish() { - elapsed := time.Now().Sub(tr.Start) + elapsed := time.Since(tr.Start) tr.mu.Lock() tr.Elapsed = elapsed tr.mu.Unlock() diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go new file mode 100644 index 000000000..060d46b6e --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go @@ -0,0 +1,15 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !aix && !linux && (ppc64 || ppc64le) +// +build !aix +// +build !linux +// +build ppc64 ppc64le + +package cpu + +func archInit() { + PPC64.IsPOWER8 = true + Initialized = true +} diff --git a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go b/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go deleted file mode 100644 index e07899b90..000000000 --- a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go +++ /dev/null @@ -1,30 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package unsafeheader contains header declarations for the Go runtime's -// slice and string implementations. -// -// This package allows x/sys to use types equivalent to -// reflect.SliceHeader and reflect.StringHeader without introducing -// a dependency on the (relatively heavy) "reflect" package. -package unsafeheader - -import ( - "unsafe" -) - -// Slice is the runtime representation of a slice. -// It cannot be used safely or portably and its representation may change in a later release. -type Slice struct { - Data unsafe.Pointer - Len int - Cap int -} - -// String is the runtime representation of a string. -// It cannot be used safely or portably and its representation may change in a later release. -type String struct { - Data unsafe.Pointer - Len int -} diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s new file mode 100644 index 000000000..e5b9a8489 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s @@ -0,0 +1,31 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (darwin || freebsd || netbsd || openbsd) && gc +// +build darwin freebsd netbsd openbsd +// +build gc + +#include "textflag.h" + +// +// System call support for ppc64, BSD +// + +// Just jump to package syscall's implementation for all these functions. +// The runtime may know about them. + +TEXT ·Syscall(SB),NOSPLIT,$0-56 + JMP syscall·Syscall(SB) + +TEXT ·Syscall6(SB),NOSPLIT,$0-80 + JMP syscall·Syscall6(SB) + +TEXT ·Syscall9(SB),NOSPLIT,$0-104 + JMP syscall·Syscall9(SB) + +TEXT ·RawSyscall(SB),NOSPLIT,$0-56 + JMP syscall·RawSyscall(SB) + +TEXT ·RawSyscall6(SB),NOSPLIT,$0-80 + JMP syscall·RawSyscall6(SB) diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go index e74e5eaa3..2499f977b 100644 --- a/vendor/golang.org/x/sys/unix/dirent.go +++ b/vendor/golang.org/x/sys/unix/dirent.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris +//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos +// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 884430b81..0d12c0851 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -4,9 +4,7 @@ package unix -import ( - "unsafe" -) +import "unsafe" // IoctlRetInt performs an ioctl operation specified by req on a device // associated with opened file descriptor fd, and returns a non-negative @@ -217,3 +215,19 @@ func IoctlKCMAttach(fd int, info KCMAttach) error { func IoctlKCMUnattach(fd int, info KCMUnattach) error { return ioctlPtr(fd, SIOCKCMUNATTACH, unsafe.Pointer(&info)) } + +// IoctlLoopGetStatus64 gets the status of the loop device associated with the +// file descriptor fd using the LOOP_GET_STATUS64 operation. +func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) { + var value LoopInfo64 + if err := ioctlPtr(fd, LOOP_GET_STATUS64, unsafe.Pointer(&value)); err != nil { + return nil, err + } + return &value, nil +} + +// IoctlLoopSetStatus64 sets the status of the loop device associated with the +// file descriptor fd using the LOOP_SET_STATUS64 operation. +func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error { + return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value)) +} diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 3b2335d5f..727cba212 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -182,6 +182,24 @@ openbsd_mips64) # API consistent across platforms. mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" ;; +openbsd_ppc64) + mkasm="go run mkasm.go" + mkerrors="$mkerrors -m64" + mksyscall="go run mksyscall.go -openbsd -libc" + mksysctl="go run mksysctl_openbsd.go" + # Let the type of C char be signed for making the bare syscall + # API consistent across platforms. + mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" + ;; +openbsd_riscv64) + mkasm="go run mkasm.go" + mkerrors="$mkerrors -m64" + mksyscall="go run mksyscall.go -openbsd -libc" + mksysctl="go run mksysctl_openbsd.go" + # Let the type of C char be signed for making the bare syscall + # API consistent across platforms. + mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" + ;; solaris_amd64) mksyscall="go run mksyscall_solaris.go" mkerrors="$mkerrors -m64" @@ -214,11 +232,6 @@ esac if [ "$GOOSARCH" == "aix_ppc64" ]; then # aix/ppc64 script generates files instead of writing to stdin. echo "$mksyscall -tags $GOOS,$GOARCH $syscall_goos $GOOSARCH_in && gofmt -w zsyscall_$GOOSARCH.go && gofmt -w zsyscall_"$GOOSARCH"_gccgo.go && gofmt -w zsyscall_"$GOOSARCH"_gc.go " ; - elif [ "$GOOS" == "darwin" ]; then - # 1.12 and later, syscalls via libSystem - echo "$mksyscall -tags $GOOS,$GOARCH,go1.12 $syscall_goos $GOOSARCH_in |gofmt >zsyscall_$GOOSARCH.go"; - # 1.13 and later, syscalls via libSystem (including syscallPtr) - echo "$mksyscall -tags $GOOS,$GOARCH,go1.13 syscall_darwin.1_13.go |gofmt >zsyscall_$GOOSARCH.1_13.go"; elif [ "$GOOS" == "illumos" ]; then # illumos code generation requires a --illumos switch echo "$mksyscall -illumos -tags illumos,$GOARCH syscall_illumos.go |gofmt > zsyscall_illumos_$GOARCH.go"; diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index 2ab44aa65..7456d9ddd 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -642,7 +642,7 @@ errors=$( signals=$( echo '#include ' | $CC -x c - -E -dM $ccflags | awk '$1=="#define" && $2 ~ /^SIG[A-Z0-9]+$/ { print $2 }' | - egrep -v '(SIGSTKSIZE|SIGSTKSZ|SIGRT|SIGMAX64)' | + grep -v 'SIGSTKSIZE\|SIGSTKSZ\|SIGRT\|SIGMAX64' | sort ) @@ -652,7 +652,7 @@ echo '#include ' | $CC -x c - -E -dM $ccflags | sort >_error.grep echo '#include ' | $CC -x c - -E -dM $ccflags | awk '$1=="#define" && $2 ~ /^SIG[A-Z0-9]+$/ { print "^\t" $2 "[ \t]*=" }' | - egrep -v '(SIGSTKSIZE|SIGSTKSZ|SIGRT|SIGMAX64)' | + grep -v 'SIGSTKSIZE\|SIGSTKSZ\|SIGRT\|SIGMAX64' | sort >_signal.grep echo '// mkerrors.sh' "$@" diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go index 453a942c5..3865943f6 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go @@ -52,6 +52,20 @@ func ParseSocketControlMessage(b []byte) ([]SocketControlMessage, error) { return msgs, nil } +// ParseOneSocketControlMessage parses a single socket control message from b, returning the message header, +// message data (a slice of b), and the remainder of b after that single message. +// When there are no remaining messages, len(remainder) == 0. +func ParseOneSocketControlMessage(b []byte) (hdr Cmsghdr, data []byte, remainder []byte, err error) { + h, dbuf, err := socketControlMessageHeaderAndData(b) + if err != nil { + return Cmsghdr{}, nil, nil, err + } + if i := cmsgAlignOf(int(h.Len)); i < len(b) { + remainder = b[i:] + } + return *h, dbuf, remainder, nil +} + func socketControlMessageHeaderAndData(b []byte) (*Cmsghdr, []byte, error) { h := (*Cmsghdr)(unsafe.Pointer(&b[0])) if h.Len < SizeofCmsghdr || uint64(h.Len) > uint64(len(b)) { diff --git a/vendor/golang.org/x/sys/unix/str.go b/vendor/golang.org/x/sys/unix/str.go deleted file mode 100644 index 8ba89ed86..000000000 --- a/vendor/golang.org/x/sys/unix/str.go +++ /dev/null @@ -1,27 +0,0 @@ -// Copyright 2009 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris - -package unix - -func itoa(val int) string { // do it here rather than with fmt to avoid dependency - if val < 0 { - return "-" + uitoa(uint(-val)) - } - return uitoa(uint(val)) -} - -func uitoa(val uint) string { - var buf [32]byte // big enough for int64 - i := len(buf) - 1 - for val >= 10 { - buf[i] = byte(val%10 + '0') - i-- - val /= 10 - } - buf[i] = byte(val + '0') - return string(buf[i:]) -} diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go index 649fa8740..63e8c8383 100644 --- a/vendor/golang.org/x/sys/unix/syscall.go +++ b/vendor/golang.org/x/sys/unix/syscall.go @@ -29,8 +29,6 @@ import ( "bytes" "strings" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) // ByteSliceFromString returns a NUL-terminated slice of bytes @@ -82,13 +80,7 @@ func BytePtrToString(p *byte) string { ptr = unsafe.Pointer(uintptr(ptr) + 1) } - var s []byte - h := (*unsafeheader.Slice)(unsafe.Pointer(&s)) - h.Data = unsafe.Pointer(p) - h.Len = n - h.Cap = n - - return string(s) + return string(unsafe.Slice(p, n)) } // Single-word zero for use when we need a valid pointer to 0 bytes. diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go b/vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go deleted file mode 100644 index b0098607c..000000000 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.1_12.go +++ /dev/null @@ -1,32 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build darwin && go1.12 && !go1.13 -// +build darwin,go1.12,!go1.13 - -package unix - -import ( - "unsafe" -) - -const _SYS_GETDIRENTRIES64 = 344 - -func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { - // To implement this using libSystem we'd need syscall_syscallPtr for - // fdopendir. However, syscallPtr was only added in Go 1.13, so we fall - // back to raw syscalls for this func on Go 1.12. - var p unsafe.Pointer - if len(buf) > 0 { - p = unsafe.Pointer(&buf[0]) - } else { - p = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(_SYS_GETDIRENTRIES64, uintptr(fd), uintptr(p), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) - n = int(r0) - if e1 != 0 { - return n, errnoErr(e1) - } - return n, nil -} diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go b/vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go deleted file mode 100644 index 1596426b1..000000000 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go +++ /dev/null @@ -1,108 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build darwin && go1.13 -// +build darwin,go1.13 - -package unix - -import ( - "unsafe" - - "golang.org/x/sys/internal/unsafeheader" -) - -//sys closedir(dir uintptr) (err error) -//sys readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) - -func fdopendir(fd int) (dir uintptr, err error) { - r0, _, e1 := syscall_syscallPtr(libc_fdopendir_trampoline_addr, uintptr(fd), 0, 0) - dir = uintptr(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_fdopendir_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_fdopendir fdopendir "/usr/lib/libSystem.B.dylib" - -func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { - // Simulate Getdirentries using fdopendir/readdir_r/closedir. - // We store the number of entries to skip in the seek - // offset of fd. See issue #31368. - // It's not the full required semantics, but should handle the case - // of calling Getdirentries or ReadDirent repeatedly. - // It won't handle assigning the results of lseek to *basep, or handle - // the directory being edited underfoot. - skip, err := Seek(fd, 0, 1 /* SEEK_CUR */) - if err != nil { - return 0, err - } - - // We need to duplicate the incoming file descriptor - // because the caller expects to retain control of it, but - // fdopendir expects to take control of its argument. - // Just Dup'ing the file descriptor is not enough, as the - // result shares underlying state. Use Openat to make a really - // new file descriptor referring to the same directory. - fd2, err := Openat(fd, ".", O_RDONLY, 0) - if err != nil { - return 0, err - } - d, err := fdopendir(fd2) - if err != nil { - Close(fd2) - return 0, err - } - defer closedir(d) - - var cnt int64 - for { - var entry Dirent - var entryp *Dirent - e := readdir_r(d, &entry, &entryp) - if e != 0 { - return n, errnoErr(e) - } - if entryp == nil { - break - } - if skip > 0 { - skip-- - cnt++ - continue - } - - reclen := int(entry.Reclen) - if reclen > len(buf) { - // Not enough room. Return for now. - // The counter will let us know where we should start up again. - // Note: this strategy for suspending in the middle and - // restarting is O(n^2) in the length of the directory. Oh well. - break - } - - // Copy entry into return buffer. - var s []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&s)) - hdr.Data = unsafe.Pointer(&entry) - hdr.Cap = reclen - hdr.Len = reclen - copy(buf, s) - - buf = buf[reclen:] - n += reclen - cnt++ - } - // Set the seek offset of the input fd to record - // how many files we've already returned. - _, err = Seek(fd, cnt, 0 /* SEEK_SET */) - if err != nil { - return n, err - } - - return n, nil -} diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 4f87f16ea..1f6338218 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -19,6 +19,96 @@ import ( "unsafe" ) +//sys closedir(dir uintptr) (err error) +//sys readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) + +func fdopendir(fd int) (dir uintptr, err error) { + r0, _, e1 := syscall_syscallPtr(libc_fdopendir_trampoline_addr, uintptr(fd), 0, 0) + dir = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fdopendir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fdopendir fdopendir "/usr/lib/libSystem.B.dylib" + +func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { + // Simulate Getdirentries using fdopendir/readdir_r/closedir. + // We store the number of entries to skip in the seek + // offset of fd. See issue #31368. + // It's not the full required semantics, but should handle the case + // of calling Getdirentries or ReadDirent repeatedly. + // It won't handle assigning the results of lseek to *basep, or handle + // the directory being edited underfoot. + skip, err := Seek(fd, 0, 1 /* SEEK_CUR */) + if err != nil { + return 0, err + } + + // We need to duplicate the incoming file descriptor + // because the caller expects to retain control of it, but + // fdopendir expects to take control of its argument. + // Just Dup'ing the file descriptor is not enough, as the + // result shares underlying state. Use Openat to make a really + // new file descriptor referring to the same directory. + fd2, err := Openat(fd, ".", O_RDONLY, 0) + if err != nil { + return 0, err + } + d, err := fdopendir(fd2) + if err != nil { + Close(fd2) + return 0, err + } + defer closedir(d) + + var cnt int64 + for { + var entry Dirent + var entryp *Dirent + e := readdir_r(d, &entry, &entryp) + if e != 0 { + return n, errnoErr(e) + } + if entryp == nil { + break + } + if skip > 0 { + skip-- + cnt++ + continue + } + + reclen := int(entry.Reclen) + if reclen > len(buf) { + // Not enough room. Return for now. + // The counter will let us know where we should start up again. + // Note: this strategy for suspending in the middle and + // restarting is O(n^2) in the length of the directory. Oh well. + break + } + + // Copy entry into return buffer. + s := unsafe.Slice((*byte)(unsafe.Pointer(&entry)), reclen) + copy(buf, s) + + buf = buf[reclen:] + n += reclen + cnt++ + } + // Set the seek offset of the input fd to record + // how many files we've already returned. + _, err = Seek(fd, cnt, 0 /* SEEK_SET */) + if err != nil { + return n, err + } + + return n, nil +} + // SockaddrDatalink implements the Sockaddr interface for AF_LINK type sockets. type SockaddrDatalink struct { Len uint8 diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go index c3c4c698e..b11ede89a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go @@ -61,7 +61,7 @@ func PtraceGetFsBase(pid int, fsbase *int64) (err error) { } func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)} + ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint32(countin)} err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go index 82be61a2f..9ed8eec6c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go @@ -61,7 +61,7 @@ func PtraceGetFsBase(pid int, fsbase *int64) (err error) { } func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} + ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint64(countin)} err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go index cd58f1026..f8ac98247 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go @@ -57,7 +57,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)} + ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint32(countin)} err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go index d6f538f9e..8e932036e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go @@ -57,7 +57,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} + ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint64(countin)} err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go index 8ea6e9610..cbe122278 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go @@ -57,7 +57,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { - ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} + ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint64(countin)} err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index e48244a9c..87db5a6a8 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -10,8 +10,6 @@ package unix import ( - "fmt" - "runtime" "unsafe" ) @@ -79,107 +77,3 @@ func Accept4(fd int, flags int) (nfd int, sa Sockaddr, err error) { } return } - -//sys putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) - -func Putmsg(fd int, cl []byte, data []byte, flags int) (err error) { - var clp, datap *strbuf - if len(cl) > 0 { - clp = &strbuf{ - Len: int32(len(cl)), - Buf: (*int8)(unsafe.Pointer(&cl[0])), - } - } - if len(data) > 0 { - datap = &strbuf{ - Len: int32(len(data)), - Buf: (*int8)(unsafe.Pointer(&data[0])), - } - } - return putmsg(fd, clp, datap, flags) -} - -//sys getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) - -func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags int, err error) { - var clp, datap *strbuf - if len(cl) > 0 { - clp = &strbuf{ - Maxlen: int32(len(cl)), - Buf: (*int8)(unsafe.Pointer(&cl[0])), - } - } - if len(data) > 0 { - datap = &strbuf{ - Maxlen: int32(len(data)), - Buf: (*int8)(unsafe.Pointer(&data[0])), - } - } - - if err = getmsg(fd, clp, datap, &flags); err != nil { - return nil, nil, 0, err - } - - if len(cl) > 0 { - retCl = cl[:clp.Len] - } - if len(data) > 0 { - retData = data[:datap.Len] - } - return retCl, retData, flags, nil -} - -func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) { - return ioctlRet(fd, req, uintptr(arg)) -} - -func IoctlSetString(fd int, req uint, val string) error { - bs := make([]byte, len(val)+1) - copy(bs[:len(bs)-1], val) - err := ioctl(fd, req, uintptr(unsafe.Pointer(&bs[0]))) - runtime.KeepAlive(&bs[0]) - return err -} - -// Lifreq Helpers - -func (l *Lifreq) SetName(name string) error { - if len(name) >= len(l.Name) { - return fmt.Errorf("name cannot be more than %d characters", len(l.Name)-1) - } - for i := range name { - l.Name[i] = int8(name[i]) - } - return nil -} - -func (l *Lifreq) SetLifruInt(d int) { - *(*int)(unsafe.Pointer(&l.Lifru[0])) = d -} - -func (l *Lifreq) GetLifruInt() int { - return *(*int)(unsafe.Pointer(&l.Lifru[0])) -} - -func (l *Lifreq) SetLifruUint(d uint) { - *(*uint)(unsafe.Pointer(&l.Lifru[0])) = d -} - -func (l *Lifreq) GetLifruUint() uint { - return *(*uint)(unsafe.Pointer(&l.Lifru[0])) -} - -func IoctlLifreq(fd int, req uint, l *Lifreq) error { - return ioctl(fd, req, uintptr(unsafe.Pointer(l))) -} - -// Strioctl Helpers - -func (s *Strioctl) SetInt(i int) { - s.Len = int32(unsafe.Sizeof(i)) - s.Dp = (*int8)(unsafe.Pointer(&i)) -} - -func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) { - return ioctlRet(fd, req, uintptr(unsafe.Pointer(s))) -} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index ecb0f27fb..c5a98440e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -13,6 +13,7 @@ package unix import ( "encoding/binary" + "strconv" "syscall" "time" "unsafe" @@ -233,7 +234,7 @@ func Futimesat(dirfd int, path string, tv []Timeval) error { func Futimes(fd int, tv []Timeval) (err error) { // Believe it or not, this is the best we can do on Linux // (and is what glibc does). - return Utimes("/proc/self/fd/"+itoa(fd), tv) + return Utimes("/proc/self/fd/"+strconv.Itoa(fd), tv) } const ImplementsGetwd = true @@ -1553,6 +1554,7 @@ func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Sockle var iova [1]Iovec iova[0].Base = &dummy iova[0].SetLen(1) + iov = iova[:] } } msg.Control = &oob[0] @@ -1891,17 +1893,28 @@ func PrctlRetInt(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uint return int(ret), nil } -// issue 1435. -// On linux Setuid and Setgid only affects the current thread, not the process. -// This does not match what most callers expect so we must return an error -// here rather than letting the caller think that the call succeeded. - func Setuid(uid int) (err error) { - return EOPNOTSUPP + return syscall.Setuid(uid) +} + +func Setgid(gid int) (err error) { + return syscall.Setgid(gid) +} + +func Setreuid(ruid, euid int) (err error) { + return syscall.Setreuid(ruid, euid) +} + +func Setregid(rgid, egid int) (err error) { + return syscall.Setregid(rgid, egid) +} + +func Setresuid(ruid, euid, suid int) (err error) { + return syscall.Setresuid(ruid, euid, suid) } -func Setgid(uid int) (err error) { - return EOPNOTSUPP +func Setresgid(rgid, egid, sgid int) (err error) { + return syscall.Setresgid(rgid, egid, sgid) } // SetfsgidRetGid sets fsgid for current thread and returns previous fsgid set. @@ -2240,7 +2253,7 @@ func (fh *FileHandle) Bytes() []byte { if n == 0 { return nil } - return (*[1 << 30]byte)(unsafe.Pointer(uintptr(unsafe.Pointer(&fh.fileHandle.Type)) + 4))[:n:n] + return unsafe.Slice((*byte)(unsafe.Pointer(uintptr(unsafe.Pointer(&fh.fileHandle.Type))+4)), n) } // NameToHandleAt wraps the name_to_handle_at system call; it obtains @@ -2356,6 +2369,16 @@ func Setitimer(which ItimerWhich, it Itimerval) (Itimerval, error) { return prev, nil } +//sysnb rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) (err error) = SYS_RT_SIGPROCMASK + +func PthreadSigmask(how int, set, oldset *Sigset_t) error { + if oldset != nil { + // Explicitly clear in case Sigset_t is larger than _C__NSIG. + *oldset = Sigset_t{} + } + return rtSigprocmask(how, set, oldset, _C__NSIG/8) +} + /* * Unimplemented */ @@ -2414,7 +2437,6 @@ func Setitimer(which ItimerWhich, it Itimerval) (Itimerval, error) { // RestartSyscall // RtSigaction // RtSigpending -// RtSigprocmask // RtSigqueueinfo // RtSigreturn // RtSigsuspend diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index 518e476e6..ff5b5899d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -41,10 +41,6 @@ func setTimeval(sec, usec int64) Timeval { //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64 //sys setfsgid(gid int) (prev int, err error) = SYS_SETFSGID32 //sys setfsuid(uid int) (prev int, err error) = SYS_SETFSUID32 -//sysnb Setregid(rgid int, egid int) (err error) = SYS_SETREGID32 -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) = SYS_SETRESGID32 -//sysnb Setresuid(ruid int, euid int, suid int) (err error) = SYS_SETRESUID32 -//sysnb Setreuid(ruid int, euid int) (err error) = SYS_SETREUID32 //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error) //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index f5e9d6bef..9b2703532 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -46,11 +46,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb Setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index c1a7778f1..856ad1d63 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -62,10 +62,6 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) = SYS__NEWSELECT //sys setfsgid(gid int) (prev int, err error) = SYS_SETFSGID32 //sys setfsuid(uid int) (prev int, err error) = SYS_SETFSUID32 -//sysnb Setregid(rgid int, egid int) (err error) = SYS_SETREGID32 -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) = SYS_SETRESGID32 -//sysnb Setresuid(ruid int, euid int, suid int) (err error) = SYS_SETRESUID32 -//sysnb Setreuid(ruid int, euid int) (err error) = SYS_SETREUID32 //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error) //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index d83e2c657..6422704bc 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -39,11 +39,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 0b69c3eff..59dab510e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -34,10 +34,6 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 98a2660b9..bfef09a39 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -37,11 +37,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb Setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index b8a18c0ad..ab3025096 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -32,10 +32,6 @@ func Syscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64 //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error) //sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index 4ed9e67c6..eac1cf1ac 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -34,10 +34,6 @@ import ( //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64 //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error) //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index db63d384c..4df56616b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -34,11 +34,7 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb Setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 925a748a3..5f4243dea 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -38,11 +38,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb Setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index 6fcf277b0..d0a7d4066 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -34,11 +34,7 @@ import ( //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb Setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index 02a45d9cc..f5c793be2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -31,11 +31,7 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setregid(rgid int, egid int) (err error) -//sysnb Setresgid(rgid int, egid int, sgid int) (err error) -//sysnb Setresuid(ruid int, euid int, suid int) (err error) //sysnb Setrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setreuid(ruid int, euid int) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go index 5930a8972..e23c5394e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (openbsd && 386) || (openbsd && amd64) || (openbsd && arm) || (openbsd && arm64) -// +build openbsd,386 openbsd,amd64 openbsd,arm openbsd,arm64 +//go:build openbsd && !mips64 +// +build openbsd,!mips64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go new file mode 100644 index 000000000..c2796139c --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go @@ -0,0 +1,42 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +func setTimespec(sec, nsec int64) Timespec { + return Timespec{Sec: sec, Nsec: nsec} +} + +func setTimeval(sec, usec int64) Timeval { + return Timeval{Sec: sec, Usec: usec} +} + +func SetKevent(k *Kevent_t, fd, mode, flags int) { + k.Ident = uint64(fd) + k.Filter = int16(mode) + k.Flags = uint16(flags) +} + +func (iov *Iovec) SetLen(length int) { + iov.Len = uint64(length) +} + +func (msghdr *Msghdr) SetControllen(length int) { + msghdr.Controllen = uint32(length) +} + +func (msghdr *Msghdr) SetIovlen(length int) { + msghdr.Iovlen = uint32(length) +} + +func (cmsg *Cmsghdr) SetLen(length int) { + cmsg.Len = uint32(length) +} + +// SYS___SYSCTL is used by syscall_bsd.go for all BSDs, but in modern versions +// of openbsd/ppc64 the syscall is called sysctl instead of __sysctl. +const SYS___SYSCTL = SYS_SYSCTL diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go new file mode 100644 index 000000000..23199a7ff --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go @@ -0,0 +1,42 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +func setTimespec(sec, nsec int64) Timespec { + return Timespec{Sec: sec, Nsec: nsec} +} + +func setTimeval(sec, usec int64) Timeval { + return Timeval{Sec: sec, Usec: usec} +} + +func SetKevent(k *Kevent_t, fd, mode, flags int) { + k.Ident = uint64(fd) + k.Filter = int16(mode) + k.Flags = uint16(flags) +} + +func (iov *Iovec) SetLen(length int) { + iov.Len = uint64(length) +} + +func (msghdr *Msghdr) SetControllen(length int) { + msghdr.Controllen = uint32(length) +} + +func (msghdr *Msghdr) SetIovlen(length int) { + msghdr.Iovlen = uint32(length) +} + +func (cmsg *Cmsghdr) SetLen(length int) { + cmsg.Len = uint32(length) +} + +// SYS___SYSCTL is used by syscall_bsd.go for all BSDs, but in modern versions +// of openbsd/riscv64 the syscall is called sysctl instead of __sysctl. +const SYS___SYSCTL = SYS_SYSCTL diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index 03fa546ec..2109e569c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -750,8 +750,8 @@ type EventPort struct { // we should handle things gracefully. To do so, we need to keep an extra // reference to the cookie around until the event is processed // thus the otherwise seemingly extraneous "cookies" map - // The key of this map is a pointer to the corresponding &fCookie.cookie - cookies map[*interface{}]*fileObjCookie + // The key of this map is a pointer to the corresponding fCookie + cookies map[*fileObjCookie]struct{} } // PortEvent is an abstraction of the port_event C struct. @@ -778,7 +778,7 @@ func NewEventPort() (*EventPort, error) { port: port, fds: make(map[uintptr]*fileObjCookie), paths: make(map[string]*fileObjCookie), - cookies: make(map[*interface{}]*fileObjCookie), + cookies: make(map[*fileObjCookie]struct{}), } return e, nil } @@ -799,6 +799,7 @@ func (e *EventPort) Close() error { } e.fds = nil e.paths = nil + e.cookies = nil return nil } @@ -826,17 +827,16 @@ func (e *EventPort) AssociatePath(path string, stat os.FileInfo, events int, coo if _, found := e.paths[path]; found { return fmt.Errorf("%v is already associated with this Event Port", path) } - fobj, err := createFileObj(path, stat) + fCookie, err := createFileObjCookie(path, stat, cookie) if err != nil { return err } - fCookie := &fileObjCookie{fobj, cookie} - _, err = port_associate(e.port, PORT_SOURCE_FILE, uintptr(unsafe.Pointer(fobj)), events, (*byte)(unsafe.Pointer(&fCookie.cookie))) + _, err = port_associate(e.port, PORT_SOURCE_FILE, uintptr(unsafe.Pointer(fCookie.fobj)), events, (*byte)(unsafe.Pointer(fCookie))) if err != nil { return err } e.paths[path] = fCookie - e.cookies[&fCookie.cookie] = fCookie + e.cookies[fCookie] = struct{}{} return nil } @@ -858,7 +858,7 @@ func (e *EventPort) DissociatePath(path string) error { if err == nil { // dissociate was successful, safe to delete the cookie fCookie := e.paths[path] - delete(e.cookies, &fCookie.cookie) + delete(e.cookies, fCookie) } delete(e.paths, path) return err @@ -871,13 +871,16 @@ func (e *EventPort) AssociateFd(fd uintptr, events int, cookie interface{}) erro if _, found := e.fds[fd]; found { return fmt.Errorf("%v is already associated with this Event Port", fd) } - fCookie := &fileObjCookie{nil, cookie} - _, err := port_associate(e.port, PORT_SOURCE_FD, fd, events, (*byte)(unsafe.Pointer(&fCookie.cookie))) + fCookie, err := createFileObjCookie("", nil, cookie) + if err != nil { + return err + } + _, err = port_associate(e.port, PORT_SOURCE_FD, fd, events, (*byte)(unsafe.Pointer(fCookie))) if err != nil { return err } e.fds[fd] = fCookie - e.cookies[&fCookie.cookie] = fCookie + e.cookies[fCookie] = struct{}{} return nil } @@ -896,27 +899,31 @@ func (e *EventPort) DissociateFd(fd uintptr) error { if err == nil { // dissociate was successful, safe to delete the cookie fCookie := e.fds[fd] - delete(e.cookies, &fCookie.cookie) + delete(e.cookies, fCookie) } delete(e.fds, fd) return err } -func createFileObj(name string, stat os.FileInfo) (*fileObj, error) { - fobj := new(fileObj) - bs, err := ByteSliceFromString(name) - if err != nil { - return nil, err - } - fobj.Name = (*int8)(unsafe.Pointer(&bs[0])) - s := stat.Sys().(*syscall.Stat_t) - fobj.Atim.Sec = s.Atim.Sec - fobj.Atim.Nsec = s.Atim.Nsec - fobj.Mtim.Sec = s.Mtim.Sec - fobj.Mtim.Nsec = s.Mtim.Nsec - fobj.Ctim.Sec = s.Ctim.Sec - fobj.Ctim.Nsec = s.Ctim.Nsec - return fobj, nil +func createFileObjCookie(name string, stat os.FileInfo, cookie interface{}) (*fileObjCookie, error) { + fCookie := new(fileObjCookie) + fCookie.cookie = cookie + if name != "" && stat != nil { + fCookie.fobj = new(fileObj) + bs, err := ByteSliceFromString(name) + if err != nil { + return nil, err + } + fCookie.fobj.Name = (*int8)(unsafe.Pointer(&bs[0])) + s := stat.Sys().(*syscall.Stat_t) + fCookie.fobj.Atim.Sec = s.Atim.Sec + fCookie.fobj.Atim.Nsec = s.Atim.Nsec + fCookie.fobj.Mtim.Sec = s.Mtim.Sec + fCookie.fobj.Mtim.Nsec = s.Mtim.Nsec + fCookie.fobj.Ctim.Sec = s.Ctim.Sec + fCookie.fobj.Ctim.Nsec = s.Ctim.Nsec + } + return fCookie, nil } // GetOne wraps port_get(3c) and returns a single PortEvent. @@ -929,44 +936,50 @@ func (e *EventPort) GetOne(t *Timespec) (*PortEvent, error) { p := new(PortEvent) e.mu.Lock() defer e.mu.Unlock() - e.peIntToExt(pe, p) + err = e.peIntToExt(pe, p) + if err != nil { + return nil, err + } return p, nil } // peIntToExt converts a cgo portEvent struct into the friendlier PortEvent // NOTE: Always call this function while holding the e.mu mutex -func (e *EventPort) peIntToExt(peInt *portEvent, peExt *PortEvent) { +func (e *EventPort) peIntToExt(peInt *portEvent, peExt *PortEvent) error { + if e.cookies == nil { + return fmt.Errorf("this EventPort is already closed") + } peExt.Events = peInt.Events peExt.Source = peInt.Source - cookie := (*interface{})(unsafe.Pointer(peInt.User)) - peExt.Cookie = *cookie + fCookie := (*fileObjCookie)(unsafe.Pointer(peInt.User)) + _, found := e.cookies[fCookie] + + if !found { + panic("unexpected event port address; may be due to kernel bug; see https://go.dev/issue/54254") + } + peExt.Cookie = fCookie.cookie + delete(e.cookies, fCookie) + switch peInt.Source { case PORT_SOURCE_FD: - delete(e.cookies, cookie) peExt.Fd = uintptr(peInt.Object) // Only remove the fds entry if it exists and this cookie matches if fobj, ok := e.fds[peExt.Fd]; ok { - if &fobj.cookie == cookie { + if fobj == fCookie { delete(e.fds, peExt.Fd) } } case PORT_SOURCE_FILE: - if fCookie, ok := e.cookies[cookie]; ok && uintptr(unsafe.Pointer(fCookie.fobj)) == uintptr(peInt.Object) { - // Use our stashed reference rather than using unsafe on what we got back - // the unsafe version would be (*fileObj)(unsafe.Pointer(uintptr(peInt.Object))) - peExt.fobj = fCookie.fobj - } else { - panic("unexpected event port address; may be due to kernel bug; see https://go.dev/issue/54254") - } - delete(e.cookies, cookie) + peExt.fobj = fCookie.fobj peExt.Path = BytePtrToString((*byte)(unsafe.Pointer(peExt.fobj.Name))) // Only remove the paths entry if it exists and this cookie matches if fobj, ok := e.paths[peExt.Path]; ok { - if &fobj.cookie == cookie { + if fobj == fCookie { delete(e.paths, peExt.Path) } } } + return nil } // Pending wraps port_getn(3c) and returns how many events are pending. @@ -990,7 +1003,7 @@ func (e *EventPort) Get(s []PortEvent, min int, timeout *Timespec) (int, error) got := uint32(min) max := uint32(len(s)) var err error - ps := make([]portEvent, max, max) + ps := make([]portEvent, max) _, err = port_getn(e.port, &ps[0], max, &got, timeout) // got will be trustworthy with ETIME, but not any other error. if err != nil && err != ETIME { @@ -998,8 +1011,122 @@ func (e *EventPort) Get(s []PortEvent, min int, timeout *Timespec) (int, error) } e.mu.Lock() defer e.mu.Unlock() + valid := 0 for i := 0; i < int(got); i++ { - e.peIntToExt(&ps[i], &s[i]) + err2 := e.peIntToExt(&ps[i], &s[i]) + if err2 != nil { + if valid == 0 && err == nil { + // If err2 is the only error and there are no valid events + // to return, return it to the caller. + err = err2 + } + break + } + valid = i + 1 + } + return valid, err +} + +//sys putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) + +func Putmsg(fd int, cl []byte, data []byte, flags int) (err error) { + var clp, datap *strbuf + if len(cl) > 0 { + clp = &strbuf{ + Len: int32(len(cl)), + Buf: (*int8)(unsafe.Pointer(&cl[0])), + } } - return int(got), err + if len(data) > 0 { + datap = &strbuf{ + Len: int32(len(data)), + Buf: (*int8)(unsafe.Pointer(&data[0])), + } + } + return putmsg(fd, clp, datap, flags) +} + +//sys getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) + +func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags int, err error) { + var clp, datap *strbuf + if len(cl) > 0 { + clp = &strbuf{ + Maxlen: int32(len(cl)), + Buf: (*int8)(unsafe.Pointer(&cl[0])), + } + } + if len(data) > 0 { + datap = &strbuf{ + Maxlen: int32(len(data)), + Buf: (*int8)(unsafe.Pointer(&data[0])), + } + } + + if err = getmsg(fd, clp, datap, &flags); err != nil { + return nil, nil, 0, err + } + + if len(cl) > 0 { + retCl = cl[:clp.Len] + } + if len(data) > 0 { + retData = data[:datap.Len] + } + return retCl, retData, flags, nil +} + +func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) { + return ioctlRet(fd, req, uintptr(arg)) +} + +func IoctlSetString(fd int, req uint, val string) error { + bs := make([]byte, len(val)+1) + copy(bs[:len(bs)-1], val) + err := ioctl(fd, req, uintptr(unsafe.Pointer(&bs[0]))) + runtime.KeepAlive(&bs[0]) + return err +} + +// Lifreq Helpers + +func (l *Lifreq) SetName(name string) error { + if len(name) >= len(l.Name) { + return fmt.Errorf("name cannot be more than %d characters", len(l.Name)-1) + } + for i := range name { + l.Name[i] = int8(name[i]) + } + return nil +} + +func (l *Lifreq) SetLifruInt(d int) { + *(*int)(unsafe.Pointer(&l.Lifru[0])) = d +} + +func (l *Lifreq) GetLifruInt() int { + return *(*int)(unsafe.Pointer(&l.Lifru[0])) +} + +func (l *Lifreq) SetLifruUint(d uint) { + *(*uint)(unsafe.Pointer(&l.Lifru[0])) = d +} + +func (l *Lifreq) GetLifruUint() uint { + return *(*uint)(unsafe.Pointer(&l.Lifru[0])) +} + +func IoctlLifreq(fd int, req uint, l *Lifreq) error { + return ioctl(fd, req, uintptr(unsafe.Pointer(l))) +} + +// Strioctl Helpers + +func (s *Strioctl) SetInt(i int) { + s.Len = int32(unsafe.Sizeof(i)) + s.Dp = (*int8)(unsafe.Pointer(&i)) +} + +func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) { + return ioctlRet(fd, req, uintptr(unsafe.Pointer(s))) } diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 1ff5060b5..00bafda86 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -13,8 +13,6 @@ import ( "sync" "syscall" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) var ( @@ -117,11 +115,7 @@ func (m *mmapper) Mmap(fd int, offset int64, length int, prot int, flags int) (d } // Use unsafe to convert addr into a []byte. - var b []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&b)) - hdr.Data = unsafe.Pointer(addr) - hdr.Cap = length - hdr.Len = length + b := unsafe.Slice((*byte)(unsafe.Pointer(addr)), length) // Register mapping in m and return it. p := &b[cap(b)-1] @@ -429,11 +423,15 @@ func Send(s int, buf []byte, flags int) (err error) { } func Sendto(fd int, p []byte, flags int, to Sockaddr) (err error) { - ptr, n, err := to.sockaddr() - if err != nil { - return err + var ptr unsafe.Pointer + var salen _Socklen + if to != nil { + ptr, salen, err = to.sockaddr() + if err != nil { + return err + } } - return sendto(fd, p, flags, ptr, n) + return sendto(fd, p, flags, ptr, salen) } func SetsockoptByte(fd, level, opt int, value byte) (err error) { diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go index 5898e9a52..b6919ca58 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go @@ -2,11 +2,9 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris) && gc && !ppc64le && !ppc64 -// +build darwin dragonfly freebsd linux netbsd openbsd solaris +//go:build (darwin || dragonfly || freebsd || (linux && !ppc64 && !ppc64le) || netbsd || openbsd || solaris) && gc +// +build darwin dragonfly freebsd linux,!ppc64,!ppc64le netbsd openbsd solaris // +build gc -// +build !ppc64le -// +build !ppc64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index f8616f454..68b2f3e1c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -9,8 +9,10 @@ package unix import ( "bytes" + "fmt" "runtime" "sort" + "strings" "sync" "syscall" "unsafe" @@ -55,7 +57,13 @@ func (d *Dirent) NameString() string { if d == nil { return "" } - return string(d.Name[:d.Namlen]) + s := string(d.Name[:]) + idx := strings.IndexByte(s, 0) + if idx == -1 { + return s + } else { + return s[:idx] + } } func (sa *SockaddrInet4) sockaddr() (unsafe.Pointer, _Socklen, error) { @@ -1230,6 +1238,14 @@ func Readdir(dir uintptr) (*Dirent, error) { return &ent, err } +func readdir_r(dirp uintptr, entry *direntLE, result **direntLE) (err error) { + r0, _, e1 := syscall_syscall(SYS___READDIR_R_A, dirp, uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + if int64(r0) == -1 { + err = errnoErr(Errno(e1)) + } + return +} + func Closedir(dir uintptr) error { _, _, e := syscall_syscall(SYS_CLOSEDIR, dir, 0, 0) if e != 0 { @@ -1821,3 +1837,158 @@ func Unmount(name string, mtm int) (err error) { } return err } + +func fdToPath(dirfd int) (path string, err error) { + var buffer [1024]byte + // w_ctrl() + ret := runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_W_IOCTL<<4, + []uintptr{uintptr(dirfd), 17, 1024, uintptr(unsafe.Pointer(&buffer[0]))}) + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + // __e2a_l() + runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___E2A_L<<4, + []uintptr{uintptr(unsafe.Pointer(&buffer[0])), uintptr(zb)}) + return string(buffer[:zb]), nil + } + // __errno() + errno := int(*(*int32)(unsafe.Pointer(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO<<4, + []uintptr{})))) + // __errno2() + errno2 := int(runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS___ERRNO2<<4, + []uintptr{})) + // strerror_r() + ret = runtime.CallLeFuncByPtr(runtime.XplinkLibvec+SYS_STRERROR_R<<4, + []uintptr{uintptr(errno), uintptr(unsafe.Pointer(&buffer[0])), 1024}) + if ret == 0 { + zb := bytes.IndexByte(buffer[:], 0) + if zb == -1 { + zb = len(buffer) + } + return "", fmt.Errorf("%s (errno2=0x%x)", buffer[:zb], errno2) + } else { + return "", fmt.Errorf("fdToPath errno %d (errno2=0x%x)", errno, errno2) + } +} + +func direntLeToDirentUnix(dirent *direntLE, dir uintptr, path string) (Dirent, error) { + var d Dirent + + d.Ino = uint64(dirent.Ino) + offset, err := Telldir(dir) + if err != nil { + return d, err + } + + d.Off = int64(offset) + s := string(bytes.Split(dirent.Name[:], []byte{0})[0]) + copy(d.Name[:], s) + + d.Reclen = uint16(24 + len(d.NameString())) + var st Stat_t + path = path + "/" + s + err = Lstat(path, &st) + if err != nil { + return d, err + } + + d.Type = uint8(st.Mode >> 24) + return d, err +} + +func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { + // Simulation of Getdirentries port from the Darwin implementation. + // COMMENTS FROM DARWIN: + // It's not the full required semantics, but should handle the case + // of calling Getdirentries or ReadDirent repeatedly. + // It won't handle assigning the results of lseek to *basep, or handle + // the directory being edited underfoot. + + skip, err := Seek(fd, 0, 1 /* SEEK_CUR */) + if err != nil { + return 0, err + } + + // Get path from fd to avoid unavailable call (fdopendir) + path, err := fdToPath(fd) + if err != nil { + return 0, err + } + d, err := Opendir(path) + if err != nil { + return 0, err + } + defer Closedir(d) + + var cnt int64 + for { + var entryLE direntLE + var entrypLE *direntLE + e := readdir_r(d, &entryLE, &entrypLE) + if e != nil { + return n, e + } + if entrypLE == nil { + break + } + if skip > 0 { + skip-- + cnt++ + continue + } + + // Dirent on zos has a different structure + entry, e := direntLeToDirentUnix(&entryLE, d, path) + if e != nil { + return n, e + } + + reclen := int(entry.Reclen) + if reclen > len(buf) { + // Not enough room. Return for now. + // The counter will let us know where we should start up again. + // Note: this strategy for suspending in the middle and + // restarting is O(n^2) in the length of the directory. Oh well. + break + } + + // Copy entry into return buffer. + s := unsafe.Slice((*byte)(unsafe.Pointer(&entry)), reclen) + copy(buf, s) + + buf = buf[reclen:] + n += reclen + cnt++ + } + // Set the seek offset of the input fd to record + // how many files we've already returned. + _, err = Seek(fd, cnt, 0 /* SEEK_SET */) + if err != nil { + return n, err + } + + return n, nil +} + +func ReadDirent(fd int, buf []byte) (n int, err error) { + var base = (*uintptr)(unsafe.Pointer(new(uint64))) + return Getdirentries(fd, buf, base) +} + +func direntIno(buf []byte) (uint64, bool) { + return readInt(buf, unsafe.Offsetof(Dirent{}.Ino), unsafe.Sizeof(Dirent{}.Ino)) +} + +func direntReclen(buf []byte) (uint64, bool) { + return readInt(buf, unsafe.Offsetof(Dirent{}.Reclen), unsafe.Sizeof(Dirent{}.Reclen)) +} + +func direntNamlen(buf []byte) (uint64, bool) { + reclen, ok := direntReclen(buf) + if !ok { + return 0, false + } + return reclen - uint64(unsafe.Offsetof(Dirent{}.Name)), true +} diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go index 0bb4c8de5..5bb41d17b 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go @@ -7,11 +7,7 @@ package unix -import ( - "unsafe" - - "golang.org/x/sys/internal/unsafeheader" -) +import "unsafe" // SysvShmAttach attaches the Sysv shared memory segment associated with the // shared memory identifier id. @@ -34,12 +30,7 @@ func SysvShmAttach(id int, addr uintptr, flag int) ([]byte, error) { } // Use unsafe to convert addr into a []byte. - // TODO: convert to unsafe.Slice once we can assume Go 1.17 - var b []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&b)) - hdr.Data = unsafe.Pointer(addr) - hdr.Cap = int(info.Segsz) - hdr.Len = int(info.Segsz) + b := unsafe.Slice((*byte)(unsafe.Pointer(addr)), int(info.Segsz)) return b, nil } diff --git a/vendor/golang.org/x/sys/unix/xattr_bsd.go b/vendor/golang.org/x/sys/unix/xattr_bsd.go index 25df1e378..663b3779d 100644 --- a/vendor/golang.org/x/sys/unix/xattr_bsd.go +++ b/vendor/golang.org/x/sys/unix/xattr_bsd.go @@ -160,13 +160,12 @@ func Lremovexattr(link string, attr string) (err error) { } func Listxattr(file string, dest []byte) (sz int, err error) { - d := initxattrdest(dest, 0) destsiz := len(dest) // FreeBSD won't allow you to list xattrs from multiple namespaces - s := 0 + s, pos := 0, 0 for _, nsid := range [...]int{EXTATTR_NAMESPACE_USER, EXTATTR_NAMESPACE_SYSTEM} { - stmp, e := ExtattrListFile(file, nsid, uintptr(d), destsiz) + stmp, e := ListxattrNS(file, nsid, dest[pos:]) /* Errors accessing system attrs are ignored so that * we can implement the Linux-like behavior of omitting errors that @@ -175,66 +174,102 @@ func Listxattr(file string, dest []byte) (sz int, err error) { * Linux will still error if we ask for user attributes on a file that * we don't have read permissions on, so don't ignore those errors */ - if e != nil && e == EPERM && nsid != EXTATTR_NAMESPACE_USER { - continue - } else if e != nil { + if e != nil { + if e == EPERM && nsid != EXTATTR_NAMESPACE_USER { + continue + } return s, e } s += stmp - destsiz -= s - if destsiz < 0 { - destsiz = 0 + pos = s + if pos > destsiz { + pos = destsiz } - d = initxattrdest(dest, s) } return s, nil } -func Flistxattr(fd int, dest []byte) (sz int, err error) { +func ListxattrNS(file string, nsid int, dest []byte) (sz int, err error) { d := initxattrdest(dest, 0) destsiz := len(dest) - s := 0 + s, e := ExtattrListFile(file, nsid, uintptr(d), destsiz) + if e != nil { + return 0, err + } + + return s, nil +} + +func Flistxattr(fd int, dest []byte) (sz int, err error) { + destsiz := len(dest) + + s, pos := 0, 0 for _, nsid := range [...]int{EXTATTR_NAMESPACE_USER, EXTATTR_NAMESPACE_SYSTEM} { - stmp, e := ExtattrListFd(fd, nsid, uintptr(d), destsiz) - if e != nil && e == EPERM && nsid != EXTATTR_NAMESPACE_USER { - continue - } else if e != nil { + stmp, e := FlistxattrNS(fd, nsid, dest[pos:]) + + if e != nil { + if e == EPERM && nsid != EXTATTR_NAMESPACE_USER { + continue + } return s, e } s += stmp - destsiz -= s - if destsiz < 0 { - destsiz = 0 + pos = s + if pos > destsiz { + pos = destsiz } - d = initxattrdest(dest, s) } return s, nil } -func Llistxattr(link string, dest []byte) (sz int, err error) { +func FlistxattrNS(fd int, nsid int, dest []byte) (sz int, err error) { d := initxattrdest(dest, 0) destsiz := len(dest) - s := 0 + s, e := ExtattrListFd(fd, nsid, uintptr(d), destsiz) + if e != nil { + return 0, err + } + + return s, nil +} + +func Llistxattr(link string, dest []byte) (sz int, err error) { + destsiz := len(dest) + + s, pos := 0, 0 for _, nsid := range [...]int{EXTATTR_NAMESPACE_USER, EXTATTR_NAMESPACE_SYSTEM} { - stmp, e := ExtattrListLink(link, nsid, uintptr(d), destsiz) - if e != nil && e == EPERM && nsid != EXTATTR_NAMESPACE_USER { - continue - } else if e != nil { + stmp, e := LlistxattrNS(link, nsid, dest[pos:]) + + if e != nil { + if e == EPERM && nsid != EXTATTR_NAMESPACE_USER { + continue + } return s, e } s += stmp - destsiz -= s - if destsiz < 0 { - destsiz = 0 + pos = s + if pos > destsiz { + pos = destsiz } - d = initxattrdest(dest, s) + } + + return s, nil +} + +func LlistxattrNS(link string, nsid int, dest []byte) (sz int, err error) { + d := initxattrdest(dest, 0) + destsiz := len(dest) + + s, e := ExtattrListLink(link, nsid, uintptr(d), destsiz) + if e != nil { + return 0, err } return s, nil diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go new file mode 100644 index 000000000..8e2c51b1e --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go @@ -0,0 +1,1905 @@ +// mkerrors.sh -m64 +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +// Code generated by cmd/cgo -godefs; DO NOT EDIT. +// cgo -godefs -- -m64 _const.go + +package unix + +import "syscall" + +const ( + AF_APPLETALK = 0x10 + AF_BLUETOOTH = 0x20 + AF_CCITT = 0xa + AF_CHAOS = 0x5 + AF_CNT = 0x15 + AF_COIP = 0x14 + AF_DATAKIT = 0x9 + AF_DECnet = 0xc + AF_DLI = 0xd + AF_E164 = 0x1a + AF_ECMA = 0x8 + AF_ENCAP = 0x1c + AF_HYLINK = 0xf + AF_IMPLINK = 0x3 + AF_INET = 0x2 + AF_INET6 = 0x18 + AF_IPX = 0x17 + AF_ISDN = 0x1a + AF_ISO = 0x7 + AF_KEY = 0x1e + AF_LAT = 0xe + AF_LINK = 0x12 + AF_LOCAL = 0x1 + AF_MAX = 0x24 + AF_MPLS = 0x21 + AF_NATM = 0x1b + AF_NS = 0x6 + AF_OSI = 0x7 + AF_PUP = 0x4 + AF_ROUTE = 0x11 + AF_SIP = 0x1d + AF_SNA = 0xb + AF_UNIX = 0x1 + AF_UNSPEC = 0x0 + ALTWERASE = 0x200 + ARPHRD_ETHER = 0x1 + ARPHRD_FRELAY = 0xf + ARPHRD_IEEE1394 = 0x18 + ARPHRD_IEEE802 = 0x6 + B0 = 0x0 + B110 = 0x6e + B115200 = 0x1c200 + B1200 = 0x4b0 + B134 = 0x86 + B14400 = 0x3840 + B150 = 0x96 + B1800 = 0x708 + B19200 = 0x4b00 + B200 = 0xc8 + B230400 = 0x38400 + B2400 = 0x960 + B28800 = 0x7080 + B300 = 0x12c + B38400 = 0x9600 + B4800 = 0x12c0 + B50 = 0x32 + B57600 = 0xe100 + B600 = 0x258 + B7200 = 0x1c20 + B75 = 0x4b + B76800 = 0x12c00 + B9600 = 0x2580 + BIOCFLUSH = 0x20004268 + BIOCGBLEN = 0x40044266 + BIOCGDIRFILT = 0x4004427c + BIOCGDLT = 0x4004426a + BIOCGDLTLIST = 0xc010427b + BIOCGETIF = 0x4020426b + BIOCGFILDROP = 0x40044278 + BIOCGHDRCMPLT = 0x40044274 + BIOCGRSIG = 0x40044273 + BIOCGRTIMEOUT = 0x4010426e + BIOCGSTATS = 0x4008426f + BIOCIMMEDIATE = 0x80044270 + BIOCLOCK = 0x20004276 + BIOCPROMISC = 0x20004269 + BIOCSBLEN = 0xc0044266 + BIOCSDIRFILT = 0x8004427d + BIOCSDLT = 0x8004427a + BIOCSETF = 0x80104267 + BIOCSETIF = 0x8020426c + BIOCSETWF = 0x80104277 + BIOCSFILDROP = 0x80044279 + BIOCSHDRCMPLT = 0x80044275 + BIOCSRSIG = 0x80044272 + BIOCSRTIMEOUT = 0x8010426d + BIOCVERSION = 0x40044271 + BPF_A = 0x10 + BPF_ABS = 0x20 + BPF_ADD = 0x0 + BPF_ALIGNMENT = 0x4 + BPF_ALU = 0x4 + BPF_AND = 0x50 + BPF_B = 0x10 + BPF_DIRECTION_IN = 0x1 + BPF_DIRECTION_OUT = 0x2 + BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 + BPF_H = 0x8 + BPF_IMM = 0x0 + BPF_IND = 0x40 + BPF_JA = 0x0 + BPF_JEQ = 0x10 + BPF_JGE = 0x30 + BPF_JGT = 0x20 + BPF_JMP = 0x5 + BPF_JSET = 0x40 + BPF_K = 0x0 + BPF_LD = 0x0 + BPF_LDX = 0x1 + BPF_LEN = 0x80 + BPF_LSH = 0x60 + BPF_MAJOR_VERSION = 0x1 + BPF_MAXBUFSIZE = 0x200000 + BPF_MAXINSNS = 0x200 + BPF_MEM = 0x60 + BPF_MEMWORDS = 0x10 + BPF_MINBUFSIZE = 0x20 + BPF_MINOR_VERSION = 0x1 + BPF_MISC = 0x7 + BPF_MSH = 0xa0 + BPF_MUL = 0x20 + BPF_NEG = 0x80 + BPF_OR = 0x40 + BPF_RELEASE = 0x30bb6 + BPF_RET = 0x6 + BPF_RND = 0xc0 + BPF_RSH = 0x70 + BPF_ST = 0x2 + BPF_STX = 0x3 + BPF_SUB = 0x10 + BPF_TAX = 0x0 + BPF_TXA = 0x80 + BPF_W = 0x0 + BPF_X = 0x8 + BRKINT = 0x2 + CFLUSH = 0xf + CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x6 + CLOCK_MONOTONIC = 0x3 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x4 + CLOCK_UPTIME = 0x5 + CPUSTATES = 0x6 + CP_IDLE = 0x5 + CP_INTR = 0x4 + CP_NICE = 0x1 + CP_SPIN = 0x3 + CP_SYS = 0x2 + CP_USER = 0x0 + CREAD = 0x800 + CRTSCTS = 0x10000 + CS5 = 0x0 + CS6 = 0x100 + CS7 = 0x200 + CS8 = 0x300 + CSIZE = 0x300 + CSTART = 0x11 + CSTATUS = 0xff + CSTOP = 0x13 + CSTOPB = 0x400 + CSUSP = 0x1a + CTL_HW = 0x6 + CTL_KERN = 0x1 + CTL_MAXNAME = 0xc + CTL_NET = 0x4 + DIOCADDQUEUE = 0xc110445d + DIOCADDRULE = 0xcd604404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcd60441a + DIOCCLRIFFLAG = 0xc028445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0e04412 + DIOCCLRSTATUS = 0xc0284416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1204460 + DIOCGETQUEUE = 0xc110445f + DIOCGETQUEUES = 0xc110445e + DIOCGETRULE = 0xcd604407 + DIOCGETRULES = 0xcd604406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0104454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0104419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0284457 + DIOCKILLSRCNODES = 0xc080445b + DIOCKILLSTATES = 0xc0e04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f + DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc4504443 + DIOCRADDTABLES = 0xc450443d + DIOCRCLRADDRS = 0xc4504442 + DIOCRCLRASTATS = 0xc4504448 + DIOCRCLRTABLES = 0xc450443c + DIOCRCLRTSTATS = 0xc4504441 + DIOCRDELADDRS = 0xc4504444 + DIOCRDELTABLES = 0xc450443e + DIOCRGETADDRS = 0xc4504446 + DIOCRGETASTATS = 0xc4504447 + DIOCRGETTABLES = 0xc450443f + DIOCRGETTSTATS = 0xc4504440 + DIOCRINADEFINE = 0xc450444d + DIOCRSETADDRS = 0xc4504445 + DIOCRSETTFLAGS = 0xc450444a + DIOCRTSTADDRS = 0xc4504449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0284459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0284414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc0104451 + DIOCXCOMMIT = 0xc0104452 + DIOCXROLLBACK = 0xc0104453 + DLT_ARCNET = 0x7 + DLT_ATM_RFC1483 = 0xb + DLT_AX25 = 0x3 + DLT_CHAOS = 0x5 + DLT_C_HDLC = 0x68 + DLT_EN10MB = 0x1 + DLT_EN3MB = 0x2 + DLT_ENC = 0xd + DLT_FDDI = 0xa + DLT_IEEE802 = 0x6 + DLT_IEEE802_11 = 0x69 + DLT_IEEE802_11_RADIO = 0x7f + DLT_LOOP = 0xc + DLT_MPLS = 0xdb + DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b + DLT_PFLOG = 0x75 + DLT_PFSYNC = 0x12 + DLT_PPP = 0x9 + DLT_PPP_BSDOS = 0x10 + DLT_PPP_ETHER = 0x33 + DLT_PPP_SERIAL = 0x32 + DLT_PRONET = 0x4 + DLT_RAW = 0xe + DLT_SLIP = 0x8 + DLT_SLIP_BSDOS = 0xf + DLT_USBPCAP = 0xf9 + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c + DT_BLK = 0x6 + DT_CHR = 0x2 + DT_DIR = 0x4 + DT_FIFO = 0x1 + DT_LNK = 0xa + DT_REG = 0x8 + DT_SOCK = 0xc + DT_UNKNOWN = 0x0 + ECHO = 0x8 + ECHOCTL = 0x40 + ECHOE = 0x2 + ECHOK = 0x4 + ECHOKE = 0x1 + ECHONL = 0x10 + ECHOPRT = 0x20 + EMT_TAGOVF = 0x1 + EMUL_ENABLED = 0x1 + EMUL_NATIVE = 0x2 + ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 + ETHERMIN = 0x2e + ETHERMTU = 0x5dc + ETHERTYPE_8023 = 0x4 + ETHERTYPE_AARP = 0x80f3 + ETHERTYPE_ACCTON = 0x8390 + ETHERTYPE_AEONIC = 0x8036 + ETHERTYPE_ALPHA = 0x814a + ETHERTYPE_AMBER = 0x6008 + ETHERTYPE_AMOEBA = 0x8145 + ETHERTYPE_AOE = 0x88a2 + ETHERTYPE_APOLLO = 0x80f7 + ETHERTYPE_APOLLODOMAIN = 0x8019 + ETHERTYPE_APPLETALK = 0x809b + ETHERTYPE_APPLITEK = 0x80c7 + ETHERTYPE_ARGONAUT = 0x803a + ETHERTYPE_ARP = 0x806 + ETHERTYPE_AT = 0x809b + ETHERTYPE_ATALK = 0x809b + ETHERTYPE_ATOMIC = 0x86df + ETHERTYPE_ATT = 0x8069 + ETHERTYPE_ATTSTANFORD = 0x8008 + ETHERTYPE_AUTOPHON = 0x806a + ETHERTYPE_AXIS = 0x8856 + ETHERTYPE_BCLOOP = 0x9003 + ETHERTYPE_BOFL = 0x8102 + ETHERTYPE_CABLETRON = 0x7034 + ETHERTYPE_CHAOS = 0x804 + ETHERTYPE_COMDESIGN = 0x806c + ETHERTYPE_COMPUGRAPHIC = 0x806d + ETHERTYPE_COUNTERPOINT = 0x8062 + ETHERTYPE_CRONUS = 0x8004 + ETHERTYPE_CRONUSVLN = 0x8003 + ETHERTYPE_DCA = 0x1234 + ETHERTYPE_DDE = 0x807b + ETHERTYPE_DEBNI = 0xaaaa + ETHERTYPE_DECAM = 0x8048 + ETHERTYPE_DECCUST = 0x6006 + ETHERTYPE_DECDIAG = 0x6005 + ETHERTYPE_DECDNS = 0x803c + ETHERTYPE_DECDTS = 0x803e + ETHERTYPE_DECEXPER = 0x6000 + ETHERTYPE_DECLAST = 0x8041 + ETHERTYPE_DECLTM = 0x803f + ETHERTYPE_DECMUMPS = 0x6009 + ETHERTYPE_DECNETBIOS = 0x8040 + ETHERTYPE_DELTACON = 0x86de + ETHERTYPE_DIDDLE = 0x4321 + ETHERTYPE_DLOG1 = 0x660 + ETHERTYPE_DLOG2 = 0x661 + ETHERTYPE_DN = 0x6003 + ETHERTYPE_DOGFIGHT = 0x1989 + ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e + ETHERTYPE_ECMA = 0x803 + ETHERTYPE_ENCRYPT = 0x803d + ETHERTYPE_ES = 0x805d + ETHERTYPE_EXCELAN = 0x8010 + ETHERTYPE_EXPERDATA = 0x8049 + ETHERTYPE_FLIP = 0x8146 + ETHERTYPE_FLOWCONTROL = 0x8808 + ETHERTYPE_FRARP = 0x808 + ETHERTYPE_GENDYN = 0x8068 + ETHERTYPE_HAYES = 0x8130 + ETHERTYPE_HIPPI_FP = 0x8180 + ETHERTYPE_HITACHI = 0x8820 + ETHERTYPE_HP = 0x8005 + ETHERTYPE_IEEEPUP = 0xa00 + ETHERTYPE_IEEEPUPAT = 0xa01 + ETHERTYPE_IMLBL = 0x4c42 + ETHERTYPE_IMLBLDIAG = 0x424c + ETHERTYPE_IP = 0x800 + ETHERTYPE_IPAS = 0x876c + ETHERTYPE_IPV6 = 0x86dd + ETHERTYPE_IPX = 0x8137 + ETHERTYPE_IPXNEW = 0x8037 + ETHERTYPE_KALPANA = 0x8582 + ETHERTYPE_LANBRIDGE = 0x8038 + ETHERTYPE_LANPROBE = 0x8888 + ETHERTYPE_LAT = 0x6004 + ETHERTYPE_LBACK = 0x9000 + ETHERTYPE_LITTLE = 0x8060 + ETHERTYPE_LLDP = 0x88cc + ETHERTYPE_LOGICRAFT = 0x8148 + ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 + ETHERTYPE_MATRA = 0x807a + ETHERTYPE_MAX = 0xffff + ETHERTYPE_MERIT = 0x807c + ETHERTYPE_MICP = 0x873a + ETHERTYPE_MOPDL = 0x6001 + ETHERTYPE_MOPRC = 0x6002 + ETHERTYPE_MOTOROLA = 0x818d + ETHERTYPE_MPLS = 0x8847 + ETHERTYPE_MPLS_MCAST = 0x8848 + ETHERTYPE_MUMPS = 0x813f + ETHERTYPE_NBPCC = 0x3c04 + ETHERTYPE_NBPCLAIM = 0x3c09 + ETHERTYPE_NBPCLREQ = 0x3c05 + ETHERTYPE_NBPCLRSP = 0x3c06 + ETHERTYPE_NBPCREQ = 0x3c02 + ETHERTYPE_NBPCRSP = 0x3c03 + ETHERTYPE_NBPDG = 0x3c07 + ETHERTYPE_NBPDGB = 0x3c08 + ETHERTYPE_NBPDLTE = 0x3c0a + ETHERTYPE_NBPRAR = 0x3c0c + ETHERTYPE_NBPRAS = 0x3c0b + ETHERTYPE_NBPRST = 0x3c0d + ETHERTYPE_NBPSCD = 0x3c01 + ETHERTYPE_NBPVCD = 0x3c00 + ETHERTYPE_NBS = 0x802 + ETHERTYPE_NCD = 0x8149 + ETHERTYPE_NESTAR = 0x8006 + ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 + ETHERTYPE_NOVELL = 0x8138 + ETHERTYPE_NS = 0x600 + ETHERTYPE_NSAT = 0x601 + ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f + ETHERTYPE_NTRAILER = 0x10 + ETHERTYPE_OS9 = 0x7007 + ETHERTYPE_OS9NET = 0x7009 + ETHERTYPE_PACER = 0x80c6 + ETHERTYPE_PBB = 0x88e7 + ETHERTYPE_PCS = 0x4242 + ETHERTYPE_PLANNING = 0x8044 + ETHERTYPE_PPP = 0x880b + ETHERTYPE_PPPOE = 0x8864 + ETHERTYPE_PPPOEDISC = 0x8863 + ETHERTYPE_PRIMENTS = 0x7031 + ETHERTYPE_PUP = 0x200 + ETHERTYPE_PUPAT = 0x200 + ETHERTYPE_QINQ = 0x88a8 + ETHERTYPE_RACAL = 0x7030 + ETHERTYPE_RATIONAL = 0x8150 + ETHERTYPE_RAWFR = 0x6559 + ETHERTYPE_RCL = 0x1995 + ETHERTYPE_RDP = 0x8739 + ETHERTYPE_RETIX = 0x80f2 + ETHERTYPE_REVARP = 0x8035 + ETHERTYPE_SCA = 0x6007 + ETHERTYPE_SECTRA = 0x86db + ETHERTYPE_SECUREDATA = 0x876d + ETHERTYPE_SGITW = 0x817e + ETHERTYPE_SG_BOUNCE = 0x8016 + ETHERTYPE_SG_DIAG = 0x8013 + ETHERTYPE_SG_NETGAMES = 0x8014 + ETHERTYPE_SG_RESV = 0x8015 + ETHERTYPE_SIMNET = 0x5208 + ETHERTYPE_SLOW = 0x8809 + ETHERTYPE_SNA = 0x80d5 + ETHERTYPE_SNMP = 0x814c + ETHERTYPE_SONIX = 0xfaf5 + ETHERTYPE_SPIDER = 0x809f + ETHERTYPE_SPRITE = 0x500 + ETHERTYPE_STP = 0x8181 + ETHERTYPE_TALARIS = 0x812b + ETHERTYPE_TALARISMC = 0x852b + ETHERTYPE_TCPCOMP = 0x876b + ETHERTYPE_TCPSM = 0x9002 + ETHERTYPE_TEC = 0x814f + ETHERTYPE_TIGAN = 0x802f + ETHERTYPE_TRAIL = 0x1000 + ETHERTYPE_TRANSETHER = 0x6558 + ETHERTYPE_TYMSHARE = 0x802e + ETHERTYPE_UBBST = 0x7005 + ETHERTYPE_UBDEBUG = 0x900 + ETHERTYPE_UBDIAGLOOP = 0x7002 + ETHERTYPE_UBDL = 0x7000 + ETHERTYPE_UBNIU = 0x7001 + ETHERTYPE_UBNMC = 0x7003 + ETHERTYPE_VALID = 0x1600 + ETHERTYPE_VARIAN = 0x80dd + ETHERTYPE_VAXELN = 0x803b + ETHERTYPE_VEECO = 0x8067 + ETHERTYPE_VEXP = 0x805b + ETHERTYPE_VGLAB = 0x8131 + ETHERTYPE_VINES = 0xbad + ETHERTYPE_VINESECHO = 0xbaf + ETHERTYPE_VINESLOOP = 0xbae + ETHERTYPE_VITAL = 0xff00 + ETHERTYPE_VLAN = 0x8100 + ETHERTYPE_VLTLMAN = 0x8080 + ETHERTYPE_VPROD = 0x805c + ETHERTYPE_VURESERVED = 0x8147 + ETHERTYPE_WATERLOO = 0x8130 + ETHERTYPE_WELLFLEET = 0x8103 + ETHERTYPE_X25 = 0x805 + ETHERTYPE_X75 = 0x801 + ETHERTYPE_XNSSM = 0x9001 + ETHERTYPE_XTP = 0x817d + ETHER_ADDR_LEN = 0x6 + ETHER_ALIGN = 0x2 + ETHER_CRC_LEN = 0x4 + ETHER_CRC_POLY_BE = 0x4c11db6 + ETHER_CRC_POLY_LE = 0xedb88320 + ETHER_HDR_LEN = 0xe + ETHER_MAX_DIX_LEN = 0x600 + ETHER_MAX_HARDMTU_LEN = 0xff9b + ETHER_MAX_LEN = 0x5ee + ETHER_MIN_LEN = 0x40 + ETHER_TYPE_LEN = 0x2 + ETHER_VLAN_ENCAP_LEN = 0x4 + EVFILT_AIO = -0x3 + EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 + EVFILT_PROC = -0x5 + EVFILT_READ = -0x1 + EVFILT_SIGNAL = -0x6 + EVFILT_SYSCOUNT = 0x9 + EVFILT_TIMER = -0x7 + EVFILT_VNODE = -0x4 + EVFILT_WRITE = -0x2 + EVL_ENCAPLEN = 0x4 + EVL_PRIO_BITS = 0xd + EVL_PRIO_MAX = 0x7 + EVL_VLID_MASK = 0xfff + EVL_VLID_MAX = 0xffe + EVL_VLID_MIN = 0x1 + EVL_VLID_NULL = 0x0 + EV_ADD = 0x1 + EV_CLEAR = 0x20 + EV_DELETE = 0x2 + EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 + EV_ENABLE = 0x4 + EV_EOF = 0x8000 + EV_ERROR = 0x4000 + EV_FLAG1 = 0x2000 + EV_ONESHOT = 0x10 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf800 + EXTA = 0x4b00 + EXTB = 0x9600 + EXTPROC = 0x800 + FD_CLOEXEC = 0x1 + FD_SETSIZE = 0x400 + FLUSHO = 0x800000 + F_DUPFD = 0x0 + F_DUPFD_CLOEXEC = 0xa + F_GETFD = 0x1 + F_GETFL = 0x3 + F_GETLK = 0x7 + F_GETOWN = 0x5 + F_ISATTY = 0xb + F_OK = 0x0 + F_RDLCK = 0x1 + F_SETFD = 0x2 + F_SETFL = 0x4 + F_SETLK = 0x8 + F_SETLKW = 0x9 + F_SETOWN = 0x6 + F_UNLCK = 0x2 + F_WRLCK = 0x3 + HUPCL = 0x4000 + HW_MACHINE = 0x1 + ICANON = 0x100 + ICMP6_FILTER = 0x12 + ICRNL = 0x100 + IEXTEN = 0x400 + IFAN_ARRIVAL = 0x0 + IFAN_DEPARTURE = 0x1 + IFF_ALLMULTI = 0x200 + IFF_BROADCAST = 0x2 + IFF_CANTCHANGE = 0x8e52 + IFF_DEBUG = 0x4 + IFF_LINK0 = 0x1000 + IFF_LINK1 = 0x2000 + IFF_LINK2 = 0x4000 + IFF_LOOPBACK = 0x8 + IFF_MULTICAST = 0x8000 + IFF_NOARP = 0x80 + IFF_OACTIVE = 0x400 + IFF_POINTOPOINT = 0x10 + IFF_PROMISC = 0x100 + IFF_RUNNING = 0x40 + IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x20 + IFF_UP = 0x1 + IFNAMSIZ = 0x10 + IFT_1822 = 0x2 + IFT_A12MPPSWITCH = 0x82 + IFT_AAL2 = 0xbb + IFT_AAL5 = 0x31 + IFT_ADSL = 0x5e + IFT_AFLANE8023 = 0x3b + IFT_AFLANE8025 = 0x3c + IFT_ARAP = 0x58 + IFT_ARCNET = 0x23 + IFT_ARCNETPLUS = 0x24 + IFT_ASYNC = 0x54 + IFT_ATM = 0x25 + IFT_ATMDXI = 0x69 + IFT_ATMFUNI = 0x6a + IFT_ATMIMA = 0x6b + IFT_ATMLOGICAL = 0x50 + IFT_ATMRADIO = 0xbd + IFT_ATMSUBINTERFACE = 0x86 + IFT_ATMVCIENDPT = 0xc2 + IFT_ATMVIRTUAL = 0x95 + IFT_BGPPOLICYACCOUNTING = 0xa2 + IFT_BLUETOOTH = 0xf8 + IFT_BRIDGE = 0xd1 + IFT_BSC = 0x53 + IFT_CARP = 0xf7 + IFT_CCTEMUL = 0x3d + IFT_CEPT = 0x13 + IFT_CES = 0x85 + IFT_CHANNEL = 0x46 + IFT_CNR = 0x55 + IFT_COFFEE = 0x84 + IFT_COMPOSITELINK = 0x9b + IFT_DCN = 0x8d + IFT_DIGITALPOWERLINE = 0x8a + IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba + IFT_DLSW = 0x4a + IFT_DOCSCABLEDOWNSTREAM = 0x80 + IFT_DOCSCABLEMACLAYER = 0x7f + IFT_DOCSCABLEUPSTREAM = 0x81 + IFT_DOCSCABLEUPSTREAMCHANNEL = 0xcd + IFT_DS0 = 0x51 + IFT_DS0BUNDLE = 0x52 + IFT_DS1FDL = 0xaa + IFT_DS3 = 0x1e + IFT_DTM = 0x8c + IFT_DUMMY = 0xf1 + IFT_DVBASILN = 0xac + IFT_DVBASIOUT = 0xad + IFT_DVBRCCDOWNSTREAM = 0x93 + IFT_DVBRCCMACLAYER = 0x92 + IFT_DVBRCCUPSTREAM = 0x94 + IFT_ECONET = 0xce + IFT_ENC = 0xf4 + IFT_EON = 0x19 + IFT_EPLRS = 0x57 + IFT_ESCON = 0x49 + IFT_ETHER = 0x6 + IFT_FAITH = 0xf3 + IFT_FAST = 0x7d + IFT_FASTETHER = 0x3e + IFT_FASTETHERFX = 0x45 + IFT_FDDI = 0xf + IFT_FIBRECHANNEL = 0x38 + IFT_FRAMERELAYINTERCONNECT = 0x3a + IFT_FRAMERELAYMPI = 0x5c + IFT_FRDLCIENDPT = 0xc1 + IFT_FRELAY = 0x20 + IFT_FRELAYDCE = 0x2c + IFT_FRF16MFRBUNDLE = 0xa3 + IFT_FRFORWARD = 0x9e + IFT_G703AT2MB = 0x43 + IFT_G703AT64K = 0x42 + IFT_GIF = 0xf0 + IFT_GIGABITETHERNET = 0x75 + IFT_GR303IDT = 0xb2 + IFT_GR303RDT = 0xb1 + IFT_H323GATEKEEPER = 0xa4 + IFT_H323PROXY = 0xa5 + IFT_HDH1822 = 0x3 + IFT_HDLC = 0x76 + IFT_HDSL2 = 0xa8 + IFT_HIPERLAN2 = 0xb7 + IFT_HIPPI = 0x2f + IFT_HIPPIINTERFACE = 0x39 + IFT_HOSTPAD = 0x5a + IFT_HSSI = 0x2e + IFT_HY = 0xe + IFT_IBM370PARCHAN = 0x48 + IFT_IDSL = 0x9a + IFT_IEEE1394 = 0x90 + IFT_IEEE80211 = 0x47 + IFT_IEEE80212 = 0x37 + IFT_IEEE8023ADLAG = 0xa1 + IFT_IFGSN = 0x91 + IFT_IMT = 0xbe + IFT_INFINIBAND = 0xc7 + IFT_INTERLEAVE = 0x7c + IFT_IP = 0x7e + IFT_IPFORWARD = 0x8e + IFT_IPOVERATM = 0x72 + IFT_IPOVERCDLC = 0x6d + IFT_IPOVERCLAW = 0x6e + IFT_IPSWITCH = 0x4e + IFT_ISDN = 0x3f + IFT_ISDNBASIC = 0x14 + IFT_ISDNPRIMARY = 0x15 + IFT_ISDNS = 0x4b + IFT_ISDNU = 0x4c + IFT_ISO88022LLC = 0x29 + IFT_ISO88023 = 0x7 + IFT_ISO88024 = 0x8 + IFT_ISO88025 = 0x9 + IFT_ISO88025CRFPINT = 0x62 + IFT_ISO88025DTR = 0x56 + IFT_ISO88025FIBER = 0x73 + IFT_ISO88026 = 0xa + IFT_ISUP = 0xb3 + IFT_L2VLAN = 0x87 + IFT_L3IPVLAN = 0x88 + IFT_L3IPXVLAN = 0x89 + IFT_LAPB = 0x10 + IFT_LAPD = 0x4d + IFT_LAPF = 0x77 + IFT_LINEGROUP = 0xd2 + IFT_LOCALTALK = 0x2a + IFT_LOOP = 0x18 + IFT_MBIM = 0xfa + IFT_MEDIAMAILOVERIP = 0x8b + IFT_MFSIGLINK = 0xa7 + IFT_MIOX25 = 0x26 + IFT_MODEM = 0x30 + IFT_MPC = 0x71 + IFT_MPLS = 0xa6 + IFT_MPLSTUNNEL = 0x96 + IFT_MSDSL = 0x8f + IFT_MVL = 0xbf + IFT_MYRINET = 0x63 + IFT_NFAS = 0xaf + IFT_NSIP = 0x1b + IFT_OPTICALCHANNEL = 0xc3 + IFT_OPTICALTRANSPORT = 0xc4 + IFT_OTHER = 0x1 + IFT_P10 = 0xc + IFT_P80 = 0xd + IFT_PARA = 0x22 + IFT_PFLOG = 0xf5 + IFT_PFLOW = 0xf9 + IFT_PFSYNC = 0xf6 + IFT_PLC = 0xae + IFT_PON155 = 0xcf + IFT_PON622 = 0xd0 + IFT_POS = 0xab + IFT_PPP = 0x17 + IFT_PPPMULTILINKBUNDLE = 0x6c + IFT_PROPATM = 0xc5 + IFT_PROPBWAP2MP = 0xb8 + IFT_PROPCNLS = 0x59 + IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 + IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 + IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 + IFT_PROPMUX = 0x36 + IFT_PROPVIRTUAL = 0x35 + IFT_PROPWIRELESSP2P = 0x9d + IFT_PTPSERIAL = 0x16 + IFT_PVC = 0xf2 + IFT_Q2931 = 0xc9 + IFT_QLLC = 0x44 + IFT_RADIOMAC = 0xbc + IFT_RADSL = 0x5f + IFT_REACHDSL = 0xc0 + IFT_RFC1483 = 0x9f + IFT_RS232 = 0x21 + IFT_RSRB = 0x4f + IFT_SDLC = 0x11 + IFT_SDSL = 0x60 + IFT_SHDSL = 0xa9 + IFT_SIP = 0x1f + IFT_SIPSIG = 0xcc + IFT_SIPTG = 0xcb + IFT_SLIP = 0x1c + IFT_SMDSDXI = 0x2b + IFT_SMDSICIP = 0x34 + IFT_SONET = 0x27 + IFT_SONETOVERHEADCHANNEL = 0xb9 + IFT_SONETPATH = 0x32 + IFT_SONETVT = 0x33 + IFT_SRP = 0x97 + IFT_SS7SIGLINK = 0x9c + IFT_STACKTOSTACK = 0x6f + IFT_STARLAN = 0xb + IFT_T1 = 0x12 + IFT_TDLC = 0x74 + IFT_TELINK = 0xc8 + IFT_TERMPAD = 0x5b + IFT_TR008 = 0xb0 + IFT_TRANSPHDLC = 0x7b + IFT_TUNNEL = 0x83 + IFT_ULTRA = 0x1d + IFT_USB = 0xa0 + IFT_V11 = 0x40 + IFT_V35 = 0x2d + IFT_V36 = 0x41 + IFT_V37 = 0x78 + IFT_VDSL = 0x61 + IFT_VIRTUALIPADDRESS = 0x70 + IFT_VIRTUALTG = 0xca + IFT_VOICEDID = 0xd5 + IFT_VOICEEM = 0x64 + IFT_VOICEEMFGD = 0xd3 + IFT_VOICEENCAP = 0x67 + IFT_VOICEFGDEANA = 0xd4 + IFT_VOICEFXO = 0x65 + IFT_VOICEFXS = 0x66 + IFT_VOICEOVERATM = 0x98 + IFT_VOICEOVERCABLE = 0xc6 + IFT_VOICEOVERFRAMERELAY = 0x99 + IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb + IFT_X213 = 0x5d + IFT_X25 = 0x5 + IFT_X25DDN = 0x4 + IFT_X25HUNTGROUP = 0x7a + IFT_X25MLP = 0x79 + IFT_X25PLE = 0x28 + IFT_XETHER = 0x1a + IGNBRK = 0x1 + IGNCR = 0x80 + IGNPAR = 0x4 + IMAXBEL = 0x2000 + INLCR = 0x40 + INPCK = 0x10 + IN_CLASSA_HOST = 0xffffff + IN_CLASSA_MAX = 0x80 + IN_CLASSA_NET = 0xff000000 + IN_CLASSA_NSHIFT = 0x18 + IN_CLASSB_HOST = 0xffff + IN_CLASSB_MAX = 0x10000 + IN_CLASSB_NET = 0xffff0000 + IN_CLASSB_NSHIFT = 0x10 + IN_CLASSC_HOST = 0xff + IN_CLASSC_NET = 0xffffff00 + IN_CLASSC_NSHIFT = 0x8 + IN_CLASSD_HOST = 0xfffffff + IN_CLASSD_NET = 0xf0000000 + IN_CLASSD_NSHIFT = 0x1c + IN_LOOPBACKNET = 0x7f + IN_RFC3021_HOST = 0x1 + IN_RFC3021_NET = 0xfffffffe + IN_RFC3021_NSHIFT = 0x1f + IPPROTO_AH = 0x33 + IPPROTO_CARP = 0x70 + IPPROTO_DIVERT = 0x102 + IPPROTO_DONE = 0x101 + IPPROTO_DSTOPTS = 0x3c + IPPROTO_EGP = 0x8 + IPPROTO_ENCAP = 0x62 + IPPROTO_EON = 0x50 + IPPROTO_ESP = 0x32 + IPPROTO_ETHERIP = 0x61 + IPPROTO_FRAGMENT = 0x2c + IPPROTO_GGP = 0x3 + IPPROTO_GRE = 0x2f + IPPROTO_HOPOPTS = 0x0 + IPPROTO_ICMP = 0x1 + IPPROTO_ICMPV6 = 0x3a + IPPROTO_IDP = 0x16 + IPPROTO_IGMP = 0x2 + IPPROTO_IP = 0x0 + IPPROTO_IPCOMP = 0x6c + IPPROTO_IPIP = 0x4 + IPPROTO_IPV4 = 0x4 + IPPROTO_IPV6 = 0x29 + IPPROTO_MAX = 0x100 + IPPROTO_MAXID = 0x103 + IPPROTO_MOBILE = 0x37 + IPPROTO_MPLS = 0x89 + IPPROTO_NONE = 0x3b + IPPROTO_PFSYNC = 0xf0 + IPPROTO_PIM = 0x67 + IPPROTO_PUP = 0xc + IPPROTO_RAW = 0xff + IPPROTO_ROUTING = 0x2b + IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 + IPPROTO_TCP = 0x6 + IPPROTO_TP = 0x1d + IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 + IPV6_AUTH_LEVEL = 0x35 + IPV6_AUTOFLOWLABEL = 0x3b + IPV6_CHECKSUM = 0x1a + IPV6_DEFAULT_MULTICAST_HOPS = 0x1 + IPV6_DEFAULT_MULTICAST_LOOP = 0x1 + IPV6_DEFHLIM = 0x40 + IPV6_DONTFRAG = 0x3e + IPV6_DSTOPTS = 0x32 + IPV6_ESP_NETWORK_LEVEL = 0x37 + IPV6_ESP_TRANS_LEVEL = 0x36 + IPV6_FAITH = 0x1d + IPV6_FLOWINFO_MASK = 0xfffffff + IPV6_FLOWLABEL_MASK = 0xfffff + IPV6_FRAGTTL = 0x78 + IPV6_HLIMDEC = 0x1 + IPV6_HOPLIMIT = 0x2f + IPV6_HOPOPTS = 0x31 + IPV6_IPCOMP_LEVEL = 0x3c + IPV6_JOIN_GROUP = 0xc + IPV6_LEAVE_GROUP = 0xd + IPV6_MAXHLIM = 0xff + IPV6_MAXPACKET = 0xffff + IPV6_MINHOPCOUNT = 0x41 + IPV6_MMTU = 0x500 + IPV6_MULTICAST_HOPS = 0xa + IPV6_MULTICAST_IF = 0x9 + IPV6_MULTICAST_LOOP = 0xb + IPV6_NEXTHOP = 0x30 + IPV6_OPTIONS = 0x1 + IPV6_PATHMTU = 0x2c + IPV6_PIPEX = 0x3f + IPV6_PKTINFO = 0x2e + IPV6_PORTRANGE = 0xe + IPV6_PORTRANGE_DEFAULT = 0x0 + IPV6_PORTRANGE_HIGH = 0x1 + IPV6_PORTRANGE_LOW = 0x2 + IPV6_RECVDSTOPTS = 0x28 + IPV6_RECVDSTPORT = 0x40 + IPV6_RECVHOPLIMIT = 0x25 + IPV6_RECVHOPOPTS = 0x27 + IPV6_RECVPATHMTU = 0x2b + IPV6_RECVPKTINFO = 0x24 + IPV6_RECVRTHDR = 0x26 + IPV6_RECVTCLASS = 0x39 + IPV6_RTABLE = 0x1021 + IPV6_RTHDR = 0x33 + IPV6_RTHDRDSTOPTS = 0x23 + IPV6_RTHDR_LOOSE = 0x0 + IPV6_RTHDR_STRICT = 0x1 + IPV6_RTHDR_TYPE_0 = 0x0 + IPV6_SOCKOPT_RESERVED1 = 0x3 + IPV6_TCLASS = 0x3d + IPV6_UNICAST_HOPS = 0x4 + IPV6_USE_MIN_MTU = 0x2a + IPV6_V6ONLY = 0x1b + IPV6_VERSION = 0x60 + IPV6_VERSION_MASK = 0xf0 + IP_ADD_MEMBERSHIP = 0xc + IP_AUTH_LEVEL = 0x14 + IP_DEFAULT_MULTICAST_LOOP = 0x1 + IP_DEFAULT_MULTICAST_TTL = 0x1 + IP_DF = 0x4000 + IP_DROP_MEMBERSHIP = 0xd + IP_ESP_NETWORK_LEVEL = 0x16 + IP_ESP_TRANS_LEVEL = 0x15 + IP_HDRINCL = 0x2 + IP_IPCOMP_LEVEL = 0x1d + IP_IPDEFTTL = 0x25 + IP_IPSECFLOWINFO = 0x24 + IP_IPSEC_LOCAL_AUTH = 0x1b + IP_IPSEC_LOCAL_CRED = 0x19 + IP_IPSEC_LOCAL_ID = 0x17 + IP_IPSEC_REMOTE_AUTH = 0x1c + IP_IPSEC_REMOTE_CRED = 0x1a + IP_IPSEC_REMOTE_ID = 0x18 + IP_MAXPACKET = 0xffff + IP_MAX_MEMBERSHIPS = 0xfff + IP_MF = 0x2000 + IP_MINTTL = 0x20 + IP_MIN_MEMBERSHIPS = 0xf + IP_MSS = 0x240 + IP_MULTICAST_IF = 0x9 + IP_MULTICAST_LOOP = 0xb + IP_MULTICAST_TTL = 0xa + IP_OFFMASK = 0x1fff + IP_OPTIONS = 0x1 + IP_PIPEX = 0x22 + IP_PORTRANGE = 0x13 + IP_PORTRANGE_DEFAULT = 0x0 + IP_PORTRANGE_HIGH = 0x1 + IP_PORTRANGE_LOW = 0x2 + IP_RECVDSTADDR = 0x7 + IP_RECVDSTPORT = 0x21 + IP_RECVIF = 0x1e + IP_RECVOPTS = 0x5 + IP_RECVRETOPTS = 0x6 + IP_RECVRTABLE = 0x23 + IP_RECVTTL = 0x1f + IP_RETOPTS = 0x8 + IP_RF = 0x8000 + IP_RTABLE = 0x1021 + IP_SENDSRCADDR = 0x7 + IP_TOS = 0x3 + IP_TTL = 0x4 + ISIG = 0x80 + ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IUCLC = 0x1000 + IXANY = 0x800 + IXOFF = 0x400 + IXON = 0x200 + KERN_HOSTNAME = 0xa + KERN_OSRELEASE = 0x2 + KERN_OSTYPE = 0x1 + KERN_VERSION = 0x4 + LCNT_OVERLOAD_FLUSH = 0x6 + LOCK_EX = 0x2 + LOCK_NB = 0x4 + LOCK_SH = 0x1 + LOCK_UN = 0x8 + MADV_DONTNEED = 0x4 + MADV_FREE = 0x6 + MADV_NORMAL = 0x0 + MADV_RANDOM = 0x1 + MADV_SEQUENTIAL = 0x2 + MADV_SPACEAVAIL = 0x5 + MADV_WILLNEED = 0x3 + MAP_ANON = 0x1000 + MAP_ANONYMOUS = 0x1000 + MAP_CONCEAL = 0x8000 + MAP_COPY = 0x2 + MAP_FILE = 0x0 + MAP_FIXED = 0x10 + MAP_FLAGMASK = 0xfff7 + MAP_HASSEMAPHORE = 0x0 + MAP_INHERIT = 0x0 + MAP_INHERIT_COPY = 0x1 + MAP_INHERIT_NONE = 0x2 + MAP_INHERIT_SHARE = 0x0 + MAP_INHERIT_ZERO = 0x3 + MAP_NOEXTEND = 0x0 + MAP_NORESERVE = 0x0 + MAP_PRIVATE = 0x2 + MAP_RENAME = 0x0 + MAP_SHARED = 0x1 + MAP_STACK = 0x4000 + MAP_TRYFIXED = 0x0 + MCL_CURRENT = 0x1 + MCL_FUTURE = 0x2 + MNT_ASYNC = 0x40 + MNT_DEFEXPORTED = 0x200 + MNT_DELEXPORT = 0x20000 + MNT_DOOMED = 0x8000000 + MNT_EXPORTANON = 0x400 + MNT_EXPORTED = 0x100 + MNT_EXRDONLY = 0x80 + MNT_FORCE = 0x80000 + MNT_LAZY = 0x3 + MNT_LOCAL = 0x1000 + MNT_NOATIME = 0x8000 + MNT_NODEV = 0x10 + MNT_NOEXEC = 0x4 + MNT_NOPERM = 0x20 + MNT_NOSUID = 0x8 + MNT_NOWAIT = 0x2 + MNT_QUOTA = 0x2000 + MNT_RDONLY = 0x1 + MNT_RELOAD = 0x40000 + MNT_ROOTFS = 0x4000 + MNT_SOFTDEP = 0x4000000 + MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 + MNT_SYNCHRONOUS = 0x2 + MNT_UPDATE = 0x10000 + MNT_VISFLAGMASK = 0x400ffff + MNT_WAIT = 0x1 + MNT_WANTRDWR = 0x2000000 + MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" + MSG_BCAST = 0x100 + MSG_CMSG_CLOEXEC = 0x800 + MSG_CTRUNC = 0x20 + MSG_DONTROUTE = 0x4 + MSG_DONTWAIT = 0x80 + MSG_EOR = 0x8 + MSG_MCAST = 0x200 + MSG_NOSIGNAL = 0x400 + MSG_OOB = 0x1 + MSG_PEEK = 0x2 + MSG_TRUNC = 0x10 + MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x1000 + MS_ASYNC = 0x1 + MS_INVALIDATE = 0x4 + MS_SYNC = 0x2 + NAME_MAX = 0xff + NET_RT_DUMP = 0x1 + NET_RT_FLAGS = 0x2 + NET_RT_IFLIST = 0x3 + NET_RT_IFNAMES = 0x6 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 + NET_RT_STATS = 0x4 + NET_RT_TABLE = 0x5 + NFDBITS = 0x20 + NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 + NOTE_ATTRIB = 0x8 + NOTE_CHANGE = 0x1 + NOTE_CHILD = 0x4 + NOTE_DELETE = 0x1 + NOTE_EOF = 0x2 + NOTE_EXEC = 0x20000000 + NOTE_EXIT = 0x80000000 + NOTE_EXTEND = 0x4 + NOTE_FORK = 0x40000000 + NOTE_LINK = 0x10 + NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 + NOTE_PCTRLMASK = 0xf0000000 + NOTE_PDATAMASK = 0xfffff + NOTE_RENAME = 0x20 + NOTE_REVOKE = 0x40 + NOTE_TRACK = 0x1 + NOTE_TRACKERR = 0x2 + NOTE_TRUNCATE = 0x80 + NOTE_WRITE = 0x2 + OCRNL = 0x10 + OLCUC = 0x20 + ONLCR = 0x2 + ONLRET = 0x80 + ONOCR = 0x40 + ONOEOT = 0x8 + OPOST = 0x1 + OXTABS = 0x4 + O_ACCMODE = 0x3 + O_APPEND = 0x8 + O_ASYNC = 0x40 + O_CLOEXEC = 0x10000 + O_CREAT = 0x200 + O_DIRECTORY = 0x20000 + O_DSYNC = 0x80 + O_EXCL = 0x800 + O_EXLOCK = 0x20 + O_FSYNC = 0x80 + O_NDELAY = 0x4 + O_NOCTTY = 0x8000 + O_NOFOLLOW = 0x100 + O_NONBLOCK = 0x4 + O_RDONLY = 0x0 + O_RDWR = 0x2 + O_RSYNC = 0x80 + O_SHLOCK = 0x10 + O_SYNC = 0x80 + O_TRUNC = 0x400 + O_WRONLY = 0x1 + PARENB = 0x1000 + PARMRK = 0x8 + PARODD = 0x2000 + PENDIN = 0x20000000 + PF_FLUSH = 0x1 + PRIO_PGRP = 0x1 + PRIO_PROCESS = 0x0 + PRIO_USER = 0x2 + PROT_EXEC = 0x4 + PROT_NONE = 0x0 + PROT_READ = 0x1 + PROT_WRITE = 0x2 + RLIMIT_CORE = 0x4 + RLIMIT_CPU = 0x0 + RLIMIT_DATA = 0x2 + RLIMIT_FSIZE = 0x1 + RLIMIT_MEMLOCK = 0x6 + RLIMIT_NOFILE = 0x8 + RLIMIT_NPROC = 0x7 + RLIMIT_RSS = 0x5 + RLIMIT_STACK = 0x3 + RLIM_INFINITY = 0x7fffffffffffffff + RTAX_AUTHOR = 0x6 + RTAX_BFD = 0xb + RTAX_BRD = 0x7 + RTAX_DNS = 0xc + RTAX_DST = 0x0 + RTAX_GATEWAY = 0x1 + RTAX_GENMASK = 0x3 + RTAX_IFA = 0x5 + RTAX_IFP = 0x4 + RTAX_LABEL = 0xa + RTAX_MAX = 0xf + RTAX_NETMASK = 0x2 + RTAX_SEARCH = 0xe + RTAX_SRC = 0x8 + RTAX_SRCMASK = 0x9 + RTAX_STATIC = 0xd + RTA_AUTHOR = 0x40 + RTA_BFD = 0x800 + RTA_BRD = 0x80 + RTA_DNS = 0x1000 + RTA_DST = 0x1 + RTA_GATEWAY = 0x2 + RTA_GENMASK = 0x8 + RTA_IFA = 0x20 + RTA_IFP = 0x10 + RTA_LABEL = 0x400 + RTA_NETMASK = 0x4 + RTA_SEARCH = 0x4000 + RTA_SRC = 0x100 + RTA_SRCMASK = 0x200 + RTA_STATIC = 0x2000 + RTF_ANNOUNCE = 0x4000 + RTF_BFD = 0x1000000 + RTF_BLACKHOLE = 0x1000 + RTF_BROADCAST = 0x400000 + RTF_CACHED = 0x20000 + RTF_CLONED = 0x10000 + RTF_CLONING = 0x100 + RTF_CONNECTED = 0x800000 + RTF_DONE = 0x40 + RTF_DYNAMIC = 0x10 + RTF_FMASK = 0x110fc08 + RTF_GATEWAY = 0x2 + RTF_HOST = 0x4 + RTF_LLINFO = 0x400 + RTF_LOCAL = 0x200000 + RTF_MODIFIED = 0x20 + RTF_MPATH = 0x40000 + RTF_MPLS = 0x100000 + RTF_MULTICAST = 0x200 + RTF_PERMANENT_ARP = 0x2000 + RTF_PROTO1 = 0x8000 + RTF_PROTO2 = 0x4000 + RTF_PROTO3 = 0x2000 + RTF_REJECT = 0x8 + RTF_STATIC = 0x800 + RTF_UP = 0x1 + RTF_USETRAILERS = 0x8000 + RTM_80211INFO = 0x15 + RTM_ADD = 0x1 + RTM_BFD = 0x12 + RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 + RTM_DELADDR = 0xd + RTM_DELETE = 0x2 + RTM_DESYNC = 0x10 + RTM_GET = 0x4 + RTM_IFANNOUNCE = 0xf + RTM_IFINFO = 0xe + RTM_INVALIDATE = 0x11 + RTM_LOSING = 0x5 + RTM_MAXSIZE = 0x800 + RTM_MISS = 0x7 + RTM_NEWADDR = 0xc + RTM_PROPOSAL = 0x13 + RTM_REDIRECT = 0x6 + RTM_RESOLVE = 0xb + RTM_SOURCE = 0x16 + RTM_VERSION = 0x5 + RTV_EXPIRE = 0x4 + RTV_HOPCOUNT = 0x2 + RTV_MTU = 0x1 + RTV_RPIPE = 0x8 + RTV_RTT = 0x40 + RTV_RTTVAR = 0x80 + RTV_SPIPE = 0x10 + RTV_SSTHRESH = 0x20 + RT_TABLEID_BITS = 0x8 + RT_TABLEID_MASK = 0xff + RT_TABLEID_MAX = 0xff + RUSAGE_CHILDREN = -0x1 + RUSAGE_SELF = 0x0 + RUSAGE_THREAD = 0x1 + SCM_RIGHTS = 0x1 + SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 + SHUT_RD = 0x0 + SHUT_RDWR = 0x2 + SHUT_WR = 0x1 + SIOCADDMULTI = 0x80206931 + SIOCAIFADDR = 0x8040691a + SIOCAIFGROUP = 0x80286987 + SIOCATMARK = 0x40047307 + SIOCBRDGADD = 0x8060693c + SIOCBRDGADDL = 0x80606949 + SIOCBRDGADDS = 0x80606941 + SIOCBRDGARL = 0x808c694d + SIOCBRDGDADDR = 0x81286947 + SIOCBRDGDEL = 0x8060693d + SIOCBRDGDELS = 0x80606942 + SIOCBRDGFLUSH = 0x80606948 + SIOCBRDGFRL = 0x808c694e + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 + SIOCBRDGGIFFLGS = 0xc060693e + SIOCBRDGGMA = 0xc0146953 + SIOCBRDGGPARAM = 0xc0406958 + SIOCBRDGGPRI = 0xc0146950 + SIOCBRDGGRL = 0xc030694f + SIOCBRDGGTO = 0xc0146946 + SIOCBRDGIFS = 0xc0606942 + SIOCBRDGRTS = 0xc0206943 + SIOCBRDGSADDR = 0xc1286944 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 + SIOCBRDGSIFCOST = 0x80606955 + SIOCBRDGSIFFLGS = 0x8060693f + SIOCBRDGSIFPRIO = 0x80606954 + SIOCBRDGSIFPROT = 0x8060694a + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 + SIOCDELMULTI = 0x80206932 + SIOCDIFADDR = 0x80206919 + SIOCDIFGROUP = 0x80286989 + SIOCDIFPARENT = 0x802069b4 + SIOCDIFPHYADDR = 0x80206949 + SIOCDPWE3NEIGHBOR = 0x802069de + SIOCDVNETID = 0x802069af + SIOCGETKALIVE = 0xc01869a4 + SIOCGETLABEL = 0x8020699a + SIOCGETMPWCFG = 0xc02069ae + SIOCGETPFLOW = 0xc02069fe + SIOCGETPFSYNC = 0xc02069f8 + SIOCGETSGCNT = 0xc0207534 + SIOCGETVIFCNT = 0xc0287533 + SIOCGETVLAN = 0xc0206990 + SIOCGIFADDR = 0xc0206921 + SIOCGIFBRDADDR = 0xc0206923 + SIOCGIFCONF = 0xc0106924 + SIOCGIFDATA = 0xc020691b + SIOCGIFDESCR = 0xc0206981 + SIOCGIFDSTADDR = 0xc0206922 + SIOCGIFFLAGS = 0xc0206911 + SIOCGIFGATTR = 0xc028698b + SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc028698d + SIOCGIFGMEMB = 0xc028698a + SIOCGIFGROUP = 0xc0286988 + SIOCGIFHARDMTU = 0xc02069a5 + SIOCGIFLLPRIO = 0xc02069b6 + SIOCGIFMEDIA = 0xc0406938 + SIOCGIFMETRIC = 0xc0206917 + SIOCGIFMTU = 0xc020697e + SIOCGIFNETMASK = 0xc0206925 + SIOCGIFPAIR = 0xc02069b1 + SIOCGIFPARENT = 0xc02069b3 + SIOCGIFPRIORITY = 0xc020699c + SIOCGIFRDOMAIN = 0xc02069a0 + SIOCGIFRTLABEL = 0xc0206983 + SIOCGIFRXR = 0x802069aa + SIOCGIFSFFPAGE = 0xc1126939 + SIOCGIFXFLAGS = 0xc020699e + SIOCGLIFPHYADDR = 0xc218694b + SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 + SIOCGLIFPHYRTABLE = 0xc02069a2 + SIOCGLIFPHYTTL = 0xc02069a9 + SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db + SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 + SIOCGUMBINFO = 0xc02069be + SIOCGUMBPARAM = 0xc02069c0 + SIOCGVH = 0xc02069f6 + SIOCGVNETFLOWID = 0xc02069c4 + SIOCGVNETID = 0xc02069a7 + SIOCIFAFATTACH = 0x801169ab + SIOCIFAFDETACH = 0x801169ac + SIOCIFCREATE = 0x8020697a + SIOCIFDESTROY = 0x80206979 + SIOCIFGCLONERS = 0xc0106978 + SIOCSETKALIVE = 0x801869a3 + SIOCSETLABEL = 0x80206999 + SIOCSETMPWCFG = 0x802069ad + SIOCSETPFLOW = 0x802069fd + SIOCSETPFSYNC = 0x802069f7 + SIOCSETVLAN = 0x8020698f + SIOCSIFADDR = 0x8020690c + SIOCSIFBRDADDR = 0x80206913 + SIOCSIFDESCR = 0x80206980 + SIOCSIFDSTADDR = 0x8020690e + SIOCSIFFLAGS = 0x80206910 + SIOCSIFGATTR = 0x8028698c + SIOCSIFGENERIC = 0x80206939 + SIOCSIFLLADDR = 0x8020691f + SIOCSIFLLPRIO = 0x802069b5 + SIOCSIFMEDIA = 0xc0206937 + SIOCSIFMETRIC = 0x80206918 + SIOCSIFMTU = 0x8020697f + SIOCSIFNETMASK = 0x80206916 + SIOCSIFPAIR = 0x802069b0 + SIOCSIFPARENT = 0x802069b2 + SIOCSIFPRIORITY = 0x8020699b + SIOCSIFRDOMAIN = 0x8020699f + SIOCSIFRTLABEL = 0x80206982 + SIOCSIFXFLAGS = 0x8020699d + SIOCSLIFPHYADDR = 0x8218694a + SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 + SIOCSLIFPHYRTABLE = 0x802069a1 + SIOCSLIFPHYTTL = 0x802069a8 + SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db + SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 + SIOCSUMBPARAM = 0x802069bf + SIOCSVH = 0xc02069f5 + SIOCSVNETFLOWID = 0x802069c3 + SIOCSVNETID = 0x802069a6 + SOCK_CLOEXEC = 0x8000 + SOCK_DGRAM = 0x2 + SOCK_DNS = 0x1000 + SOCK_NONBLOCK = 0x4000 + SOCK_RAW = 0x3 + SOCK_RDM = 0x4 + SOCK_SEQPACKET = 0x5 + SOCK_STREAM = 0x1 + SOL_SOCKET = 0xffff + SOMAXCONN = 0x80 + SO_ACCEPTCONN = 0x2 + SO_BINDANY = 0x1000 + SO_BROADCAST = 0x20 + SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 + SO_DONTROUTE = 0x10 + SO_ERROR = 0x1007 + SO_KEEPALIVE = 0x8 + SO_LINGER = 0x80 + SO_NETPROC = 0x1020 + SO_OOBINLINE = 0x100 + SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 + SO_RCVBUF = 0x1002 + SO_RCVLOWAT = 0x1004 + SO_RCVTIMEO = 0x1006 + SO_REUSEADDR = 0x4 + SO_REUSEPORT = 0x200 + SO_RTABLE = 0x1021 + SO_SNDBUF = 0x1001 + SO_SNDLOWAT = 0x1003 + SO_SNDTIMEO = 0x1005 + SO_SPLICE = 0x1023 + SO_TIMESTAMP = 0x800 + SO_TYPE = 0x1008 + SO_USELOOPBACK = 0x40 + SO_ZEROIZE = 0x2000 + S_BLKSIZE = 0x200 + S_IEXEC = 0x40 + S_IFBLK = 0x6000 + S_IFCHR = 0x2000 + S_IFDIR = 0x4000 + S_IFIFO = 0x1000 + S_IFLNK = 0xa000 + S_IFMT = 0xf000 + S_IFREG = 0x8000 + S_IFSOCK = 0xc000 + S_IREAD = 0x100 + S_IRGRP = 0x20 + S_IROTH = 0x4 + S_IRUSR = 0x100 + S_IRWXG = 0x38 + S_IRWXO = 0x7 + S_IRWXU = 0x1c0 + S_ISGID = 0x400 + S_ISTXT = 0x200 + S_ISUID = 0x800 + S_ISVTX = 0x200 + S_IWGRP = 0x10 + S_IWOTH = 0x2 + S_IWRITE = 0x80 + S_IWUSR = 0x80 + S_IXGRP = 0x8 + S_IXOTH = 0x1 + S_IXUSR = 0x40 + TCIFLUSH = 0x1 + TCIOFF = 0x3 + TCIOFLUSH = 0x3 + TCION = 0x4 + TCOFLUSH = 0x2 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 + TCP_MAXSEG = 0x2 + TCP_MAXWIN = 0xffff + TCP_MAX_SACK = 0x3 + TCP_MAX_WINSHIFT = 0xe + TCP_MD5SIG = 0x4 + TCP_MSS = 0x200 + TCP_NODELAY = 0x1 + TCP_NOPUSH = 0x10 + TCP_SACKHOLE_LIMIT = 0x80 + TCP_SACK_ENABLE = 0x8 + TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 + TIOCCBRK = 0x2000747a + TIOCCDTR = 0x20007478 + TIOCCHKVERAUTH = 0x2000741e + TIOCCLRVERAUTH = 0x2000741d + TIOCCONS = 0x80047462 + TIOCDRAIN = 0x2000745e + TIOCEXCL = 0x2000740d + TIOCEXT = 0x80047460 + TIOCFLAG_CLOCAL = 0x2 + TIOCFLAG_CRTSCTS = 0x4 + TIOCFLAG_MDMBUF = 0x8 + TIOCFLAG_PPS = 0x10 + TIOCFLAG_SOFTCAR = 0x1 + TIOCFLUSH = 0x80047410 + TIOCGETA = 0x402c7413 + TIOCGETD = 0x4004741a + TIOCGFLAGS = 0x4004745d + TIOCGPGRP = 0x40047477 + TIOCGSID = 0x40047463 + TIOCGTSTAMP = 0x4010745b + TIOCGWINSZ = 0x40087468 + TIOCMBIC = 0x8004746b + TIOCMBIS = 0x8004746c + TIOCMGET = 0x4004746a + TIOCMODG = 0x4004746a + TIOCMODS = 0x8004746d + TIOCMSET = 0x8004746d + TIOCM_CAR = 0x40 + TIOCM_CD = 0x40 + TIOCM_CTS = 0x20 + TIOCM_DSR = 0x100 + TIOCM_DTR = 0x2 + TIOCM_LE = 0x1 + TIOCM_RI = 0x80 + TIOCM_RNG = 0x80 + TIOCM_RTS = 0x4 + TIOCM_SR = 0x10 + TIOCM_ST = 0x8 + TIOCNOTTY = 0x20007471 + TIOCNXCL = 0x2000740e + TIOCOUTQ = 0x40047473 + TIOCPKT = 0x80047470 + TIOCPKT_DATA = 0x0 + TIOCPKT_DOSTOP = 0x20 + TIOCPKT_FLUSHREAD = 0x1 + TIOCPKT_FLUSHWRITE = 0x2 + TIOCPKT_IOCTL = 0x40 + TIOCPKT_NOSTOP = 0x10 + TIOCPKT_START = 0x8 + TIOCPKT_STOP = 0x4 + TIOCREMOTE = 0x80047469 + TIOCSBRK = 0x2000747b + TIOCSCTTY = 0x20007461 + TIOCSDTR = 0x20007479 + TIOCSETA = 0x802c7414 + TIOCSETAF = 0x802c7416 + TIOCSETAW = 0x802c7415 + TIOCSETD = 0x8004741b + TIOCSETVERAUTH = 0x8004741c + TIOCSFLAGS = 0x8004745c + TIOCSIG = 0x8004745f + TIOCSPGRP = 0x80047476 + TIOCSTART = 0x2000746e + TIOCSTAT = 0x20007465 + TIOCSTOP = 0x2000746f + TIOCSTSTAMP = 0x8008745a + TIOCSWINSZ = 0x80087467 + TIOCUCNTL = 0x80047466 + TIOCUCNTL_CBRK = 0x7a + TIOCUCNTL_SBRK = 0x7b + TOSTOP = 0x400000 + UTIME_NOW = -0x2 + UTIME_OMIT = -0x1 + VDISCARD = 0xf + VDSUSP = 0xb + VEOF = 0x0 + VEOL = 0x1 + VEOL2 = 0x2 + VERASE = 0x3 + VINTR = 0x8 + VKILL = 0x5 + VLNEXT = 0xe + VMIN = 0x10 + VM_ANONMIN = 0x7 + VM_LOADAVG = 0x2 + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd + VM_MAXSLP = 0xa + VM_METER = 0x1 + VM_NKMEMPAGES = 0x6 + VM_PSSTRINGS = 0x3 + VM_SWAPENCRYPT = 0x5 + VM_USPACE = 0xb + VM_UVMEXP = 0x4 + VM_VNODEMIN = 0x9 + VM_VTEXTMIN = 0x8 + VQUIT = 0x9 + VREPRINT = 0x6 + VSTART = 0xc + VSTATUS = 0x12 + VSTOP = 0xd + VSUSP = 0xa + VTIME = 0x11 + VWERASE = 0x4 + WALTSIG = 0x4 + WCONTINUED = 0x8 + WCOREFLAG = 0x80 + WNOHANG = 0x1 + WUNTRACED = 0x2 + XCASE = 0x1000000 +) + +// Errors +const ( + E2BIG = syscall.Errno(0x7) + EACCES = syscall.Errno(0xd) + EADDRINUSE = syscall.Errno(0x30) + EADDRNOTAVAIL = syscall.Errno(0x31) + EAFNOSUPPORT = syscall.Errno(0x2f) + EAGAIN = syscall.Errno(0x23) + EALREADY = syscall.Errno(0x25) + EAUTH = syscall.Errno(0x50) + EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x5c) + EBADRPC = syscall.Errno(0x48) + EBUSY = syscall.Errno(0x10) + ECANCELED = syscall.Errno(0x58) + ECHILD = syscall.Errno(0xa) + ECONNABORTED = syscall.Errno(0x35) + ECONNREFUSED = syscall.Errno(0x3d) + ECONNRESET = syscall.Errno(0x36) + EDEADLK = syscall.Errno(0xb) + EDESTADDRREQ = syscall.Errno(0x27) + EDOM = syscall.Errno(0x21) + EDQUOT = syscall.Errno(0x45) + EEXIST = syscall.Errno(0x11) + EFAULT = syscall.Errno(0xe) + EFBIG = syscall.Errno(0x1b) + EFTYPE = syscall.Errno(0x4f) + EHOSTDOWN = syscall.Errno(0x40) + EHOSTUNREACH = syscall.Errno(0x41) + EIDRM = syscall.Errno(0x59) + EILSEQ = syscall.Errno(0x54) + EINPROGRESS = syscall.Errno(0x24) + EINTR = syscall.Errno(0x4) + EINVAL = syscall.Errno(0x16) + EIO = syscall.Errno(0x5) + EIPSEC = syscall.Errno(0x52) + EISCONN = syscall.Errno(0x38) + EISDIR = syscall.Errno(0x15) + ELAST = syscall.Errno(0x5f) + ELOOP = syscall.Errno(0x3e) + EMEDIUMTYPE = syscall.Errno(0x56) + EMFILE = syscall.Errno(0x18) + EMLINK = syscall.Errno(0x1f) + EMSGSIZE = syscall.Errno(0x28) + ENAMETOOLONG = syscall.Errno(0x3f) + ENEEDAUTH = syscall.Errno(0x51) + ENETDOWN = syscall.Errno(0x32) + ENETRESET = syscall.Errno(0x34) + ENETUNREACH = syscall.Errno(0x33) + ENFILE = syscall.Errno(0x17) + ENOATTR = syscall.Errno(0x53) + ENOBUFS = syscall.Errno(0x37) + ENODEV = syscall.Errno(0x13) + ENOENT = syscall.Errno(0x2) + ENOEXEC = syscall.Errno(0x8) + ENOLCK = syscall.Errno(0x4d) + ENOMEDIUM = syscall.Errno(0x55) + ENOMEM = syscall.Errno(0xc) + ENOMSG = syscall.Errno(0x5a) + ENOPROTOOPT = syscall.Errno(0x2a) + ENOSPC = syscall.Errno(0x1c) + ENOSYS = syscall.Errno(0x4e) + ENOTBLK = syscall.Errno(0xf) + ENOTCONN = syscall.Errno(0x39) + ENOTDIR = syscall.Errno(0x14) + ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5d) + ENOTSOCK = syscall.Errno(0x26) + ENOTSUP = syscall.Errno(0x5b) + ENOTTY = syscall.Errno(0x19) + ENXIO = syscall.Errno(0x6) + EOPNOTSUPP = syscall.Errno(0x2d) + EOVERFLOW = syscall.Errno(0x57) + EOWNERDEAD = syscall.Errno(0x5e) + EPERM = syscall.Errno(0x1) + EPFNOSUPPORT = syscall.Errno(0x2e) + EPIPE = syscall.Errno(0x20) + EPROCLIM = syscall.Errno(0x43) + EPROCUNAVAIL = syscall.Errno(0x4c) + EPROGMISMATCH = syscall.Errno(0x4b) + EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5f) + EPROTONOSUPPORT = syscall.Errno(0x2b) + EPROTOTYPE = syscall.Errno(0x29) + ERANGE = syscall.Errno(0x22) + EREMOTE = syscall.Errno(0x47) + EROFS = syscall.Errno(0x1e) + ERPCMISMATCH = syscall.Errno(0x49) + ESHUTDOWN = syscall.Errno(0x3a) + ESOCKTNOSUPPORT = syscall.Errno(0x2c) + ESPIPE = syscall.Errno(0x1d) + ESRCH = syscall.Errno(0x3) + ESTALE = syscall.Errno(0x46) + ETIMEDOUT = syscall.Errno(0x3c) + ETOOMANYREFS = syscall.Errno(0x3b) + ETXTBSY = syscall.Errno(0x1a) + EUSERS = syscall.Errno(0x44) + EWOULDBLOCK = syscall.Errno(0x23) + EXDEV = syscall.Errno(0x12) +) + +// Signals +const ( + SIGABRT = syscall.Signal(0x6) + SIGALRM = syscall.Signal(0xe) + SIGBUS = syscall.Signal(0xa) + SIGCHLD = syscall.Signal(0x14) + SIGCONT = syscall.Signal(0x13) + SIGEMT = syscall.Signal(0x7) + SIGFPE = syscall.Signal(0x8) + SIGHUP = syscall.Signal(0x1) + SIGILL = syscall.Signal(0x4) + SIGINFO = syscall.Signal(0x1d) + SIGINT = syscall.Signal(0x2) + SIGIO = syscall.Signal(0x17) + SIGIOT = syscall.Signal(0x6) + SIGKILL = syscall.Signal(0x9) + SIGPIPE = syscall.Signal(0xd) + SIGPROF = syscall.Signal(0x1b) + SIGQUIT = syscall.Signal(0x3) + SIGSEGV = syscall.Signal(0xb) + SIGSTOP = syscall.Signal(0x11) + SIGSYS = syscall.Signal(0xc) + SIGTERM = syscall.Signal(0xf) + SIGTHR = syscall.Signal(0x20) + SIGTRAP = syscall.Signal(0x5) + SIGTSTP = syscall.Signal(0x12) + SIGTTIN = syscall.Signal(0x15) + SIGTTOU = syscall.Signal(0x16) + SIGURG = syscall.Signal(0x10) + SIGUSR1 = syscall.Signal(0x1e) + SIGUSR2 = syscall.Signal(0x1f) + SIGVTALRM = syscall.Signal(0x1a) + SIGWINCH = syscall.Signal(0x1c) + SIGXCPU = syscall.Signal(0x18) + SIGXFSZ = syscall.Signal(0x19) +) + +// Error table +var errorList = [...]struct { + num syscall.Errno + name string + desc string +}{ + {1, "EPERM", "operation not permitted"}, + {2, "ENOENT", "no such file or directory"}, + {3, "ESRCH", "no such process"}, + {4, "EINTR", "interrupted system call"}, + {5, "EIO", "input/output error"}, + {6, "ENXIO", "device not configured"}, + {7, "E2BIG", "argument list too long"}, + {8, "ENOEXEC", "exec format error"}, + {9, "EBADF", "bad file descriptor"}, + {10, "ECHILD", "no child processes"}, + {11, "EDEADLK", "resource deadlock avoided"}, + {12, "ENOMEM", "cannot allocate memory"}, + {13, "EACCES", "permission denied"}, + {14, "EFAULT", "bad address"}, + {15, "ENOTBLK", "block device required"}, + {16, "EBUSY", "device busy"}, + {17, "EEXIST", "file exists"}, + {18, "EXDEV", "cross-device link"}, + {19, "ENODEV", "operation not supported by device"}, + {20, "ENOTDIR", "not a directory"}, + {21, "EISDIR", "is a directory"}, + {22, "EINVAL", "invalid argument"}, + {23, "ENFILE", "too many open files in system"}, + {24, "EMFILE", "too many open files"}, + {25, "ENOTTY", "inappropriate ioctl for device"}, + {26, "ETXTBSY", "text file busy"}, + {27, "EFBIG", "file too large"}, + {28, "ENOSPC", "no space left on device"}, + {29, "ESPIPE", "illegal seek"}, + {30, "EROFS", "read-only file system"}, + {31, "EMLINK", "too many links"}, + {32, "EPIPE", "broken pipe"}, + {33, "EDOM", "numerical argument out of domain"}, + {34, "ERANGE", "result too large"}, + {35, "EAGAIN", "resource temporarily unavailable"}, + {36, "EINPROGRESS", "operation now in progress"}, + {37, "EALREADY", "operation already in progress"}, + {38, "ENOTSOCK", "socket operation on non-socket"}, + {39, "EDESTADDRREQ", "destination address required"}, + {40, "EMSGSIZE", "message too long"}, + {41, "EPROTOTYPE", "protocol wrong type for socket"}, + {42, "ENOPROTOOPT", "protocol not available"}, + {43, "EPROTONOSUPPORT", "protocol not supported"}, + {44, "ESOCKTNOSUPPORT", "socket type not supported"}, + {45, "EOPNOTSUPP", "operation not supported"}, + {46, "EPFNOSUPPORT", "protocol family not supported"}, + {47, "EAFNOSUPPORT", "address family not supported by protocol family"}, + {48, "EADDRINUSE", "address already in use"}, + {49, "EADDRNOTAVAIL", "can't assign requested address"}, + {50, "ENETDOWN", "network is down"}, + {51, "ENETUNREACH", "network is unreachable"}, + {52, "ENETRESET", "network dropped connection on reset"}, + {53, "ECONNABORTED", "software caused connection abort"}, + {54, "ECONNRESET", "connection reset by peer"}, + {55, "ENOBUFS", "no buffer space available"}, + {56, "EISCONN", "socket is already connected"}, + {57, "ENOTCONN", "socket is not connected"}, + {58, "ESHUTDOWN", "can't send after socket shutdown"}, + {59, "ETOOMANYREFS", "too many references: can't splice"}, + {60, "ETIMEDOUT", "operation timed out"}, + {61, "ECONNREFUSED", "connection refused"}, + {62, "ELOOP", "too many levels of symbolic links"}, + {63, "ENAMETOOLONG", "file name too long"}, + {64, "EHOSTDOWN", "host is down"}, + {65, "EHOSTUNREACH", "no route to host"}, + {66, "ENOTEMPTY", "directory not empty"}, + {67, "EPROCLIM", "too many processes"}, + {68, "EUSERS", "too many users"}, + {69, "EDQUOT", "disk quota exceeded"}, + {70, "ESTALE", "stale NFS file handle"}, + {71, "EREMOTE", "too many levels of remote in path"}, + {72, "EBADRPC", "RPC struct is bad"}, + {73, "ERPCMISMATCH", "RPC version wrong"}, + {74, "EPROGUNAVAIL", "RPC program not available"}, + {75, "EPROGMISMATCH", "program version wrong"}, + {76, "EPROCUNAVAIL", "bad procedure for program"}, + {77, "ENOLCK", "no locks available"}, + {78, "ENOSYS", "function not implemented"}, + {79, "EFTYPE", "inappropriate file type or format"}, + {80, "EAUTH", "authentication error"}, + {81, "ENEEDAUTH", "need authenticator"}, + {82, "EIPSEC", "IPsec processing failure"}, + {83, "ENOATTR", "attribute not found"}, + {84, "EILSEQ", "illegal byte sequence"}, + {85, "ENOMEDIUM", "no medium found"}, + {86, "EMEDIUMTYPE", "wrong medium type"}, + {87, "EOVERFLOW", "value too large to be stored in data type"}, + {88, "ECANCELED", "operation canceled"}, + {89, "EIDRM", "identifier removed"}, + {90, "ENOMSG", "no message of desired type"}, + {91, "ENOTSUP", "not supported"}, + {92, "EBADMSG", "bad message"}, + {93, "ENOTRECOVERABLE", "state not recoverable"}, + {94, "EOWNERDEAD", "previous owner died"}, + {95, "ELAST", "protocol error"}, +} + +// Signal table +var signalList = [...]struct { + num syscall.Signal + name string + desc string +}{ + {1, "SIGHUP", "hangup"}, + {2, "SIGINT", "interrupt"}, + {3, "SIGQUIT", "quit"}, + {4, "SIGILL", "illegal instruction"}, + {5, "SIGTRAP", "trace/BPT trap"}, + {6, "SIGABRT", "abort trap"}, + {7, "SIGEMT", "EMT trap"}, + {8, "SIGFPE", "floating point exception"}, + {9, "SIGKILL", "killed"}, + {10, "SIGBUS", "bus error"}, + {11, "SIGSEGV", "segmentation fault"}, + {12, "SIGSYS", "bad system call"}, + {13, "SIGPIPE", "broken pipe"}, + {14, "SIGALRM", "alarm clock"}, + {15, "SIGTERM", "terminated"}, + {16, "SIGURG", "urgent I/O condition"}, + {17, "SIGSTOP", "suspended (signal)"}, + {18, "SIGTSTP", "suspended"}, + {19, "SIGCONT", "continued"}, + {20, "SIGCHLD", "child exited"}, + {21, "SIGTTIN", "stopped (tty input)"}, + {22, "SIGTTOU", "stopped (tty output)"}, + {23, "SIGIO", "I/O possible"}, + {24, "SIGXCPU", "cputime limit exceeded"}, + {25, "SIGXFSZ", "filesize limit exceeded"}, + {26, "SIGVTALRM", "virtual timer expired"}, + {27, "SIGPROF", "profiling timer expired"}, + {28, "SIGWINCH", "window size changes"}, + {29, "SIGINFO", "information request"}, + {30, "SIGUSR1", "user defined signal 1"}, + {31, "SIGUSR2", "user defined signal 2"}, + {32, "SIGTHR", "thread AST"}, +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go new file mode 100644 index 000000000..13d403031 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go @@ -0,0 +1,1904 @@ +// mkerrors.sh -m64 +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +// Code generated by cmd/cgo -godefs; DO NOT EDIT. +// cgo -godefs -- -m64 _const.go + +package unix + +import "syscall" + +const ( + AF_APPLETALK = 0x10 + AF_BLUETOOTH = 0x20 + AF_CCITT = 0xa + AF_CHAOS = 0x5 + AF_CNT = 0x15 + AF_COIP = 0x14 + AF_DATAKIT = 0x9 + AF_DECnet = 0xc + AF_DLI = 0xd + AF_E164 = 0x1a + AF_ECMA = 0x8 + AF_ENCAP = 0x1c + AF_HYLINK = 0xf + AF_IMPLINK = 0x3 + AF_INET = 0x2 + AF_INET6 = 0x18 + AF_IPX = 0x17 + AF_ISDN = 0x1a + AF_ISO = 0x7 + AF_KEY = 0x1e + AF_LAT = 0xe + AF_LINK = 0x12 + AF_LOCAL = 0x1 + AF_MAX = 0x24 + AF_MPLS = 0x21 + AF_NATM = 0x1b + AF_NS = 0x6 + AF_OSI = 0x7 + AF_PUP = 0x4 + AF_ROUTE = 0x11 + AF_SIP = 0x1d + AF_SNA = 0xb + AF_UNIX = 0x1 + AF_UNSPEC = 0x0 + ALTWERASE = 0x200 + ARPHRD_ETHER = 0x1 + ARPHRD_FRELAY = 0xf + ARPHRD_IEEE1394 = 0x18 + ARPHRD_IEEE802 = 0x6 + B0 = 0x0 + B110 = 0x6e + B115200 = 0x1c200 + B1200 = 0x4b0 + B134 = 0x86 + B14400 = 0x3840 + B150 = 0x96 + B1800 = 0x708 + B19200 = 0x4b00 + B200 = 0xc8 + B230400 = 0x38400 + B2400 = 0x960 + B28800 = 0x7080 + B300 = 0x12c + B38400 = 0x9600 + B4800 = 0x12c0 + B50 = 0x32 + B57600 = 0xe100 + B600 = 0x258 + B7200 = 0x1c20 + B75 = 0x4b + B76800 = 0x12c00 + B9600 = 0x2580 + BIOCFLUSH = 0x20004268 + BIOCGBLEN = 0x40044266 + BIOCGDIRFILT = 0x4004427c + BIOCGDLT = 0x4004426a + BIOCGDLTLIST = 0xc010427b + BIOCGETIF = 0x4020426b + BIOCGFILDROP = 0x40044278 + BIOCGHDRCMPLT = 0x40044274 + BIOCGRSIG = 0x40044273 + BIOCGRTIMEOUT = 0x4010426e + BIOCGSTATS = 0x4008426f + BIOCIMMEDIATE = 0x80044270 + BIOCLOCK = 0x20004276 + BIOCPROMISC = 0x20004269 + BIOCSBLEN = 0xc0044266 + BIOCSDIRFILT = 0x8004427d + BIOCSDLT = 0x8004427a + BIOCSETF = 0x80104267 + BIOCSETIF = 0x8020426c + BIOCSETWF = 0x80104277 + BIOCSFILDROP = 0x80044279 + BIOCSHDRCMPLT = 0x80044275 + BIOCSRSIG = 0x80044272 + BIOCSRTIMEOUT = 0x8010426d + BIOCVERSION = 0x40044271 + BPF_A = 0x10 + BPF_ABS = 0x20 + BPF_ADD = 0x0 + BPF_ALIGNMENT = 0x4 + BPF_ALU = 0x4 + BPF_AND = 0x50 + BPF_B = 0x10 + BPF_DIRECTION_IN = 0x1 + BPF_DIRECTION_OUT = 0x2 + BPF_DIV = 0x30 + BPF_FILDROP_CAPTURE = 0x1 + BPF_FILDROP_DROP = 0x2 + BPF_FILDROP_PASS = 0x0 + BPF_F_DIR_IN = 0x10 + BPF_F_DIR_MASK = 0x30 + BPF_F_DIR_OUT = 0x20 + BPF_F_DIR_SHIFT = 0x4 + BPF_F_FLOWID = 0x8 + BPF_F_PRI_MASK = 0x7 + BPF_H = 0x8 + BPF_IMM = 0x0 + BPF_IND = 0x40 + BPF_JA = 0x0 + BPF_JEQ = 0x10 + BPF_JGE = 0x30 + BPF_JGT = 0x20 + BPF_JMP = 0x5 + BPF_JSET = 0x40 + BPF_K = 0x0 + BPF_LD = 0x0 + BPF_LDX = 0x1 + BPF_LEN = 0x80 + BPF_LSH = 0x60 + BPF_MAJOR_VERSION = 0x1 + BPF_MAXBUFSIZE = 0x200000 + BPF_MAXINSNS = 0x200 + BPF_MEM = 0x60 + BPF_MEMWORDS = 0x10 + BPF_MINBUFSIZE = 0x20 + BPF_MINOR_VERSION = 0x1 + BPF_MISC = 0x7 + BPF_MSH = 0xa0 + BPF_MUL = 0x20 + BPF_NEG = 0x80 + BPF_OR = 0x40 + BPF_RELEASE = 0x30bb6 + BPF_RET = 0x6 + BPF_RND = 0xc0 + BPF_RSH = 0x70 + BPF_ST = 0x2 + BPF_STX = 0x3 + BPF_SUB = 0x10 + BPF_TAX = 0x0 + BPF_TXA = 0x80 + BPF_W = 0x0 + BPF_X = 0x8 + BRKINT = 0x2 + CFLUSH = 0xf + CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x6 + CLOCK_MONOTONIC = 0x3 + CLOCK_PROCESS_CPUTIME_ID = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_THREAD_CPUTIME_ID = 0x4 + CLOCK_UPTIME = 0x5 + CPUSTATES = 0x6 + CP_IDLE = 0x5 + CP_INTR = 0x4 + CP_NICE = 0x1 + CP_SPIN = 0x3 + CP_SYS = 0x2 + CP_USER = 0x0 + CREAD = 0x800 + CRTSCTS = 0x10000 + CS5 = 0x0 + CS6 = 0x100 + CS7 = 0x200 + CS8 = 0x300 + CSIZE = 0x300 + CSTART = 0x11 + CSTATUS = 0xff + CSTOP = 0x13 + CSTOPB = 0x400 + CSUSP = 0x1a + CTL_HW = 0x6 + CTL_KERN = 0x1 + CTL_MAXNAME = 0xc + CTL_NET = 0x4 + DIOCADDQUEUE = 0xc110445d + DIOCADDRULE = 0xcd604404 + DIOCADDSTATE = 0xc1084425 + DIOCCHANGERULE = 0xcd60441a + DIOCCLRIFFLAG = 0xc028445a + DIOCCLRSRCNODES = 0x20004455 + DIOCCLRSTATES = 0xc0e04412 + DIOCCLRSTATUS = 0xc0284416 + DIOCGETLIMIT = 0xc0084427 + DIOCGETQSTATS = 0xc1204460 + DIOCGETQUEUE = 0xc110445f + DIOCGETQUEUES = 0xc110445e + DIOCGETRULE = 0xcd604407 + DIOCGETRULES = 0xcd604406 + DIOCGETRULESET = 0xc444443b + DIOCGETRULESETS = 0xc444443a + DIOCGETSRCNODES = 0xc0104454 + DIOCGETSTATE = 0xc1084413 + DIOCGETSTATES = 0xc0104419 + DIOCGETSTATUS = 0xc1e84415 + DIOCGETSYNFLWATS = 0xc0084463 + DIOCGETTIMEOUT = 0xc008441e + DIOCIGETIFACES = 0xc0284457 + DIOCKILLSRCNODES = 0xc080445b + DIOCKILLSTATES = 0xc0e04429 + DIOCNATLOOK = 0xc0504417 + DIOCOSFPADD = 0xc088444f + DIOCOSFPFLUSH = 0x2000444e + DIOCOSFPGET = 0xc0884450 + DIOCRADDADDRS = 0xc4504443 + DIOCRADDTABLES = 0xc450443d + DIOCRCLRADDRS = 0xc4504442 + DIOCRCLRASTATS = 0xc4504448 + DIOCRCLRTABLES = 0xc450443c + DIOCRCLRTSTATS = 0xc4504441 + DIOCRDELADDRS = 0xc4504444 + DIOCRDELTABLES = 0xc450443e + DIOCRGETADDRS = 0xc4504446 + DIOCRGETASTATS = 0xc4504447 + DIOCRGETTABLES = 0xc450443f + DIOCRGETTSTATS = 0xc4504440 + DIOCRINADEFINE = 0xc450444d + DIOCRSETADDRS = 0xc4504445 + DIOCRSETTFLAGS = 0xc450444a + DIOCRTSTADDRS = 0xc4504449 + DIOCSETDEBUG = 0xc0044418 + DIOCSETHOSTID = 0xc0044456 + DIOCSETIFFLAG = 0xc0284459 + DIOCSETLIMIT = 0xc0084428 + DIOCSETREASS = 0xc004445c + DIOCSETSTATUSIF = 0xc0284414 + DIOCSETSYNCOOKIES = 0xc0014462 + DIOCSETSYNFLWATS = 0xc0084461 + DIOCSETTIMEOUT = 0xc008441d + DIOCSTART = 0x20004401 + DIOCSTOP = 0x20004402 + DIOCXBEGIN = 0xc0104451 + DIOCXCOMMIT = 0xc0104452 + DIOCXROLLBACK = 0xc0104453 + DLT_ARCNET = 0x7 + DLT_ATM_RFC1483 = 0xb + DLT_AX25 = 0x3 + DLT_CHAOS = 0x5 + DLT_C_HDLC = 0x68 + DLT_EN10MB = 0x1 + DLT_EN3MB = 0x2 + DLT_ENC = 0xd + DLT_FDDI = 0xa + DLT_IEEE802 = 0x6 + DLT_IEEE802_11 = 0x69 + DLT_IEEE802_11_RADIO = 0x7f + DLT_LOOP = 0xc + DLT_MPLS = 0xdb + DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b + DLT_PFLOG = 0x75 + DLT_PFSYNC = 0x12 + DLT_PPP = 0x9 + DLT_PPP_BSDOS = 0x10 + DLT_PPP_ETHER = 0x33 + DLT_PPP_SERIAL = 0x32 + DLT_PRONET = 0x4 + DLT_RAW = 0xe + DLT_SLIP = 0x8 + DLT_SLIP_BSDOS = 0xf + DLT_USBPCAP = 0xf9 + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c + DT_BLK = 0x6 + DT_CHR = 0x2 + DT_DIR = 0x4 + DT_FIFO = 0x1 + DT_LNK = 0xa + DT_REG = 0x8 + DT_SOCK = 0xc + DT_UNKNOWN = 0x0 + ECHO = 0x8 + ECHOCTL = 0x40 + ECHOE = 0x2 + ECHOK = 0x4 + ECHOKE = 0x1 + ECHONL = 0x10 + ECHOPRT = 0x20 + EMT_TAGOVF = 0x1 + EMUL_ENABLED = 0x1 + EMUL_NATIVE = 0x2 + ENDRUNDISC = 0x9 + ETH64_8021_RSVD_MASK = 0xfffffffffff0 + ETH64_8021_RSVD_PREFIX = 0x180c2000000 + ETHERMIN = 0x2e + ETHERMTU = 0x5dc + ETHERTYPE_8023 = 0x4 + ETHERTYPE_AARP = 0x80f3 + ETHERTYPE_ACCTON = 0x8390 + ETHERTYPE_AEONIC = 0x8036 + ETHERTYPE_ALPHA = 0x814a + ETHERTYPE_AMBER = 0x6008 + ETHERTYPE_AMOEBA = 0x8145 + ETHERTYPE_AOE = 0x88a2 + ETHERTYPE_APOLLO = 0x80f7 + ETHERTYPE_APOLLODOMAIN = 0x8019 + ETHERTYPE_APPLETALK = 0x809b + ETHERTYPE_APPLITEK = 0x80c7 + ETHERTYPE_ARGONAUT = 0x803a + ETHERTYPE_ARP = 0x806 + ETHERTYPE_AT = 0x809b + ETHERTYPE_ATALK = 0x809b + ETHERTYPE_ATOMIC = 0x86df + ETHERTYPE_ATT = 0x8069 + ETHERTYPE_ATTSTANFORD = 0x8008 + ETHERTYPE_AUTOPHON = 0x806a + ETHERTYPE_AXIS = 0x8856 + ETHERTYPE_BCLOOP = 0x9003 + ETHERTYPE_BOFL = 0x8102 + ETHERTYPE_CABLETRON = 0x7034 + ETHERTYPE_CHAOS = 0x804 + ETHERTYPE_COMDESIGN = 0x806c + ETHERTYPE_COMPUGRAPHIC = 0x806d + ETHERTYPE_COUNTERPOINT = 0x8062 + ETHERTYPE_CRONUS = 0x8004 + ETHERTYPE_CRONUSVLN = 0x8003 + ETHERTYPE_DCA = 0x1234 + ETHERTYPE_DDE = 0x807b + ETHERTYPE_DEBNI = 0xaaaa + ETHERTYPE_DECAM = 0x8048 + ETHERTYPE_DECCUST = 0x6006 + ETHERTYPE_DECDIAG = 0x6005 + ETHERTYPE_DECDNS = 0x803c + ETHERTYPE_DECDTS = 0x803e + ETHERTYPE_DECEXPER = 0x6000 + ETHERTYPE_DECLAST = 0x8041 + ETHERTYPE_DECLTM = 0x803f + ETHERTYPE_DECMUMPS = 0x6009 + ETHERTYPE_DECNETBIOS = 0x8040 + ETHERTYPE_DELTACON = 0x86de + ETHERTYPE_DIDDLE = 0x4321 + ETHERTYPE_DLOG1 = 0x660 + ETHERTYPE_DLOG2 = 0x661 + ETHERTYPE_DN = 0x6003 + ETHERTYPE_DOGFIGHT = 0x1989 + ETHERTYPE_DSMD = 0x8039 + ETHERTYPE_EAPOL = 0x888e + ETHERTYPE_ECMA = 0x803 + ETHERTYPE_ENCRYPT = 0x803d + ETHERTYPE_ES = 0x805d + ETHERTYPE_EXCELAN = 0x8010 + ETHERTYPE_EXPERDATA = 0x8049 + ETHERTYPE_FLIP = 0x8146 + ETHERTYPE_FLOWCONTROL = 0x8808 + ETHERTYPE_FRARP = 0x808 + ETHERTYPE_GENDYN = 0x8068 + ETHERTYPE_HAYES = 0x8130 + ETHERTYPE_HIPPI_FP = 0x8180 + ETHERTYPE_HITACHI = 0x8820 + ETHERTYPE_HP = 0x8005 + ETHERTYPE_IEEEPUP = 0xa00 + ETHERTYPE_IEEEPUPAT = 0xa01 + ETHERTYPE_IMLBL = 0x4c42 + ETHERTYPE_IMLBLDIAG = 0x424c + ETHERTYPE_IP = 0x800 + ETHERTYPE_IPAS = 0x876c + ETHERTYPE_IPV6 = 0x86dd + ETHERTYPE_IPX = 0x8137 + ETHERTYPE_IPXNEW = 0x8037 + ETHERTYPE_KALPANA = 0x8582 + ETHERTYPE_LANBRIDGE = 0x8038 + ETHERTYPE_LANPROBE = 0x8888 + ETHERTYPE_LAT = 0x6004 + ETHERTYPE_LBACK = 0x9000 + ETHERTYPE_LITTLE = 0x8060 + ETHERTYPE_LLDP = 0x88cc + ETHERTYPE_LOGICRAFT = 0x8148 + ETHERTYPE_LOOPBACK = 0x9000 + ETHERTYPE_MACSEC = 0x88e5 + ETHERTYPE_MATRA = 0x807a + ETHERTYPE_MAX = 0xffff + ETHERTYPE_MERIT = 0x807c + ETHERTYPE_MICP = 0x873a + ETHERTYPE_MOPDL = 0x6001 + ETHERTYPE_MOPRC = 0x6002 + ETHERTYPE_MOTOROLA = 0x818d + ETHERTYPE_MPLS = 0x8847 + ETHERTYPE_MPLS_MCAST = 0x8848 + ETHERTYPE_MUMPS = 0x813f + ETHERTYPE_NBPCC = 0x3c04 + ETHERTYPE_NBPCLAIM = 0x3c09 + ETHERTYPE_NBPCLREQ = 0x3c05 + ETHERTYPE_NBPCLRSP = 0x3c06 + ETHERTYPE_NBPCREQ = 0x3c02 + ETHERTYPE_NBPCRSP = 0x3c03 + ETHERTYPE_NBPDG = 0x3c07 + ETHERTYPE_NBPDGB = 0x3c08 + ETHERTYPE_NBPDLTE = 0x3c0a + ETHERTYPE_NBPRAR = 0x3c0c + ETHERTYPE_NBPRAS = 0x3c0b + ETHERTYPE_NBPRST = 0x3c0d + ETHERTYPE_NBPSCD = 0x3c01 + ETHERTYPE_NBPVCD = 0x3c00 + ETHERTYPE_NBS = 0x802 + ETHERTYPE_NCD = 0x8149 + ETHERTYPE_NESTAR = 0x8006 + ETHERTYPE_NETBEUI = 0x8191 + ETHERTYPE_NHRP = 0x2001 + ETHERTYPE_NOVELL = 0x8138 + ETHERTYPE_NS = 0x600 + ETHERTYPE_NSAT = 0x601 + ETHERTYPE_NSCOMPAT = 0x807 + ETHERTYPE_NSH = 0x984f + ETHERTYPE_NTRAILER = 0x10 + ETHERTYPE_OS9 = 0x7007 + ETHERTYPE_OS9NET = 0x7009 + ETHERTYPE_PACER = 0x80c6 + ETHERTYPE_PBB = 0x88e7 + ETHERTYPE_PCS = 0x4242 + ETHERTYPE_PLANNING = 0x8044 + ETHERTYPE_PPP = 0x880b + ETHERTYPE_PPPOE = 0x8864 + ETHERTYPE_PPPOEDISC = 0x8863 + ETHERTYPE_PRIMENTS = 0x7031 + ETHERTYPE_PUP = 0x200 + ETHERTYPE_PUPAT = 0x200 + ETHERTYPE_QINQ = 0x88a8 + ETHERTYPE_RACAL = 0x7030 + ETHERTYPE_RATIONAL = 0x8150 + ETHERTYPE_RAWFR = 0x6559 + ETHERTYPE_RCL = 0x1995 + ETHERTYPE_RDP = 0x8739 + ETHERTYPE_RETIX = 0x80f2 + ETHERTYPE_REVARP = 0x8035 + ETHERTYPE_SCA = 0x6007 + ETHERTYPE_SECTRA = 0x86db + ETHERTYPE_SECUREDATA = 0x876d + ETHERTYPE_SGITW = 0x817e + ETHERTYPE_SG_BOUNCE = 0x8016 + ETHERTYPE_SG_DIAG = 0x8013 + ETHERTYPE_SG_NETGAMES = 0x8014 + ETHERTYPE_SG_RESV = 0x8015 + ETHERTYPE_SIMNET = 0x5208 + ETHERTYPE_SLOW = 0x8809 + ETHERTYPE_SNA = 0x80d5 + ETHERTYPE_SNMP = 0x814c + ETHERTYPE_SONIX = 0xfaf5 + ETHERTYPE_SPIDER = 0x809f + ETHERTYPE_SPRITE = 0x500 + ETHERTYPE_STP = 0x8181 + ETHERTYPE_TALARIS = 0x812b + ETHERTYPE_TALARISMC = 0x852b + ETHERTYPE_TCPCOMP = 0x876b + ETHERTYPE_TCPSM = 0x9002 + ETHERTYPE_TEC = 0x814f + ETHERTYPE_TIGAN = 0x802f + ETHERTYPE_TRAIL = 0x1000 + ETHERTYPE_TRANSETHER = 0x6558 + ETHERTYPE_TYMSHARE = 0x802e + ETHERTYPE_UBBST = 0x7005 + ETHERTYPE_UBDEBUG = 0x900 + ETHERTYPE_UBDIAGLOOP = 0x7002 + ETHERTYPE_UBDL = 0x7000 + ETHERTYPE_UBNIU = 0x7001 + ETHERTYPE_UBNMC = 0x7003 + ETHERTYPE_VALID = 0x1600 + ETHERTYPE_VARIAN = 0x80dd + ETHERTYPE_VAXELN = 0x803b + ETHERTYPE_VEECO = 0x8067 + ETHERTYPE_VEXP = 0x805b + ETHERTYPE_VGLAB = 0x8131 + ETHERTYPE_VINES = 0xbad + ETHERTYPE_VINESECHO = 0xbaf + ETHERTYPE_VINESLOOP = 0xbae + ETHERTYPE_VITAL = 0xff00 + ETHERTYPE_VLAN = 0x8100 + ETHERTYPE_VLTLMAN = 0x8080 + ETHERTYPE_VPROD = 0x805c + ETHERTYPE_VURESERVED = 0x8147 + ETHERTYPE_WATERLOO = 0x8130 + ETHERTYPE_WELLFLEET = 0x8103 + ETHERTYPE_X25 = 0x805 + ETHERTYPE_X75 = 0x801 + ETHERTYPE_XNSSM = 0x9001 + ETHERTYPE_XTP = 0x817d + ETHER_ADDR_LEN = 0x6 + ETHER_ALIGN = 0x2 + ETHER_CRC_LEN = 0x4 + ETHER_CRC_POLY_BE = 0x4c11db6 + ETHER_CRC_POLY_LE = 0xedb88320 + ETHER_HDR_LEN = 0xe + ETHER_MAX_DIX_LEN = 0x600 + ETHER_MAX_HARDMTU_LEN = 0xff9b + ETHER_MAX_LEN = 0x5ee + ETHER_MIN_LEN = 0x40 + ETHER_TYPE_LEN = 0x2 + ETHER_VLAN_ENCAP_LEN = 0x4 + EVFILT_AIO = -0x3 + EVFILT_DEVICE = -0x8 + EVFILT_EXCEPT = -0x9 + EVFILT_PROC = -0x5 + EVFILT_READ = -0x1 + EVFILT_SIGNAL = -0x6 + EVFILT_SYSCOUNT = 0x9 + EVFILT_TIMER = -0x7 + EVFILT_VNODE = -0x4 + EVFILT_WRITE = -0x2 + EVL_ENCAPLEN = 0x4 + EVL_PRIO_BITS = 0xd + EVL_PRIO_MAX = 0x7 + EVL_VLID_MASK = 0xfff + EVL_VLID_MAX = 0xffe + EVL_VLID_MIN = 0x1 + EVL_VLID_NULL = 0x0 + EV_ADD = 0x1 + EV_CLEAR = 0x20 + EV_DELETE = 0x2 + EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 + EV_ENABLE = 0x4 + EV_EOF = 0x8000 + EV_ERROR = 0x4000 + EV_FLAG1 = 0x2000 + EV_ONESHOT = 0x10 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf800 + EXTA = 0x4b00 + EXTB = 0x9600 + EXTPROC = 0x800 + FD_CLOEXEC = 0x1 + FD_SETSIZE = 0x400 + FLUSHO = 0x800000 + F_DUPFD = 0x0 + F_DUPFD_CLOEXEC = 0xa + F_GETFD = 0x1 + F_GETFL = 0x3 + F_GETLK = 0x7 + F_GETOWN = 0x5 + F_ISATTY = 0xb + F_OK = 0x0 + F_RDLCK = 0x1 + F_SETFD = 0x2 + F_SETFL = 0x4 + F_SETLK = 0x8 + F_SETLKW = 0x9 + F_SETOWN = 0x6 + F_UNLCK = 0x2 + F_WRLCK = 0x3 + HUPCL = 0x4000 + HW_MACHINE = 0x1 + ICANON = 0x100 + ICMP6_FILTER = 0x12 + ICRNL = 0x100 + IEXTEN = 0x400 + IFAN_ARRIVAL = 0x0 + IFAN_DEPARTURE = 0x1 + IFF_ALLMULTI = 0x200 + IFF_BROADCAST = 0x2 + IFF_CANTCHANGE = 0x8e52 + IFF_DEBUG = 0x4 + IFF_LINK0 = 0x1000 + IFF_LINK1 = 0x2000 + IFF_LINK2 = 0x4000 + IFF_LOOPBACK = 0x8 + IFF_MULTICAST = 0x8000 + IFF_NOARP = 0x80 + IFF_OACTIVE = 0x400 + IFF_POINTOPOINT = 0x10 + IFF_PROMISC = 0x100 + IFF_RUNNING = 0x40 + IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x20 + IFF_UP = 0x1 + IFNAMSIZ = 0x10 + IFT_1822 = 0x2 + IFT_A12MPPSWITCH = 0x82 + IFT_AAL2 = 0xbb + IFT_AAL5 = 0x31 + IFT_ADSL = 0x5e + IFT_AFLANE8023 = 0x3b + IFT_AFLANE8025 = 0x3c + IFT_ARAP = 0x58 + IFT_ARCNET = 0x23 + IFT_ARCNETPLUS = 0x24 + IFT_ASYNC = 0x54 + IFT_ATM = 0x25 + IFT_ATMDXI = 0x69 + IFT_ATMFUNI = 0x6a + IFT_ATMIMA = 0x6b + IFT_ATMLOGICAL = 0x50 + IFT_ATMRADIO = 0xbd + IFT_ATMSUBINTERFACE = 0x86 + IFT_ATMVCIENDPT = 0xc2 + IFT_ATMVIRTUAL = 0x95 + IFT_BGPPOLICYACCOUNTING = 0xa2 + IFT_BLUETOOTH = 0xf8 + IFT_BRIDGE = 0xd1 + IFT_BSC = 0x53 + IFT_CARP = 0xf7 + IFT_CCTEMUL = 0x3d + IFT_CEPT = 0x13 + IFT_CES = 0x85 + IFT_CHANNEL = 0x46 + IFT_CNR = 0x55 + IFT_COFFEE = 0x84 + IFT_COMPOSITELINK = 0x9b + IFT_DCN = 0x8d + IFT_DIGITALPOWERLINE = 0x8a + IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba + IFT_DLSW = 0x4a + IFT_DOCSCABLEDOWNSTREAM = 0x80 + IFT_DOCSCABLEMACLAYER = 0x7f + IFT_DOCSCABLEUPSTREAM = 0x81 + IFT_DOCSCABLEUPSTREAMCHANNEL = 0xcd + IFT_DS0 = 0x51 + IFT_DS0BUNDLE = 0x52 + IFT_DS1FDL = 0xaa + IFT_DS3 = 0x1e + IFT_DTM = 0x8c + IFT_DUMMY = 0xf1 + IFT_DVBASILN = 0xac + IFT_DVBASIOUT = 0xad + IFT_DVBRCCDOWNSTREAM = 0x93 + IFT_DVBRCCMACLAYER = 0x92 + IFT_DVBRCCUPSTREAM = 0x94 + IFT_ECONET = 0xce + IFT_ENC = 0xf4 + IFT_EON = 0x19 + IFT_EPLRS = 0x57 + IFT_ESCON = 0x49 + IFT_ETHER = 0x6 + IFT_FAITH = 0xf3 + IFT_FAST = 0x7d + IFT_FASTETHER = 0x3e + IFT_FASTETHERFX = 0x45 + IFT_FDDI = 0xf + IFT_FIBRECHANNEL = 0x38 + IFT_FRAMERELAYINTERCONNECT = 0x3a + IFT_FRAMERELAYMPI = 0x5c + IFT_FRDLCIENDPT = 0xc1 + IFT_FRELAY = 0x20 + IFT_FRELAYDCE = 0x2c + IFT_FRF16MFRBUNDLE = 0xa3 + IFT_FRFORWARD = 0x9e + IFT_G703AT2MB = 0x43 + IFT_G703AT64K = 0x42 + IFT_GIF = 0xf0 + IFT_GIGABITETHERNET = 0x75 + IFT_GR303IDT = 0xb2 + IFT_GR303RDT = 0xb1 + IFT_H323GATEKEEPER = 0xa4 + IFT_H323PROXY = 0xa5 + IFT_HDH1822 = 0x3 + IFT_HDLC = 0x76 + IFT_HDSL2 = 0xa8 + IFT_HIPERLAN2 = 0xb7 + IFT_HIPPI = 0x2f + IFT_HIPPIINTERFACE = 0x39 + IFT_HOSTPAD = 0x5a + IFT_HSSI = 0x2e + IFT_HY = 0xe + IFT_IBM370PARCHAN = 0x48 + IFT_IDSL = 0x9a + IFT_IEEE1394 = 0x90 + IFT_IEEE80211 = 0x47 + IFT_IEEE80212 = 0x37 + IFT_IEEE8023ADLAG = 0xa1 + IFT_IFGSN = 0x91 + IFT_IMT = 0xbe + IFT_INFINIBAND = 0xc7 + IFT_INTERLEAVE = 0x7c + IFT_IP = 0x7e + IFT_IPFORWARD = 0x8e + IFT_IPOVERATM = 0x72 + IFT_IPOVERCDLC = 0x6d + IFT_IPOVERCLAW = 0x6e + IFT_IPSWITCH = 0x4e + IFT_ISDN = 0x3f + IFT_ISDNBASIC = 0x14 + IFT_ISDNPRIMARY = 0x15 + IFT_ISDNS = 0x4b + IFT_ISDNU = 0x4c + IFT_ISO88022LLC = 0x29 + IFT_ISO88023 = 0x7 + IFT_ISO88024 = 0x8 + IFT_ISO88025 = 0x9 + IFT_ISO88025CRFPINT = 0x62 + IFT_ISO88025DTR = 0x56 + IFT_ISO88025FIBER = 0x73 + IFT_ISO88026 = 0xa + IFT_ISUP = 0xb3 + IFT_L2VLAN = 0x87 + IFT_L3IPVLAN = 0x88 + IFT_L3IPXVLAN = 0x89 + IFT_LAPB = 0x10 + IFT_LAPD = 0x4d + IFT_LAPF = 0x77 + IFT_LINEGROUP = 0xd2 + IFT_LOCALTALK = 0x2a + IFT_LOOP = 0x18 + IFT_MBIM = 0xfa + IFT_MEDIAMAILOVERIP = 0x8b + IFT_MFSIGLINK = 0xa7 + IFT_MIOX25 = 0x26 + IFT_MODEM = 0x30 + IFT_MPC = 0x71 + IFT_MPLS = 0xa6 + IFT_MPLSTUNNEL = 0x96 + IFT_MSDSL = 0x8f + IFT_MVL = 0xbf + IFT_MYRINET = 0x63 + IFT_NFAS = 0xaf + IFT_NSIP = 0x1b + IFT_OPTICALCHANNEL = 0xc3 + IFT_OPTICALTRANSPORT = 0xc4 + IFT_OTHER = 0x1 + IFT_P10 = 0xc + IFT_P80 = 0xd + IFT_PARA = 0x22 + IFT_PFLOG = 0xf5 + IFT_PFLOW = 0xf9 + IFT_PFSYNC = 0xf6 + IFT_PLC = 0xae + IFT_PON155 = 0xcf + IFT_PON622 = 0xd0 + IFT_POS = 0xab + IFT_PPP = 0x17 + IFT_PPPMULTILINKBUNDLE = 0x6c + IFT_PROPATM = 0xc5 + IFT_PROPBWAP2MP = 0xb8 + IFT_PROPCNLS = 0x59 + IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 + IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 + IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 + IFT_PROPMUX = 0x36 + IFT_PROPVIRTUAL = 0x35 + IFT_PROPWIRELESSP2P = 0x9d + IFT_PTPSERIAL = 0x16 + IFT_PVC = 0xf2 + IFT_Q2931 = 0xc9 + IFT_QLLC = 0x44 + IFT_RADIOMAC = 0xbc + IFT_RADSL = 0x5f + IFT_REACHDSL = 0xc0 + IFT_RFC1483 = 0x9f + IFT_RS232 = 0x21 + IFT_RSRB = 0x4f + IFT_SDLC = 0x11 + IFT_SDSL = 0x60 + IFT_SHDSL = 0xa9 + IFT_SIP = 0x1f + IFT_SIPSIG = 0xcc + IFT_SIPTG = 0xcb + IFT_SLIP = 0x1c + IFT_SMDSDXI = 0x2b + IFT_SMDSICIP = 0x34 + IFT_SONET = 0x27 + IFT_SONETOVERHEADCHANNEL = 0xb9 + IFT_SONETPATH = 0x32 + IFT_SONETVT = 0x33 + IFT_SRP = 0x97 + IFT_SS7SIGLINK = 0x9c + IFT_STACKTOSTACK = 0x6f + IFT_STARLAN = 0xb + IFT_T1 = 0x12 + IFT_TDLC = 0x74 + IFT_TELINK = 0xc8 + IFT_TERMPAD = 0x5b + IFT_TR008 = 0xb0 + IFT_TRANSPHDLC = 0x7b + IFT_TUNNEL = 0x83 + IFT_ULTRA = 0x1d + IFT_USB = 0xa0 + IFT_V11 = 0x40 + IFT_V35 = 0x2d + IFT_V36 = 0x41 + IFT_V37 = 0x78 + IFT_VDSL = 0x61 + IFT_VIRTUALIPADDRESS = 0x70 + IFT_VIRTUALTG = 0xca + IFT_VOICEDID = 0xd5 + IFT_VOICEEM = 0x64 + IFT_VOICEEMFGD = 0xd3 + IFT_VOICEENCAP = 0x67 + IFT_VOICEFGDEANA = 0xd4 + IFT_VOICEFXO = 0x65 + IFT_VOICEFXS = 0x66 + IFT_VOICEOVERATM = 0x98 + IFT_VOICEOVERCABLE = 0xc6 + IFT_VOICEOVERFRAMERELAY = 0x99 + IFT_VOICEOVERIP = 0x68 + IFT_WIREGUARD = 0xfb + IFT_X213 = 0x5d + IFT_X25 = 0x5 + IFT_X25DDN = 0x4 + IFT_X25HUNTGROUP = 0x7a + IFT_X25MLP = 0x79 + IFT_X25PLE = 0x28 + IFT_XETHER = 0x1a + IGNBRK = 0x1 + IGNCR = 0x80 + IGNPAR = 0x4 + IMAXBEL = 0x2000 + INLCR = 0x40 + INPCK = 0x10 + IN_CLASSA_HOST = 0xffffff + IN_CLASSA_MAX = 0x80 + IN_CLASSA_NET = 0xff000000 + IN_CLASSA_NSHIFT = 0x18 + IN_CLASSB_HOST = 0xffff + IN_CLASSB_MAX = 0x10000 + IN_CLASSB_NET = 0xffff0000 + IN_CLASSB_NSHIFT = 0x10 + IN_CLASSC_HOST = 0xff + IN_CLASSC_NET = 0xffffff00 + IN_CLASSC_NSHIFT = 0x8 + IN_CLASSD_HOST = 0xfffffff + IN_CLASSD_NET = 0xf0000000 + IN_CLASSD_NSHIFT = 0x1c + IN_LOOPBACKNET = 0x7f + IN_RFC3021_HOST = 0x1 + IN_RFC3021_NET = 0xfffffffe + IN_RFC3021_NSHIFT = 0x1f + IPPROTO_AH = 0x33 + IPPROTO_CARP = 0x70 + IPPROTO_DIVERT = 0x102 + IPPROTO_DONE = 0x101 + IPPROTO_DSTOPTS = 0x3c + IPPROTO_EGP = 0x8 + IPPROTO_ENCAP = 0x62 + IPPROTO_EON = 0x50 + IPPROTO_ESP = 0x32 + IPPROTO_ETHERIP = 0x61 + IPPROTO_FRAGMENT = 0x2c + IPPROTO_GGP = 0x3 + IPPROTO_GRE = 0x2f + IPPROTO_HOPOPTS = 0x0 + IPPROTO_ICMP = 0x1 + IPPROTO_ICMPV6 = 0x3a + IPPROTO_IDP = 0x16 + IPPROTO_IGMP = 0x2 + IPPROTO_IP = 0x0 + IPPROTO_IPCOMP = 0x6c + IPPROTO_IPIP = 0x4 + IPPROTO_IPV4 = 0x4 + IPPROTO_IPV6 = 0x29 + IPPROTO_MAX = 0x100 + IPPROTO_MAXID = 0x103 + IPPROTO_MOBILE = 0x37 + IPPROTO_MPLS = 0x89 + IPPROTO_NONE = 0x3b + IPPROTO_PFSYNC = 0xf0 + IPPROTO_PIM = 0x67 + IPPROTO_PUP = 0xc + IPPROTO_RAW = 0xff + IPPROTO_ROUTING = 0x2b + IPPROTO_RSVP = 0x2e + IPPROTO_SCTP = 0x84 + IPPROTO_TCP = 0x6 + IPPROTO_TP = 0x1d + IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 + IPV6_AUTH_LEVEL = 0x35 + IPV6_AUTOFLOWLABEL = 0x3b + IPV6_CHECKSUM = 0x1a + IPV6_DEFAULT_MULTICAST_HOPS = 0x1 + IPV6_DEFAULT_MULTICAST_LOOP = 0x1 + IPV6_DEFHLIM = 0x40 + IPV6_DONTFRAG = 0x3e + IPV6_DSTOPTS = 0x32 + IPV6_ESP_NETWORK_LEVEL = 0x37 + IPV6_ESP_TRANS_LEVEL = 0x36 + IPV6_FAITH = 0x1d + IPV6_FLOWINFO_MASK = 0xffffff0f + IPV6_FLOWLABEL_MASK = 0xffff0f00 + IPV6_FRAGTTL = 0x78 + IPV6_HLIMDEC = 0x1 + IPV6_HOPLIMIT = 0x2f + IPV6_HOPOPTS = 0x31 + IPV6_IPCOMP_LEVEL = 0x3c + IPV6_JOIN_GROUP = 0xc + IPV6_LEAVE_GROUP = 0xd + IPV6_MAXHLIM = 0xff + IPV6_MAXPACKET = 0xffff + IPV6_MINHOPCOUNT = 0x41 + IPV6_MMTU = 0x500 + IPV6_MULTICAST_HOPS = 0xa + IPV6_MULTICAST_IF = 0x9 + IPV6_MULTICAST_LOOP = 0xb + IPV6_NEXTHOP = 0x30 + IPV6_OPTIONS = 0x1 + IPV6_PATHMTU = 0x2c + IPV6_PIPEX = 0x3f + IPV6_PKTINFO = 0x2e + IPV6_PORTRANGE = 0xe + IPV6_PORTRANGE_DEFAULT = 0x0 + IPV6_PORTRANGE_HIGH = 0x1 + IPV6_PORTRANGE_LOW = 0x2 + IPV6_RECVDSTOPTS = 0x28 + IPV6_RECVDSTPORT = 0x40 + IPV6_RECVHOPLIMIT = 0x25 + IPV6_RECVHOPOPTS = 0x27 + IPV6_RECVPATHMTU = 0x2b + IPV6_RECVPKTINFO = 0x24 + IPV6_RECVRTHDR = 0x26 + IPV6_RECVTCLASS = 0x39 + IPV6_RTABLE = 0x1021 + IPV6_RTHDR = 0x33 + IPV6_RTHDRDSTOPTS = 0x23 + IPV6_RTHDR_LOOSE = 0x0 + IPV6_RTHDR_STRICT = 0x1 + IPV6_RTHDR_TYPE_0 = 0x0 + IPV6_SOCKOPT_RESERVED1 = 0x3 + IPV6_TCLASS = 0x3d + IPV6_UNICAST_HOPS = 0x4 + IPV6_USE_MIN_MTU = 0x2a + IPV6_V6ONLY = 0x1b + IPV6_VERSION = 0x60 + IPV6_VERSION_MASK = 0xf0 + IP_ADD_MEMBERSHIP = 0xc + IP_AUTH_LEVEL = 0x14 + IP_DEFAULT_MULTICAST_LOOP = 0x1 + IP_DEFAULT_MULTICAST_TTL = 0x1 + IP_DF = 0x4000 + IP_DROP_MEMBERSHIP = 0xd + IP_ESP_NETWORK_LEVEL = 0x16 + IP_ESP_TRANS_LEVEL = 0x15 + IP_HDRINCL = 0x2 + IP_IPCOMP_LEVEL = 0x1d + IP_IPDEFTTL = 0x25 + IP_IPSECFLOWINFO = 0x24 + IP_IPSEC_LOCAL_AUTH = 0x1b + IP_IPSEC_LOCAL_CRED = 0x19 + IP_IPSEC_LOCAL_ID = 0x17 + IP_IPSEC_REMOTE_AUTH = 0x1c + IP_IPSEC_REMOTE_CRED = 0x1a + IP_IPSEC_REMOTE_ID = 0x18 + IP_MAXPACKET = 0xffff + IP_MAX_MEMBERSHIPS = 0xfff + IP_MF = 0x2000 + IP_MINTTL = 0x20 + IP_MIN_MEMBERSHIPS = 0xf + IP_MSS = 0x240 + IP_MULTICAST_IF = 0x9 + IP_MULTICAST_LOOP = 0xb + IP_MULTICAST_TTL = 0xa + IP_OFFMASK = 0x1fff + IP_OPTIONS = 0x1 + IP_PIPEX = 0x22 + IP_PORTRANGE = 0x13 + IP_PORTRANGE_DEFAULT = 0x0 + IP_PORTRANGE_HIGH = 0x1 + IP_PORTRANGE_LOW = 0x2 + IP_RECVDSTADDR = 0x7 + IP_RECVDSTPORT = 0x21 + IP_RECVIF = 0x1e + IP_RECVOPTS = 0x5 + IP_RECVRETOPTS = 0x6 + IP_RECVRTABLE = 0x23 + IP_RECVTTL = 0x1f + IP_RETOPTS = 0x8 + IP_RF = 0x8000 + IP_RTABLE = 0x1021 + IP_SENDSRCADDR = 0x7 + IP_TOS = 0x3 + IP_TTL = 0x4 + ISIG = 0x80 + ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IUCLC = 0x1000 + IXANY = 0x800 + IXOFF = 0x400 + IXON = 0x200 + KERN_HOSTNAME = 0xa + KERN_OSRELEASE = 0x2 + KERN_OSTYPE = 0x1 + KERN_VERSION = 0x4 + LCNT_OVERLOAD_FLUSH = 0x6 + LOCK_EX = 0x2 + LOCK_NB = 0x4 + LOCK_SH = 0x1 + LOCK_UN = 0x8 + MADV_DONTNEED = 0x4 + MADV_FREE = 0x6 + MADV_NORMAL = 0x0 + MADV_RANDOM = 0x1 + MADV_SEQUENTIAL = 0x2 + MADV_SPACEAVAIL = 0x5 + MADV_WILLNEED = 0x3 + MAP_ANON = 0x1000 + MAP_ANONYMOUS = 0x1000 + MAP_CONCEAL = 0x8000 + MAP_COPY = 0x2 + MAP_FILE = 0x0 + MAP_FIXED = 0x10 + MAP_FLAGMASK = 0xfff7 + MAP_HASSEMAPHORE = 0x0 + MAP_INHERIT = 0x0 + MAP_INHERIT_COPY = 0x1 + MAP_INHERIT_NONE = 0x2 + MAP_INHERIT_SHARE = 0x0 + MAP_INHERIT_ZERO = 0x3 + MAP_NOEXTEND = 0x0 + MAP_NORESERVE = 0x0 + MAP_PRIVATE = 0x2 + MAP_RENAME = 0x0 + MAP_SHARED = 0x1 + MAP_STACK = 0x4000 + MAP_TRYFIXED = 0x0 + MCL_CURRENT = 0x1 + MCL_FUTURE = 0x2 + MNT_ASYNC = 0x40 + MNT_DEFEXPORTED = 0x200 + MNT_DELEXPORT = 0x20000 + MNT_DOOMED = 0x8000000 + MNT_EXPORTANON = 0x400 + MNT_EXPORTED = 0x100 + MNT_EXRDONLY = 0x80 + MNT_FORCE = 0x80000 + MNT_LAZY = 0x3 + MNT_LOCAL = 0x1000 + MNT_NOATIME = 0x8000 + MNT_NODEV = 0x10 + MNT_NOEXEC = 0x4 + MNT_NOPERM = 0x20 + MNT_NOSUID = 0x8 + MNT_NOWAIT = 0x2 + MNT_QUOTA = 0x2000 + MNT_RDONLY = 0x1 + MNT_RELOAD = 0x40000 + MNT_ROOTFS = 0x4000 + MNT_SOFTDEP = 0x4000000 + MNT_STALLED = 0x100000 + MNT_SWAPPABLE = 0x200000 + MNT_SYNCHRONOUS = 0x2 + MNT_UPDATE = 0x10000 + MNT_VISFLAGMASK = 0x400ffff + MNT_WAIT = 0x1 + MNT_WANTRDWR = 0x2000000 + MNT_WXALLOWED = 0x800 + MOUNT_AFS = "afs" + MOUNT_CD9660 = "cd9660" + MOUNT_EXT2FS = "ext2fs" + MOUNT_FFS = "ffs" + MOUNT_FUSEFS = "fuse" + MOUNT_MFS = "mfs" + MOUNT_MSDOS = "msdos" + MOUNT_NCPFS = "ncpfs" + MOUNT_NFS = "nfs" + MOUNT_NTFS = "ntfs" + MOUNT_TMPFS = "tmpfs" + MOUNT_UDF = "udf" + MOUNT_UFS = "ffs" + MSG_BCAST = 0x100 + MSG_CMSG_CLOEXEC = 0x800 + MSG_CTRUNC = 0x20 + MSG_DONTROUTE = 0x4 + MSG_DONTWAIT = 0x80 + MSG_EOR = 0x8 + MSG_MCAST = 0x200 + MSG_NOSIGNAL = 0x400 + MSG_OOB = 0x1 + MSG_PEEK = 0x2 + MSG_TRUNC = 0x10 + MSG_WAITALL = 0x40 + MS_ASYNC = 0x1 + MS_INVALIDATE = 0x4 + MS_SYNC = 0x2 + NAME_MAX = 0xff + NET_RT_DUMP = 0x1 + NET_RT_FLAGS = 0x2 + NET_RT_IFLIST = 0x3 + NET_RT_IFNAMES = 0x6 + NET_RT_MAXID = 0x8 + NET_RT_SOURCE = 0x7 + NET_RT_STATS = 0x4 + NET_RT_TABLE = 0x5 + NFDBITS = 0x20 + NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 + NOTE_ATTRIB = 0x8 + NOTE_CHANGE = 0x1 + NOTE_CHILD = 0x4 + NOTE_DELETE = 0x1 + NOTE_EOF = 0x2 + NOTE_EXEC = 0x20000000 + NOTE_EXIT = 0x80000000 + NOTE_EXTEND = 0x4 + NOTE_FORK = 0x40000000 + NOTE_LINK = 0x10 + NOTE_LOWAT = 0x1 + NOTE_OOB = 0x4 + NOTE_PCTRLMASK = 0xf0000000 + NOTE_PDATAMASK = 0xfffff + NOTE_RENAME = 0x20 + NOTE_REVOKE = 0x40 + NOTE_TRACK = 0x1 + NOTE_TRACKERR = 0x2 + NOTE_TRUNCATE = 0x80 + NOTE_WRITE = 0x2 + OCRNL = 0x10 + OLCUC = 0x20 + ONLCR = 0x2 + ONLRET = 0x80 + ONOCR = 0x40 + ONOEOT = 0x8 + OPOST = 0x1 + OXTABS = 0x4 + O_ACCMODE = 0x3 + O_APPEND = 0x8 + O_ASYNC = 0x40 + O_CLOEXEC = 0x10000 + O_CREAT = 0x200 + O_DIRECTORY = 0x20000 + O_DSYNC = 0x80 + O_EXCL = 0x800 + O_EXLOCK = 0x20 + O_FSYNC = 0x80 + O_NDELAY = 0x4 + O_NOCTTY = 0x8000 + O_NOFOLLOW = 0x100 + O_NONBLOCK = 0x4 + O_RDONLY = 0x0 + O_RDWR = 0x2 + O_RSYNC = 0x80 + O_SHLOCK = 0x10 + O_SYNC = 0x80 + O_TRUNC = 0x400 + O_WRONLY = 0x1 + PARENB = 0x1000 + PARMRK = 0x8 + PARODD = 0x2000 + PENDIN = 0x20000000 + PF_FLUSH = 0x1 + PRIO_PGRP = 0x1 + PRIO_PROCESS = 0x0 + PRIO_USER = 0x2 + PROT_EXEC = 0x4 + PROT_NONE = 0x0 + PROT_READ = 0x1 + PROT_WRITE = 0x2 + RLIMIT_CORE = 0x4 + RLIMIT_CPU = 0x0 + RLIMIT_DATA = 0x2 + RLIMIT_FSIZE = 0x1 + RLIMIT_MEMLOCK = 0x6 + RLIMIT_NOFILE = 0x8 + RLIMIT_NPROC = 0x7 + RLIMIT_RSS = 0x5 + RLIMIT_STACK = 0x3 + RLIM_INFINITY = 0x7fffffffffffffff + RTAX_AUTHOR = 0x6 + RTAX_BFD = 0xb + RTAX_BRD = 0x7 + RTAX_DNS = 0xc + RTAX_DST = 0x0 + RTAX_GATEWAY = 0x1 + RTAX_GENMASK = 0x3 + RTAX_IFA = 0x5 + RTAX_IFP = 0x4 + RTAX_LABEL = 0xa + RTAX_MAX = 0xf + RTAX_NETMASK = 0x2 + RTAX_SEARCH = 0xe + RTAX_SRC = 0x8 + RTAX_SRCMASK = 0x9 + RTAX_STATIC = 0xd + RTA_AUTHOR = 0x40 + RTA_BFD = 0x800 + RTA_BRD = 0x80 + RTA_DNS = 0x1000 + RTA_DST = 0x1 + RTA_GATEWAY = 0x2 + RTA_GENMASK = 0x8 + RTA_IFA = 0x20 + RTA_IFP = 0x10 + RTA_LABEL = 0x400 + RTA_NETMASK = 0x4 + RTA_SEARCH = 0x4000 + RTA_SRC = 0x100 + RTA_SRCMASK = 0x200 + RTA_STATIC = 0x2000 + RTF_ANNOUNCE = 0x4000 + RTF_BFD = 0x1000000 + RTF_BLACKHOLE = 0x1000 + RTF_BROADCAST = 0x400000 + RTF_CACHED = 0x20000 + RTF_CLONED = 0x10000 + RTF_CLONING = 0x100 + RTF_CONNECTED = 0x800000 + RTF_DONE = 0x40 + RTF_DYNAMIC = 0x10 + RTF_FMASK = 0x110fc08 + RTF_GATEWAY = 0x2 + RTF_HOST = 0x4 + RTF_LLINFO = 0x400 + RTF_LOCAL = 0x200000 + RTF_MODIFIED = 0x20 + RTF_MPATH = 0x40000 + RTF_MPLS = 0x100000 + RTF_MULTICAST = 0x200 + RTF_PERMANENT_ARP = 0x2000 + RTF_PROTO1 = 0x8000 + RTF_PROTO2 = 0x4000 + RTF_PROTO3 = 0x2000 + RTF_REJECT = 0x8 + RTF_STATIC = 0x800 + RTF_UP = 0x1 + RTF_USETRAILERS = 0x8000 + RTM_80211INFO = 0x15 + RTM_ADD = 0x1 + RTM_BFD = 0x12 + RTM_CHANGE = 0x3 + RTM_CHGADDRATTR = 0x14 + RTM_DELADDR = 0xd + RTM_DELETE = 0x2 + RTM_DESYNC = 0x10 + RTM_GET = 0x4 + RTM_IFANNOUNCE = 0xf + RTM_IFINFO = 0xe + RTM_INVALIDATE = 0x11 + RTM_LOSING = 0x5 + RTM_MAXSIZE = 0x800 + RTM_MISS = 0x7 + RTM_NEWADDR = 0xc + RTM_PROPOSAL = 0x13 + RTM_REDIRECT = 0x6 + RTM_RESOLVE = 0xb + RTM_SOURCE = 0x16 + RTM_VERSION = 0x5 + RTV_EXPIRE = 0x4 + RTV_HOPCOUNT = 0x2 + RTV_MTU = 0x1 + RTV_RPIPE = 0x8 + RTV_RTT = 0x40 + RTV_RTTVAR = 0x80 + RTV_SPIPE = 0x10 + RTV_SSTHRESH = 0x20 + RT_TABLEID_BITS = 0x8 + RT_TABLEID_MASK = 0xff + RT_TABLEID_MAX = 0xff + RUSAGE_CHILDREN = -0x1 + RUSAGE_SELF = 0x0 + RUSAGE_THREAD = 0x1 + SCM_RIGHTS = 0x1 + SCM_TIMESTAMP = 0x4 + SEEK_CUR = 0x1 + SEEK_END = 0x2 + SEEK_SET = 0x0 + SHUT_RD = 0x0 + SHUT_RDWR = 0x2 + SHUT_WR = 0x1 + SIOCADDMULTI = 0x80206931 + SIOCAIFADDR = 0x8040691a + SIOCAIFGROUP = 0x80286987 + SIOCATMARK = 0x40047307 + SIOCBRDGADD = 0x8060693c + SIOCBRDGADDL = 0x80606949 + SIOCBRDGADDS = 0x80606941 + SIOCBRDGARL = 0x808c694d + SIOCBRDGDADDR = 0x81286947 + SIOCBRDGDEL = 0x8060693d + SIOCBRDGDELS = 0x80606942 + SIOCBRDGFLUSH = 0x80606948 + SIOCBRDGFRL = 0x808c694e + SIOCBRDGGCACHE = 0xc0146941 + SIOCBRDGGFD = 0xc0146952 + SIOCBRDGGHT = 0xc0146951 + SIOCBRDGGIFFLGS = 0xc060693e + SIOCBRDGGMA = 0xc0146953 + SIOCBRDGGPARAM = 0xc0406958 + SIOCBRDGGPRI = 0xc0146950 + SIOCBRDGGRL = 0xc030694f + SIOCBRDGGTO = 0xc0146946 + SIOCBRDGIFS = 0xc0606942 + SIOCBRDGRTS = 0xc0206943 + SIOCBRDGSADDR = 0xc1286944 + SIOCBRDGSCACHE = 0x80146940 + SIOCBRDGSFD = 0x80146952 + SIOCBRDGSHT = 0x80146951 + SIOCBRDGSIFCOST = 0x80606955 + SIOCBRDGSIFFLGS = 0x8060693f + SIOCBRDGSIFPRIO = 0x80606954 + SIOCBRDGSIFPROT = 0x8060694a + SIOCBRDGSMA = 0x80146953 + SIOCBRDGSPRI = 0x80146950 + SIOCBRDGSPROTO = 0x8014695a + SIOCBRDGSTO = 0x80146945 + SIOCBRDGSTXHC = 0x80146959 + SIOCDELLABEL = 0x80206997 + SIOCDELMULTI = 0x80206932 + SIOCDIFADDR = 0x80206919 + SIOCDIFGROUP = 0x80286989 + SIOCDIFPARENT = 0x802069b4 + SIOCDIFPHYADDR = 0x80206949 + SIOCDPWE3NEIGHBOR = 0x802069de + SIOCDVNETID = 0x802069af + SIOCGETKALIVE = 0xc01869a4 + SIOCGETLABEL = 0x8020699a + SIOCGETMPWCFG = 0xc02069ae + SIOCGETPFLOW = 0xc02069fe + SIOCGETPFSYNC = 0xc02069f8 + SIOCGETSGCNT = 0xc0207534 + SIOCGETVIFCNT = 0xc0287533 + SIOCGETVLAN = 0xc0206990 + SIOCGIFADDR = 0xc0206921 + SIOCGIFBRDADDR = 0xc0206923 + SIOCGIFCONF = 0xc0106924 + SIOCGIFDATA = 0xc020691b + SIOCGIFDESCR = 0xc0206981 + SIOCGIFDSTADDR = 0xc0206922 + SIOCGIFFLAGS = 0xc0206911 + SIOCGIFGATTR = 0xc028698b + SIOCGIFGENERIC = 0xc020693a + SIOCGIFGLIST = 0xc028698d + SIOCGIFGMEMB = 0xc028698a + SIOCGIFGROUP = 0xc0286988 + SIOCGIFHARDMTU = 0xc02069a5 + SIOCGIFLLPRIO = 0xc02069b6 + SIOCGIFMEDIA = 0xc0406938 + SIOCGIFMETRIC = 0xc0206917 + SIOCGIFMTU = 0xc020697e + SIOCGIFNETMASK = 0xc0206925 + SIOCGIFPAIR = 0xc02069b1 + SIOCGIFPARENT = 0xc02069b3 + SIOCGIFPRIORITY = 0xc020699c + SIOCGIFRDOMAIN = 0xc02069a0 + SIOCGIFRTLABEL = 0xc0206983 + SIOCGIFRXR = 0x802069aa + SIOCGIFSFFPAGE = 0xc1126939 + SIOCGIFXFLAGS = 0xc020699e + SIOCGLIFPHYADDR = 0xc218694b + SIOCGLIFPHYDF = 0xc02069c2 + SIOCGLIFPHYECN = 0xc02069c8 + SIOCGLIFPHYRTABLE = 0xc02069a2 + SIOCGLIFPHYTTL = 0xc02069a9 + SIOCGPGRP = 0x40047309 + SIOCGPWE3 = 0xc0206998 + SIOCGPWE3CTRLWORD = 0xc02069dc + SIOCGPWE3FAT = 0xc02069dd + SIOCGPWE3NEIGHBOR = 0xc21869de + SIOCGRXHPRIO = 0xc02069db + SIOCGSPPPPARAMS = 0xc0206994 + SIOCGTXHPRIO = 0xc02069c6 + SIOCGUMBINFO = 0xc02069be + SIOCGUMBPARAM = 0xc02069c0 + SIOCGVH = 0xc02069f6 + SIOCGVNETFLOWID = 0xc02069c4 + SIOCGVNETID = 0xc02069a7 + SIOCIFAFATTACH = 0x801169ab + SIOCIFAFDETACH = 0x801169ac + SIOCIFCREATE = 0x8020697a + SIOCIFDESTROY = 0x80206979 + SIOCIFGCLONERS = 0xc0106978 + SIOCSETKALIVE = 0x801869a3 + SIOCSETLABEL = 0x80206999 + SIOCSETMPWCFG = 0x802069ad + SIOCSETPFLOW = 0x802069fd + SIOCSETPFSYNC = 0x802069f7 + SIOCSETVLAN = 0x8020698f + SIOCSIFADDR = 0x8020690c + SIOCSIFBRDADDR = 0x80206913 + SIOCSIFDESCR = 0x80206980 + SIOCSIFDSTADDR = 0x8020690e + SIOCSIFFLAGS = 0x80206910 + SIOCSIFGATTR = 0x8028698c + SIOCSIFGENERIC = 0x80206939 + SIOCSIFLLADDR = 0x8020691f + SIOCSIFLLPRIO = 0x802069b5 + SIOCSIFMEDIA = 0xc0206937 + SIOCSIFMETRIC = 0x80206918 + SIOCSIFMTU = 0x8020697f + SIOCSIFNETMASK = 0x80206916 + SIOCSIFPAIR = 0x802069b0 + SIOCSIFPARENT = 0x802069b2 + SIOCSIFPRIORITY = 0x8020699b + SIOCSIFRDOMAIN = 0x8020699f + SIOCSIFRTLABEL = 0x80206982 + SIOCSIFXFLAGS = 0x8020699d + SIOCSLIFPHYADDR = 0x8218694a + SIOCSLIFPHYDF = 0x802069c1 + SIOCSLIFPHYECN = 0x802069c7 + SIOCSLIFPHYRTABLE = 0x802069a1 + SIOCSLIFPHYTTL = 0x802069a8 + SIOCSPGRP = 0x80047308 + SIOCSPWE3CTRLWORD = 0x802069dc + SIOCSPWE3FAT = 0x802069dd + SIOCSPWE3NEIGHBOR = 0x821869de + SIOCSRXHPRIO = 0x802069db + SIOCSSPPPPARAMS = 0x80206993 + SIOCSTXHPRIO = 0x802069c5 + SIOCSUMBPARAM = 0x802069bf + SIOCSVH = 0xc02069f5 + SIOCSVNETFLOWID = 0x802069c3 + SIOCSVNETID = 0x802069a6 + SOCK_CLOEXEC = 0x8000 + SOCK_DGRAM = 0x2 + SOCK_DNS = 0x1000 + SOCK_NONBLOCK = 0x4000 + SOCK_RAW = 0x3 + SOCK_RDM = 0x4 + SOCK_SEQPACKET = 0x5 + SOCK_STREAM = 0x1 + SOL_SOCKET = 0xffff + SOMAXCONN = 0x80 + SO_ACCEPTCONN = 0x2 + SO_BINDANY = 0x1000 + SO_BROADCAST = 0x20 + SO_DEBUG = 0x1 + SO_DOMAIN = 0x1024 + SO_DONTROUTE = 0x10 + SO_ERROR = 0x1007 + SO_KEEPALIVE = 0x8 + SO_LINGER = 0x80 + SO_NETPROC = 0x1020 + SO_OOBINLINE = 0x100 + SO_PEERCRED = 0x1022 + SO_PROTOCOL = 0x1025 + SO_RCVBUF = 0x1002 + SO_RCVLOWAT = 0x1004 + SO_RCVTIMEO = 0x1006 + SO_REUSEADDR = 0x4 + SO_REUSEPORT = 0x200 + SO_RTABLE = 0x1021 + SO_SNDBUF = 0x1001 + SO_SNDLOWAT = 0x1003 + SO_SNDTIMEO = 0x1005 + SO_SPLICE = 0x1023 + SO_TIMESTAMP = 0x800 + SO_TYPE = 0x1008 + SO_USELOOPBACK = 0x40 + SO_ZEROIZE = 0x2000 + S_BLKSIZE = 0x200 + S_IEXEC = 0x40 + S_IFBLK = 0x6000 + S_IFCHR = 0x2000 + S_IFDIR = 0x4000 + S_IFIFO = 0x1000 + S_IFLNK = 0xa000 + S_IFMT = 0xf000 + S_IFREG = 0x8000 + S_IFSOCK = 0xc000 + S_IREAD = 0x100 + S_IRGRP = 0x20 + S_IROTH = 0x4 + S_IRUSR = 0x100 + S_IRWXG = 0x38 + S_IRWXO = 0x7 + S_IRWXU = 0x1c0 + S_ISGID = 0x400 + S_ISTXT = 0x200 + S_ISUID = 0x800 + S_ISVTX = 0x200 + S_IWGRP = 0x10 + S_IWOTH = 0x2 + S_IWRITE = 0x80 + S_IWUSR = 0x80 + S_IXGRP = 0x8 + S_IXOTH = 0x1 + S_IXUSR = 0x40 + TCIFLUSH = 0x1 + TCIOFF = 0x3 + TCIOFLUSH = 0x3 + TCION = 0x4 + TCOFLUSH = 0x2 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_HDR = 0x1010500 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SACK_PERMIT_HDR = 0x1010402 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_TSTAMP_HDR = 0x101080a + TCPOPT_WINDOW = 0x3 + TCP_INFO = 0x9 + TCP_MAXSEG = 0x2 + TCP_MAXWIN = 0xffff + TCP_MAX_SACK = 0x3 + TCP_MAX_WINSHIFT = 0xe + TCP_MD5SIG = 0x4 + TCP_MSS = 0x200 + TCP_NODELAY = 0x1 + TCP_NOPUSH = 0x10 + TCP_SACKHOLE_LIMIT = 0x80 + TCP_SACK_ENABLE = 0x8 + TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 + TIOCCBRK = 0x2000747a + TIOCCDTR = 0x20007478 + TIOCCHKVERAUTH = 0x2000741e + TIOCCLRVERAUTH = 0x2000741d + TIOCCONS = 0x80047462 + TIOCDRAIN = 0x2000745e + TIOCEXCL = 0x2000740d + TIOCEXT = 0x80047460 + TIOCFLAG_CLOCAL = 0x2 + TIOCFLAG_CRTSCTS = 0x4 + TIOCFLAG_MDMBUF = 0x8 + TIOCFLAG_PPS = 0x10 + TIOCFLAG_SOFTCAR = 0x1 + TIOCFLUSH = 0x80047410 + TIOCGETA = 0x402c7413 + TIOCGETD = 0x4004741a + TIOCGFLAGS = 0x4004745d + TIOCGPGRP = 0x40047477 + TIOCGSID = 0x40047463 + TIOCGTSTAMP = 0x4010745b + TIOCGWINSZ = 0x40087468 + TIOCMBIC = 0x8004746b + TIOCMBIS = 0x8004746c + TIOCMGET = 0x4004746a + TIOCMODG = 0x4004746a + TIOCMODS = 0x8004746d + TIOCMSET = 0x8004746d + TIOCM_CAR = 0x40 + TIOCM_CD = 0x40 + TIOCM_CTS = 0x20 + TIOCM_DSR = 0x100 + TIOCM_DTR = 0x2 + TIOCM_LE = 0x1 + TIOCM_RI = 0x80 + TIOCM_RNG = 0x80 + TIOCM_RTS = 0x4 + TIOCM_SR = 0x10 + TIOCM_ST = 0x8 + TIOCNOTTY = 0x20007471 + TIOCNXCL = 0x2000740e + TIOCOUTQ = 0x40047473 + TIOCPKT = 0x80047470 + TIOCPKT_DATA = 0x0 + TIOCPKT_DOSTOP = 0x20 + TIOCPKT_FLUSHREAD = 0x1 + TIOCPKT_FLUSHWRITE = 0x2 + TIOCPKT_IOCTL = 0x40 + TIOCPKT_NOSTOP = 0x10 + TIOCPKT_START = 0x8 + TIOCPKT_STOP = 0x4 + TIOCREMOTE = 0x80047469 + TIOCSBRK = 0x2000747b + TIOCSCTTY = 0x20007461 + TIOCSDTR = 0x20007479 + TIOCSETA = 0x802c7414 + TIOCSETAF = 0x802c7416 + TIOCSETAW = 0x802c7415 + TIOCSETD = 0x8004741b + TIOCSETVERAUTH = 0x8004741c + TIOCSFLAGS = 0x8004745c + TIOCSIG = 0x8004745f + TIOCSPGRP = 0x80047476 + TIOCSTART = 0x2000746e + TIOCSTAT = 0x20007465 + TIOCSTOP = 0x2000746f + TIOCSTSTAMP = 0x8008745a + TIOCSWINSZ = 0x80087467 + TIOCUCNTL = 0x80047466 + TIOCUCNTL_CBRK = 0x7a + TIOCUCNTL_SBRK = 0x7b + TOSTOP = 0x400000 + UTIME_NOW = -0x2 + UTIME_OMIT = -0x1 + VDISCARD = 0xf + VDSUSP = 0xb + VEOF = 0x0 + VEOL = 0x1 + VEOL2 = 0x2 + VERASE = 0x3 + VINTR = 0x8 + VKILL = 0x5 + VLNEXT = 0xe + VMIN = 0x10 + VM_ANONMIN = 0x7 + VM_LOADAVG = 0x2 + VM_MALLOC_CONF = 0xc + VM_MAXID = 0xd + VM_MAXSLP = 0xa + VM_METER = 0x1 + VM_NKMEMPAGES = 0x6 + VM_PSSTRINGS = 0x3 + VM_SWAPENCRYPT = 0x5 + VM_USPACE = 0xb + VM_UVMEXP = 0x4 + VM_VNODEMIN = 0x9 + VM_VTEXTMIN = 0x8 + VQUIT = 0x9 + VREPRINT = 0x6 + VSTART = 0xc + VSTATUS = 0x12 + VSTOP = 0xd + VSUSP = 0xa + VTIME = 0x11 + VWERASE = 0x4 + WALTSIG = 0x4 + WCONTINUED = 0x8 + WCOREFLAG = 0x80 + WNOHANG = 0x1 + WUNTRACED = 0x2 + XCASE = 0x1000000 +) + +// Errors +const ( + E2BIG = syscall.Errno(0x7) + EACCES = syscall.Errno(0xd) + EADDRINUSE = syscall.Errno(0x30) + EADDRNOTAVAIL = syscall.Errno(0x31) + EAFNOSUPPORT = syscall.Errno(0x2f) + EAGAIN = syscall.Errno(0x23) + EALREADY = syscall.Errno(0x25) + EAUTH = syscall.Errno(0x50) + EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x5c) + EBADRPC = syscall.Errno(0x48) + EBUSY = syscall.Errno(0x10) + ECANCELED = syscall.Errno(0x58) + ECHILD = syscall.Errno(0xa) + ECONNABORTED = syscall.Errno(0x35) + ECONNREFUSED = syscall.Errno(0x3d) + ECONNRESET = syscall.Errno(0x36) + EDEADLK = syscall.Errno(0xb) + EDESTADDRREQ = syscall.Errno(0x27) + EDOM = syscall.Errno(0x21) + EDQUOT = syscall.Errno(0x45) + EEXIST = syscall.Errno(0x11) + EFAULT = syscall.Errno(0xe) + EFBIG = syscall.Errno(0x1b) + EFTYPE = syscall.Errno(0x4f) + EHOSTDOWN = syscall.Errno(0x40) + EHOSTUNREACH = syscall.Errno(0x41) + EIDRM = syscall.Errno(0x59) + EILSEQ = syscall.Errno(0x54) + EINPROGRESS = syscall.Errno(0x24) + EINTR = syscall.Errno(0x4) + EINVAL = syscall.Errno(0x16) + EIO = syscall.Errno(0x5) + EIPSEC = syscall.Errno(0x52) + EISCONN = syscall.Errno(0x38) + EISDIR = syscall.Errno(0x15) + ELAST = syscall.Errno(0x5f) + ELOOP = syscall.Errno(0x3e) + EMEDIUMTYPE = syscall.Errno(0x56) + EMFILE = syscall.Errno(0x18) + EMLINK = syscall.Errno(0x1f) + EMSGSIZE = syscall.Errno(0x28) + ENAMETOOLONG = syscall.Errno(0x3f) + ENEEDAUTH = syscall.Errno(0x51) + ENETDOWN = syscall.Errno(0x32) + ENETRESET = syscall.Errno(0x34) + ENETUNREACH = syscall.Errno(0x33) + ENFILE = syscall.Errno(0x17) + ENOATTR = syscall.Errno(0x53) + ENOBUFS = syscall.Errno(0x37) + ENODEV = syscall.Errno(0x13) + ENOENT = syscall.Errno(0x2) + ENOEXEC = syscall.Errno(0x8) + ENOLCK = syscall.Errno(0x4d) + ENOMEDIUM = syscall.Errno(0x55) + ENOMEM = syscall.Errno(0xc) + ENOMSG = syscall.Errno(0x5a) + ENOPROTOOPT = syscall.Errno(0x2a) + ENOSPC = syscall.Errno(0x1c) + ENOSYS = syscall.Errno(0x4e) + ENOTBLK = syscall.Errno(0xf) + ENOTCONN = syscall.Errno(0x39) + ENOTDIR = syscall.Errno(0x14) + ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5d) + ENOTSOCK = syscall.Errno(0x26) + ENOTSUP = syscall.Errno(0x5b) + ENOTTY = syscall.Errno(0x19) + ENXIO = syscall.Errno(0x6) + EOPNOTSUPP = syscall.Errno(0x2d) + EOVERFLOW = syscall.Errno(0x57) + EOWNERDEAD = syscall.Errno(0x5e) + EPERM = syscall.Errno(0x1) + EPFNOSUPPORT = syscall.Errno(0x2e) + EPIPE = syscall.Errno(0x20) + EPROCLIM = syscall.Errno(0x43) + EPROCUNAVAIL = syscall.Errno(0x4c) + EPROGMISMATCH = syscall.Errno(0x4b) + EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5f) + EPROTONOSUPPORT = syscall.Errno(0x2b) + EPROTOTYPE = syscall.Errno(0x29) + ERANGE = syscall.Errno(0x22) + EREMOTE = syscall.Errno(0x47) + EROFS = syscall.Errno(0x1e) + ERPCMISMATCH = syscall.Errno(0x49) + ESHUTDOWN = syscall.Errno(0x3a) + ESOCKTNOSUPPORT = syscall.Errno(0x2c) + ESPIPE = syscall.Errno(0x1d) + ESRCH = syscall.Errno(0x3) + ESTALE = syscall.Errno(0x46) + ETIMEDOUT = syscall.Errno(0x3c) + ETOOMANYREFS = syscall.Errno(0x3b) + ETXTBSY = syscall.Errno(0x1a) + EUSERS = syscall.Errno(0x44) + EWOULDBLOCK = syscall.Errno(0x23) + EXDEV = syscall.Errno(0x12) +) + +// Signals +const ( + SIGABRT = syscall.Signal(0x6) + SIGALRM = syscall.Signal(0xe) + SIGBUS = syscall.Signal(0xa) + SIGCHLD = syscall.Signal(0x14) + SIGCONT = syscall.Signal(0x13) + SIGEMT = syscall.Signal(0x7) + SIGFPE = syscall.Signal(0x8) + SIGHUP = syscall.Signal(0x1) + SIGILL = syscall.Signal(0x4) + SIGINFO = syscall.Signal(0x1d) + SIGINT = syscall.Signal(0x2) + SIGIO = syscall.Signal(0x17) + SIGIOT = syscall.Signal(0x6) + SIGKILL = syscall.Signal(0x9) + SIGPIPE = syscall.Signal(0xd) + SIGPROF = syscall.Signal(0x1b) + SIGQUIT = syscall.Signal(0x3) + SIGSEGV = syscall.Signal(0xb) + SIGSTOP = syscall.Signal(0x11) + SIGSYS = syscall.Signal(0xc) + SIGTERM = syscall.Signal(0xf) + SIGTHR = syscall.Signal(0x20) + SIGTRAP = syscall.Signal(0x5) + SIGTSTP = syscall.Signal(0x12) + SIGTTIN = syscall.Signal(0x15) + SIGTTOU = syscall.Signal(0x16) + SIGURG = syscall.Signal(0x10) + SIGUSR1 = syscall.Signal(0x1e) + SIGUSR2 = syscall.Signal(0x1f) + SIGVTALRM = syscall.Signal(0x1a) + SIGWINCH = syscall.Signal(0x1c) + SIGXCPU = syscall.Signal(0x18) + SIGXFSZ = syscall.Signal(0x19) +) + +// Error table +var errorList = [...]struct { + num syscall.Errno + name string + desc string +}{ + {1, "EPERM", "operation not permitted"}, + {2, "ENOENT", "no such file or directory"}, + {3, "ESRCH", "no such process"}, + {4, "EINTR", "interrupted system call"}, + {5, "EIO", "input/output error"}, + {6, "ENXIO", "device not configured"}, + {7, "E2BIG", "argument list too long"}, + {8, "ENOEXEC", "exec format error"}, + {9, "EBADF", "bad file descriptor"}, + {10, "ECHILD", "no child processes"}, + {11, "EDEADLK", "resource deadlock avoided"}, + {12, "ENOMEM", "cannot allocate memory"}, + {13, "EACCES", "permission denied"}, + {14, "EFAULT", "bad address"}, + {15, "ENOTBLK", "block device required"}, + {16, "EBUSY", "device busy"}, + {17, "EEXIST", "file exists"}, + {18, "EXDEV", "cross-device link"}, + {19, "ENODEV", "operation not supported by device"}, + {20, "ENOTDIR", "not a directory"}, + {21, "EISDIR", "is a directory"}, + {22, "EINVAL", "invalid argument"}, + {23, "ENFILE", "too many open files in system"}, + {24, "EMFILE", "too many open files"}, + {25, "ENOTTY", "inappropriate ioctl for device"}, + {26, "ETXTBSY", "text file busy"}, + {27, "EFBIG", "file too large"}, + {28, "ENOSPC", "no space left on device"}, + {29, "ESPIPE", "illegal seek"}, + {30, "EROFS", "read-only file system"}, + {31, "EMLINK", "too many links"}, + {32, "EPIPE", "broken pipe"}, + {33, "EDOM", "numerical argument out of domain"}, + {34, "ERANGE", "result too large"}, + {35, "EAGAIN", "resource temporarily unavailable"}, + {36, "EINPROGRESS", "operation now in progress"}, + {37, "EALREADY", "operation already in progress"}, + {38, "ENOTSOCK", "socket operation on non-socket"}, + {39, "EDESTADDRREQ", "destination address required"}, + {40, "EMSGSIZE", "message too long"}, + {41, "EPROTOTYPE", "protocol wrong type for socket"}, + {42, "ENOPROTOOPT", "protocol not available"}, + {43, "EPROTONOSUPPORT", "protocol not supported"}, + {44, "ESOCKTNOSUPPORT", "socket type not supported"}, + {45, "EOPNOTSUPP", "operation not supported"}, + {46, "EPFNOSUPPORT", "protocol family not supported"}, + {47, "EAFNOSUPPORT", "address family not supported by protocol family"}, + {48, "EADDRINUSE", "address already in use"}, + {49, "EADDRNOTAVAIL", "can't assign requested address"}, + {50, "ENETDOWN", "network is down"}, + {51, "ENETUNREACH", "network is unreachable"}, + {52, "ENETRESET", "network dropped connection on reset"}, + {53, "ECONNABORTED", "software caused connection abort"}, + {54, "ECONNRESET", "connection reset by peer"}, + {55, "ENOBUFS", "no buffer space available"}, + {56, "EISCONN", "socket is already connected"}, + {57, "ENOTCONN", "socket is not connected"}, + {58, "ESHUTDOWN", "can't send after socket shutdown"}, + {59, "ETOOMANYREFS", "too many references: can't splice"}, + {60, "ETIMEDOUT", "operation timed out"}, + {61, "ECONNREFUSED", "connection refused"}, + {62, "ELOOP", "too many levels of symbolic links"}, + {63, "ENAMETOOLONG", "file name too long"}, + {64, "EHOSTDOWN", "host is down"}, + {65, "EHOSTUNREACH", "no route to host"}, + {66, "ENOTEMPTY", "directory not empty"}, + {67, "EPROCLIM", "too many processes"}, + {68, "EUSERS", "too many users"}, + {69, "EDQUOT", "disk quota exceeded"}, + {70, "ESTALE", "stale NFS file handle"}, + {71, "EREMOTE", "too many levels of remote in path"}, + {72, "EBADRPC", "RPC struct is bad"}, + {73, "ERPCMISMATCH", "RPC version wrong"}, + {74, "EPROGUNAVAIL", "RPC program not available"}, + {75, "EPROGMISMATCH", "program version wrong"}, + {76, "EPROCUNAVAIL", "bad procedure for program"}, + {77, "ENOLCK", "no locks available"}, + {78, "ENOSYS", "function not implemented"}, + {79, "EFTYPE", "inappropriate file type or format"}, + {80, "EAUTH", "authentication error"}, + {81, "ENEEDAUTH", "need authenticator"}, + {82, "EIPSEC", "IPsec processing failure"}, + {83, "ENOATTR", "attribute not found"}, + {84, "EILSEQ", "illegal byte sequence"}, + {85, "ENOMEDIUM", "no medium found"}, + {86, "EMEDIUMTYPE", "wrong medium type"}, + {87, "EOVERFLOW", "value too large to be stored in data type"}, + {88, "ECANCELED", "operation canceled"}, + {89, "EIDRM", "identifier removed"}, + {90, "ENOMSG", "no message of desired type"}, + {91, "ENOTSUP", "not supported"}, + {92, "EBADMSG", "bad message"}, + {93, "ENOTRECOVERABLE", "state not recoverable"}, + {94, "EOWNERDEAD", "previous owner died"}, + {95, "ELAST", "protocol error"}, +} + +// Signal table +var signalList = [...]struct { + num syscall.Signal + name string + desc string +}{ + {1, "SIGHUP", "hangup"}, + {2, "SIGINT", "interrupt"}, + {3, "SIGQUIT", "quit"}, + {4, "SIGILL", "illegal instruction"}, + {5, "SIGTRAP", "trace/BPT trap"}, + {6, "SIGABRT", "abort trap"}, + {7, "SIGEMT", "EMT trap"}, + {8, "SIGFPE", "floating point exception"}, + {9, "SIGKILL", "killed"}, + {10, "SIGBUS", "bus error"}, + {11, "SIGSEGV", "segmentation fault"}, + {12, "SIGSYS", "bad system call"}, + {13, "SIGPIPE", "broken pipe"}, + {14, "SIGALRM", "alarm clock"}, + {15, "SIGTERM", "terminated"}, + {16, "SIGURG", "urgent I/O condition"}, + {17, "SIGSTOP", "suspended (signal)"}, + {18, "SIGTSTP", "suspended"}, + {19, "SIGCONT", "continued"}, + {20, "SIGCHLD", "child exited"}, + {21, "SIGTTIN", "stopped (tty input)"}, + {22, "SIGTTOU", "stopped (tty output)"}, + {23, "SIGIO", "I/O possible"}, + {24, "SIGXCPU", "cputime limit exceeded"}, + {25, "SIGXFSZ", "filesize limit exceeded"}, + {26, "SIGVTALRM", "virtual timer expired"}, + {27, "SIGPROF", "profiling timer expired"}, + {28, "SIGWINCH", "window size changes"}, + {29, "SIGINFO", "information request"}, + {30, "SIGUSR1", "user defined signal 1"}, + {31, "SIGUSR2", "user defined signal 2"}, + {32, "SIGTHR", "thread AST"}, +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go deleted file mode 100644 index a06eb0932..000000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.go +++ /dev/null @@ -1,40 +0,0 @@ -// go run mksyscall.go -tags darwin,amd64,go1.13 syscall_darwin.1_13.go -// Code generated by the command above; see README.md. DO NOT EDIT. - -//go:build darwin && amd64 && go1.13 -// +build darwin,amd64,go1.13 - -package unix - -import ( - "syscall" - "unsafe" -) - -var _ syscall.Errno - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func closedir(dir uintptr) (err error) { - _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_closedir_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { - r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) - res = Errno(r0) - return -} - -var libc_readdir_r_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s deleted file mode 100644 index f5bb40eda..000000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.1_13.s +++ /dev/null @@ -1,25 +0,0 @@ -// go run mkasm.go darwin amd64 -// Code generated by the command above; DO NOT EDIT. - -//go:build go1.13 -// +build go1.13 - -#include "textflag.h" - -TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_fdopendir(SB) - -GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) - -TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_closedir(SB) - -GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) - -TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_readdir_r(SB) - -GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 -DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 467deed76..c2461c496 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -1,8 +1,8 @@ -// go run mksyscall.go -tags darwin,amd64,go1.12 syscall_bsd.go syscall_darwin.go syscall_darwin_amd64.go +// go run mksyscall.go -tags darwin,amd64 syscall_bsd.go syscall_darwin.go syscall_darwin_amd64.go // Code generated by the command above; see README.md. DO NOT EDIT. -//go:build darwin && amd64 && go1.12 -// +build darwin,amd64,go1.12 +//go:build darwin && amd64 +// +build darwin,amd64 package unix @@ -463,6 +463,32 @@ var libc_munlockall_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func closedir(dir uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_closedir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { + r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + res = Errno(r0) + return +} + +var libc_readdir_r_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func pipe(p *[2]int32) (err error) { _, _, e1 := syscall_rawSyscall(libc_pipe_trampoline_addr, uintptr(unsafe.Pointer(p)), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index b41467a0e..95fe4c0eb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -1,11 +1,14 @@ // go run mkasm.go darwin amd64 // Code generated by the command above; DO NOT EDIT. -//go:build go1.12 -// +build go1.12 - #include "textflag.h" +TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fdopendir(SB) + +GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) + TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) @@ -174,6 +177,18 @@ TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) +TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_closedir(SB) + +GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) + +TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readdir_r(SB) + +GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) + TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go deleted file mode 100644 index cec595d55..000000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.go +++ /dev/null @@ -1,40 +0,0 @@ -// go run mksyscall.go -tags darwin,arm64,go1.13 syscall_darwin.1_13.go -// Code generated by the command above; see README.md. DO NOT EDIT. - -//go:build darwin && arm64 && go1.13 -// +build darwin,arm64,go1.13 - -package unix - -import ( - "syscall" - "unsafe" -) - -var _ syscall.Errno - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func closedir(dir uintptr) (err error) { - _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_closedir_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { - r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) - res = Errno(r0) - return -} - -var libc_readdir_r_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s deleted file mode 100644 index 0c3f76bc2..000000000 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.1_13.s +++ /dev/null @@ -1,25 +0,0 @@ -// go run mkasm.go darwin arm64 -// Code generated by the command above; DO NOT EDIT. - -//go:build go1.13 -// +build go1.13 - -#include "textflag.h" - -TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_fdopendir(SB) - -GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) - -TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_closedir(SB) - -GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 -DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) - -TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_readdir_r(SB) - -GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 -DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 35938d34f..26a0fdc50 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -1,8 +1,8 @@ -// go run mksyscall.go -tags darwin,arm64,go1.12 syscall_bsd.go syscall_darwin.go syscall_darwin_arm64.go +// go run mksyscall.go -tags darwin,arm64 syscall_bsd.go syscall_darwin.go syscall_darwin_arm64.go // Code generated by the command above; see README.md. DO NOT EDIT. -//go:build darwin && arm64 && go1.12 -// +build darwin,arm64,go1.12 +//go:build darwin && arm64 +// +build darwin,arm64 package unix @@ -463,6 +463,32 @@ var libc_munlockall_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func closedir(dir uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_closedir_trampoline_addr, uintptr(dir), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_closedir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_closedir closedir "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno) { + r0, _, _ := syscall_syscall(libc_readdir_r_trampoline_addr, uintptr(dir), uintptr(unsafe.Pointer(entry)), uintptr(unsafe.Pointer(result))) + res = Errno(r0) + return +} + +var libc_readdir_r_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readdir_r readdir_r "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func pipe(p *[2]int32) (err error) { _, _, e1 := syscall_rawSyscall(libc_pipe_trampoline_addr, uintptr(unsafe.Pointer(p)), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index e1f9204a2..efa5b4c98 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -1,11 +1,14 @@ // go run mkasm.go darwin arm64 // Code generated by the command above; DO NOT EDIT. -//go:build go1.12 -// +build go1.12 - #include "textflag.h" +TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fdopendir(SB) + +GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) + TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) @@ -174,6 +177,18 @@ TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) +TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_closedir(SB) + +GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) + +TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readdir_r(SB) + +GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) + TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go index af5cb064e..b57c7050d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go @@ -15,25 +15,19 @@ import ( //go:cgo_import_dynamic libc_writev writev "libc.so" //go:cgo_import_dynamic libc_pwritev pwritev "libc.so" //go:cgo_import_dynamic libc_accept4 accept4 "libsocket.so" -//go:cgo_import_dynamic libc_putmsg putmsg "libc.so" -//go:cgo_import_dynamic libc_getmsg getmsg "libc.so" //go:linkname procreadv libc_readv //go:linkname procpreadv libc_preadv //go:linkname procwritev libc_writev //go:linkname procpwritev libc_pwritev //go:linkname procaccept4 libc_accept4 -//go:linkname procputmsg libc_putmsg -//go:linkname procgetmsg libc_getmsg var ( procreadv, procpreadv, procwritev, procpwritev, - procaccept4, - procputmsg, - procgetmsg syscallFunc + procaccept4 syscallFunc ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -106,23 +100,3 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, } return } - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { - _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) - if e1 != 0 { - err = e1 - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { - _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) - if e1 != 0 { - err = e1 - } - return -} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index bc4a27531..293cf3680 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -2151,3 +2151,13 @@ func setitimer(which int, newValue *Itimerval, oldValue *Itimerval) (err error) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) (err error) { + _, _, e1 := RawSyscall6(SYS_RT_SIGPROCMASK, uintptr(how), uintptr(unsafe.Pointer(set)), uintptr(unsafe.Pointer(oldset)), uintptr(sigsetsize), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index 88af526b7..c81b0ad47 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -287,46 +287,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID32, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID32, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID32, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID32, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index 2a0c4aa6a..2206bce7f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -334,36 +334,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -374,16 +344,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index 4882bde3a..edf6b39f1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -412,46 +412,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID32, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID32, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID32, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID32, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index 9f8c24e43..190609f21 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -289,36 +289,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -329,16 +299,6 @@ func setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index 523f2ba03..806ffd1e1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -223,46 +223,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index d7d6f4244..5f984cbb1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -248,46 +248,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 7f1f8e653..46fc380a4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -278,36 +278,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -318,16 +288,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index f933d0f51..cbd0d4dad 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -278,36 +278,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -318,16 +288,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index 297d0a998..0c13d15f0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -248,46 +248,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index 2e32e7a44..e01432aed 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -308,46 +308,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index 3c5317046..13c7ee7ba 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -349,36 +349,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -389,16 +359,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index a00c6744e..02d0c0fd6 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -349,36 +349,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -389,16 +359,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 1239cc2de..9fee3b1d2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -269,36 +269,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -309,16 +279,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index e0dabc602..647bbfecd 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -319,36 +319,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -359,16 +329,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index 368623c0f..ada057f89 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -329,36 +329,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setregid(rgid int, egid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresgid(rgid int, egid int, sgid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setresuid(ruid int, euid int, suid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrlimit(resource int, rlim *Rlimit) (err error) { _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) if e1 != 0 { @@ -369,16 +339,6 @@ func Setrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setreuid(ruid int, euid int) (err error) { - _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go new file mode 100644 index 000000000..c85de2d97 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -0,0 +1,2221 @@ +// go run mksyscall.go -openbsd -libc -tags openbsd,ppc64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_ppc64.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build openbsd && ppc64 +// +build openbsd,ppc64 + +package unix + +import ( + "syscall" + "unsafe" +) + +var _ syscall.Errno + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getgroups(ngid int, gid *_Gid_t) (n int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setgroups(ngid int, gid *_Gid_t) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + wpid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socket(domain int, typ int, proto int) (fd int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Shutdown(s int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimes(path string, timeval *[2]Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func futimes(fd int, timeval *[2]Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Madvise(b []byte, behav int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlockall(flags int) (err error) { + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mprotect(b []byte, prot int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Msync(b []byte, flags int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlockall() (err error) { + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pipe2(p *[2]_C_int, flags int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getdents(fd int, buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getcwd(buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctl(fd int, req uint, arg uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Access(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chflags(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chmod(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chroot(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Close(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup(fd int) (nfd int, err error) { + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) + nfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup2(from int, to int) (err error) { + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup3(from int, to int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Exit(code int) { + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) + return +} + +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchdir(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchflags(fd int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmod(fd int, mode uint32) (err error) { + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Flock(fd int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fpathconf(fd int, name int) (val int, err error) { + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstat(fd int, stat *Stat_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatfs(fd int, stat *Statfs_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsync(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Ftruncate(fd int, length int64) (err error) { + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) + egid = int(r0) + return +} + +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) + gid = int(r0) + return +} + +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgid(pid int) (pgid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) + pgid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgrp() (pgrp int) { + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) + pgrp = int(r0) + return +} + +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpid() (pid int) { + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) + pid = int(r0) + return +} + +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getppid() (ppid int) { + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) + ppid = int(r0) + return +} + +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpriority(which int, who int) (prio int, err error) { + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) + prio = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrtable() (rtable int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) + rtable = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrusage(who int, rusage *Rusage) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) + sid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gettimeofday(tv *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Issetugid() (tainted bool) { + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) + tainted = bool(r0 != 0) + return +} + +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kill(pid int, signum syscall.Signal) (err error) { + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kqueue() (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lchown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Link(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, backlog int) (err error) { + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lstat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdir(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdirat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifo(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifoat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknod(path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Nanosleep(time *Timespec, leftover *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Open(path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Pathconf(path string, name int) (val int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func read(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlink(path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rename(from string, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Renameat(fromfd int, from string, tofd int, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Revoke(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rmdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) + newoffset = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setegid(egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seteuid(euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setgid(gid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setlogin(name string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(name) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpgid(pid int, pgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpriority(which int, who int, prio int) (err error) { + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setregid(rgid int, egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setreuid(ruid int, euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresgid(rgid int, egid int, sgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresuid(ruid int, euid int, suid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrtable(rtable int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setsid() (pid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) + pid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Settimeofday(tp *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setuid(uid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Stat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Statfs(path string, stat *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlink(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldpath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newpath) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Sync() (err error) { + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Truncate(path string, length int64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Umask(newmask int) (oldmask int) { + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) + oldmask = int(r0) + return +} + +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlink(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlinkat(dirfd int, path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unmount(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func write(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + ret = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func munmap(addr uintptr, length uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readlen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writelen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s new file mode 100644 index 000000000..7c9223b64 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -0,0 +1,796 @@ +// go run mkasm.go openbsd ppc64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getgroups(SB) + RET +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setgroups(SB) + RET +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_wait4(SB) + RET +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_accept(SB) + RET +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_bind(SB) + RET +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_connect(SB) + RET +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_socket(SB) + RET +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getsockopt(SB) + RET +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setsockopt(SB) + RET +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpeername(SB) + RET +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getsockname(SB) + RET +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_shutdown(SB) + RET +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_socketpair(SB) + RET +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_recvfrom(SB) + RET +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sendto(SB) + RET +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_recvmsg(SB) + RET +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sendmsg(SB) + RET +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_kevent(SB) + RET +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_utimes(SB) + RET +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_futimes(SB) + RET +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_poll(SB) + RET +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_madvise(SB) + RET +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mlock(SB) + RET +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mlockall(SB) + RET +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mprotect(SB) + RET +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_msync(SB) + RET +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_munlock(SB) + RET +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_munlockall(SB) + RET +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pipe2(SB) + RET +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getdents(SB) + RET +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getcwd(SB) + RET +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_ioctl(SB) + RET +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sysctl(SB) + RET +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_ppoll(SB) + RET +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_access(SB) + RET +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_adjtime(SB) + RET +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chdir(SB) + RET +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chflags(SB) + RET +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chmod(SB) + RET +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chown(SB) + RET +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_chroot(SB) + RET +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_close(SB) + RET +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_dup(SB) + RET +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_dup2(SB) + RET +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_dup3(SB) + RET +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_exit(SB) + RET +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_faccessat(SB) + RET +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchdir(SB) + RET +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchflags(SB) + RET +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchmod(SB) + RET +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchmodat(SB) + RET +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchown(SB) + RET +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fchownat(SB) + RET +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_flock(SB) + RET +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fpathconf(SB) + RET +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fstat(SB) + RET +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fstatat(SB) + RET +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fstatfs(SB) + RET +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fsync(SB) + RET +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_ftruncate(SB) + RET +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getegid(SB) + RET +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_geteuid(SB) + RET +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getgid(SB) + RET +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpgid(SB) + RET +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpgrp(SB) + RET +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpid(SB) + RET +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getppid(SB) + RET +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getpriority(SB) + RET +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getrlimit(SB) + RET +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getrtable(SB) + RET +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getrusage(SB) + RET +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getsid(SB) + RET +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_gettimeofday(SB) + RET +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getuid(SB) + RET +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_issetugid(SB) + RET +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_kill(SB) + RET +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_kqueue(SB) + RET +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_lchown(SB) + RET +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_link(SB) + RET +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_linkat(SB) + RET +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_listen(SB) + RET +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_lstat(SB) + RET +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkdir(SB) + RET +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkdirat(SB) + RET +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkfifo(SB) + RET +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mkfifoat(SB) + RET +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mknod(SB) + RET +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mknodat(SB) + RET +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_nanosleep(SB) + RET +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_open(SB) + RET +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_openat(SB) + RET +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pathconf(SB) + RET +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pread(SB) + RET +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pwrite(SB) + RET +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_read(SB) + RET +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_readlink(SB) + RET +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_readlinkat(SB) + RET +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_rename(SB) + RET +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_renameat(SB) + RET +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_revoke(SB) + RET +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_rmdir(SB) + RET +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_lseek(SB) + RET +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_select(SB) + RET +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setegid(SB) + RET +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_seteuid(SB) + RET +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setgid(SB) + RET +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setlogin(SB) + RET +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setpgid(SB) + RET +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setpriority(SB) + RET +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setregid(SB) + RET +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setreuid(SB) + RET +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setresgid(SB) + RET +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setresuid(SB) + RET +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setrlimit(SB) + RET +GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setrtable(SB) + RET +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setsid(SB) + RET +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_settimeofday(SB) + RET +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_setuid(SB) + RET +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_stat(SB) + RET +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_statfs(SB) + RET +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_symlink(SB) + RET +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_symlinkat(SB) + RET +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_sync(SB) + RET +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_truncate(SB) + RET +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_umask(SB) + RET +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unlink(SB) + RET +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unlinkat(SB) + RET +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unmount(SB) + RET +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_write(SB) + RET +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_mmap(SB) + RET +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_munmap(SB) + RET +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_utimensat(SB) + RET +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go new file mode 100644 index 000000000..8e3e7873f --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -0,0 +1,2221 @@ +// go run mksyscall.go -openbsd -libc -tags openbsd,riscv64 syscall_bsd.go syscall_openbsd.go syscall_openbsd_riscv64.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build openbsd && riscv64 +// +build openbsd,riscv64 + +package unix + +import ( + "syscall" + "unsafe" +) + +var _ syscall.Errno + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getgroups(ngid int, gid *_Gid_t) (n int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgroups getgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setgroups(ngid int, gid *_Gid_t) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgroups_trampoline_addr, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgroups_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgroups setgroups "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { + r0, _, e1 := syscall_syscall6(libc_wait4_trampoline_addr, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + wpid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_wait4_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_wait4 wait4 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_accept_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_accept_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_accept accept "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_bind_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_bind_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_bind bind "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := syscall_syscall(libc_connect_trampoline_addr, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_connect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_connect connect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socket(domain int, typ int, proto int) (fd int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_socket_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socket_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socket socket "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { + _, _, e1 := syscall_syscall6(libc_getsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockopt getsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { + _, _, e1 := syscall_syscall6(libc_setsockopt_trampoline_addr, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsockopt_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsockopt setsockopt "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getpeername_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpeername_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpeername getpeername "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getsockname_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsockname_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsockname getsockname "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Shutdown(s int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_shutdown_trampoline_addr, uintptr(s), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_shutdown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_shutdown shutdown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { + _, _, e1 := syscall_rawSyscall6(libc_socketpair_trampoline_addr, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_socketpair_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_socketpair socketpair "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_recvfrom_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvfrom_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvfrom recvfrom "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sendto_trampoline_addr, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendto_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendto sendto "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_recvmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_recvmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_recvmsg recvmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_sendmsg_trampoline_addr, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sendmsg_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sendmsg sendmsg "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_kevent_trampoline_addr, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kevent_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimes(path string, timeval *[2]Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_utimes_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimes utimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func futimes(fd int, timeval *[2]Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_futimes_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_futimes_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_futimes futimes "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_poll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_poll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_poll poll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Madvise(b []byte, behav int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_madvise_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_madvise_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlock mlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlockall(flags int) (err error) { + _, _, e1 := syscall_syscall(libc_mlockall_trampoline_addr, uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mlockall mlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mprotect(b []byte, prot int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_mprotect_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mprotect_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mprotect mprotect "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Msync(b []byte, flags int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_msync_trampoline_addr, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_msync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_msync msync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall(libc_munlock_trampoline_addr, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlock munlock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlockall() (err error) { + _, _, e1 := syscall_syscall(libc_munlockall_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munlockall_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munlockall munlockall "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pipe2(p *[2]_C_int, flags int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_pipe2_trampoline_addr, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pipe2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getdents(fd int, buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getdents_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getdents_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getdents getdents "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getcwd(buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_getcwd_trampoline_addr, uintptr(_p0), uintptr(len(buf)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getcwd_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getcwd getcwd "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctl(fd int, req uint, arg uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ppoll_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ppoll ppoll "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Access(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_access_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_access_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_access access "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { + _, _, e1 := syscall_syscall(libc_adjtime_trampoline_addr, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_adjtime_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_adjtime adjtime "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chdir chdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chflags(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chflags_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chflags chflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chmod(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chmod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chmod chmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chown chown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chroot(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_chroot_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_chroot_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_chroot chroot "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Close(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_close_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_close_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_close close "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup(fd int) (nfd int, err error) { + r0, _, e1 := syscall_syscall(libc_dup_trampoline_addr, uintptr(fd), 0, 0) + nfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup dup "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup2(from int, to int) (err error) { + _, _, e1 := syscall_syscall(libc_dup2_trampoline_addr, uintptr(from), uintptr(to), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup2_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup2 dup2 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup3(from int, to int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_dup3_trampoline_addr, uintptr(from), uintptr(to), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_dup3_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_dup3 dup3 "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Exit(code int) { + syscall_syscall(libc_exit_trampoline_addr, uintptr(code), 0, 0) + return +} + +var libc_exit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_exit exit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_faccessat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_faccessat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_faccessat faccessat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchdir(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fchdir_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchdir fchdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchflags(fd int, flags int) (err error) { + _, _, e1 := syscall_syscall(libc_fchflags_trampoline_addr, uintptr(fd), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchflags_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchflags fchflags "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmod(fd int, mode uint32) (err error) { + _, _, e1 := syscall_syscall(libc_fchmod_trampoline_addr, uintptr(fd), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmod fchmod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchmodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchmodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchmodat fchmodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + _, _, e1 := syscall_syscall(libc_fchown_trampoline_addr, uintptr(fd), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchown fchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fchownat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fchownat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fchownat fchownat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Flock(fd int, how int) (err error) { + _, _, e1 := syscall_syscall(libc_flock_trampoline_addr, uintptr(fd), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_flock_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_flock flock "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fpathconf(fd int, name int) (val int, err error) { + r0, _, e1 := syscall_syscall(libc_fpathconf_trampoline_addr, uintptr(fd), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fpathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fpathconf fpathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstat(fd int, stat *Stat_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstat fstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_fstatat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatat fstatat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatfs(fd int, stat *Statfs_t) (err error) { + _, _, e1 := syscall_syscall(libc_fstatfs_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fstatfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fstatfs fstatfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsync(fd int) (err error) { + _, _, e1 := syscall_syscall(libc_fsync_trampoline_addr, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fsync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fsync fsync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Ftruncate(fd int, length int64) (err error) { + _, _, e1 := syscall_syscall(libc_ftruncate_trampoline_addr, uintptr(fd), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_ftruncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ftruncate ftruncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + r0, _, _ := syscall_rawSyscall(libc_getegid_trampoline_addr, 0, 0, 0) + egid = int(r0) + return +} + +var libc_getegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getegid getegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_geteuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_geteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_geteuid geteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _, _ := syscall_rawSyscall(libc_getgid_trampoline_addr, 0, 0, 0) + gid = int(r0) + return +} + +var libc_getgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getgid getgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgid(pid int) (pgid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getpgid_trampoline_addr, uintptr(pid), 0, 0) + pgid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgid getpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgrp() (pgrp int) { + r0, _, _ := syscall_rawSyscall(libc_getpgrp_trampoline_addr, 0, 0, 0) + pgrp = int(r0) + return +} + +var libc_getpgrp_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpgrp getpgrp "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpid() (pid int) { + r0, _, _ := syscall_rawSyscall(libc_getpid_trampoline_addr, 0, 0, 0) + pid = int(r0) + return +} + +var libc_getpid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpid getpid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getppid() (ppid int) { + r0, _, _ := syscall_rawSyscall(libc_getppid_trampoline_addr, 0, 0, 0) + ppid = int(r0) + return +} + +var libc_getppid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getppid getppid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpriority(which int, who int) (prio int, err error) { + r0, _, e1 := syscall_syscall(libc_getpriority_trampoline_addr, uintptr(which), uintptr(who), 0) + prio = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getpriority getpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrtable() (rtable int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getrtable_trampoline_addr, 0, 0, 0) + rtable = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrtable getrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrusage(who int, rusage *Rusage) (err error) { + _, _, e1 := syscall_rawSyscall(libc_getrusage_trampoline_addr, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getrusage_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getrusage getrusage "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_getsid_trampoline_addr, uintptr(pid), 0, 0) + sid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_getsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getsid getsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gettimeofday(tv *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_gettimeofday_trampoline_addr, uintptr(unsafe.Pointer(tv)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_gettimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _, _ := syscall_rawSyscall(libc_getuid_trampoline_addr, 0, 0, 0) + uid = int(r0) + return +} + +var libc_getuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getuid getuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Issetugid() (tainted bool) { + r0, _, _ := syscall_syscall(libc_issetugid_trampoline_addr, 0, 0, 0) + tainted = bool(r0 != 0) + return +} + +var libc_issetugid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kill(pid int, signum syscall.Signal) (err error) { + _, _, e1 := syscall_syscall(libc_kill_trampoline_addr, uintptr(pid), uintptr(signum), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kill_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kill kill "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kqueue() (fd int, err error) { + r0, _, e1 := syscall_syscall(libc_kqueue_trampoline_addr, 0, 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_kqueue_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lchown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lchown_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lchown_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lchown lchown "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Link(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_link_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_link_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_link link "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_linkat_trampoline_addr, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_linkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_linkat linkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, backlog int) (err error) { + _, _, e1 := syscall_syscall(libc_listen_trampoline_addr, uintptr(s), uintptr(backlog), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_listen_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_listen listen "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lstat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_lstat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lstat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lstat lstat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdir(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdir mkdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdirat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkdirat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkdirat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkdirat mkdirat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifo(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifo_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifo_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifo mkfifo "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifoat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mkfifoat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mkfifoat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mkfifoat mkfifoat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknod(path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_mknod_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknod_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknod mknod "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mknodat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mknodat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mknodat mknodat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Nanosleep(time *Timespec, leftover *Timespec) (err error) { + _, _, e1 := syscall_syscall(libc_nanosleep_trampoline_addr, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_nanosleep_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_nanosleep nanosleep "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Open(path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_open_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_open_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_open open "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall6(libc_openat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_openat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_openat openat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Pathconf(path string, name int) (val int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := syscall_syscall(libc_pathconf_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pathconf_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pathconf pathconf "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pread_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pread_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pread pread "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pwrite_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pwrite_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwrite pwrite "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func read(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_read_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_read read "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlink(path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_readlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlink readlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_readlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readlinkat readlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rename(from string, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rename_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rename_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rename rename "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Renameat(fromfd int, from string, tofd int, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_renameat_trampoline_addr, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_renameat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_renameat renameat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Revoke(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_revoke_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_revoke_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_revoke revoke "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rmdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_rmdir_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_rmdir_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_rmdir rmdir "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { + r0, _, e1 := syscall_syscall(libc_lseek_trampoline_addr, uintptr(fd), uintptr(offset), uintptr(whence)) + newoffset = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_lseek_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_lseek lseek "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { + r0, _, e1 := syscall_syscall6(libc_select_trampoline_addr, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_select_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_select select "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setegid(egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setegid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setegid setegid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seteuid(euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_seteuid_trampoline_addr, uintptr(euid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_seteuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_seteuid seteuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setgid(gid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setgid_trampoline_addr, uintptr(gid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setgid setgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setlogin(name string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(name) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_setlogin_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setlogin_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setlogin setlogin "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpgid(pid int, pgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setpgid_trampoline_addr, uintptr(pid), uintptr(pgid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpgid setpgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpriority(which int, who int, prio int) (err error) { + _, _, e1 := syscall_syscall(libc_setpriority_trampoline_addr, uintptr(which), uintptr(who), uintptr(prio)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setpriority_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setpriority setpriority "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setregid(rgid int, egid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setregid_trampoline_addr, uintptr(rgid), uintptr(egid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setregid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setregid setregid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setreuid(ruid int, euid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setreuid_trampoline_addr, uintptr(ruid), uintptr(euid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setreuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setreuid setreuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresgid(rgid int, egid int, sgid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresgid_trampoline_addr, uintptr(rgid), uintptr(egid), uintptr(sgid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresgid setresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresuid(ruid int, euid int, suid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setresuid_trampoline_addr, uintptr(ruid), uintptr(euid), uintptr(suid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setresuid setresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setrlimit_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrtable(rtable int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setrtable_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setrtable setrtable "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setsid() (pid int, err error) { + r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) + pid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setsid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setsid setsid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Settimeofday(tp *Timeval) (err error) { + _, _, e1 := syscall_rawSyscall(libc_settimeofday_trampoline_addr, uintptr(unsafe.Pointer(tp)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_settimeofday_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_settimeofday settimeofday "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setuid(uid int) (err error) { + _, _, e1 := syscall_rawSyscall(libc_setuid_trampoline_addr, uintptr(uid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setuid setuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Stat(path string, stat *Stat_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_stat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_stat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_stat stat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Statfs(path string, stat *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_statfs_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_statfs_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_statfs statfs "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlink(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlink symlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldpath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newpath) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_symlinkat_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_symlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_symlinkat symlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Sync() (err error) { + _, _, e1 := syscall_syscall(libc_sync_trampoline_addr, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_sync_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sync sync "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Truncate(path string, length int64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_truncate_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_truncate_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_truncate truncate "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Umask(newmask int) (oldmask int) { + r0, _, _ := syscall_syscall(libc_umask_trampoline_addr, uintptr(newmask), 0, 0) + oldmask = int(r0) + return +} + +var libc_umask_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_umask umask "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlink(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlink_trampoline_addr, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlink_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlink unlink "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlinkat(dirfd int, path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unlinkat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unlinkat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unlinkat unlinkat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unmount(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall(libc_unmount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unmount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unmount unmount "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func write(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_write_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_write write "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { + r0, _, e1 := syscall_syscall6(libc_mmap_trampoline_addr, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + ret = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func munmap(addr uintptr, length uintptr) (err error) { + _, _, e1 := syscall_syscall(libc_munmap_trampoline_addr, uintptr(addr), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_munmap_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_munmap munmap "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readlen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writelen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_utimensat_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_utimensat utimensat "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s new file mode 100644 index 000000000..7dba78927 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -0,0 +1,796 @@ +// go run mkasm.go openbsd riscv64 +// Code generated by the command above; DO NOT EDIT. + +#include "textflag.h" + +TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgroups(SB) + +GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) + +TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgroups(SB) + +GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) + +TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_wait4(SB) + +GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 +DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) + +TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_accept(SB) + +GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 +DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) + +TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_bind(SB) + +GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 +DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) + +TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_connect(SB) + +GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) + +TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socket(SB) + +GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) + +TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockopt(SB) + +GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) + +TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsockopt(SB) + +GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) + +TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpeername(SB) + +GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) + +TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsockname(SB) + +GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) + +TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_shutdown(SB) + +GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) + +TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_socketpair(SB) + +GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 +DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) + +TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvfrom(SB) + +GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) + +TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendto(SB) + +GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) + +TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_recvmsg(SB) + +GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) + +TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sendmsg(SB) + +GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) + +TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kevent(SB) + +GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) + +TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimes(SB) + +GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) + +TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_futimes(SB) + +GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 +DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) + +TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_poll(SB) + +GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) + +TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_madvise(SB) + +GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 +DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) + +TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlock(SB) + +GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) + +TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mlockall(SB) + +GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) + +TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mprotect(SB) + +GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) + +TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_msync(SB) + +GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) + +TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlock(SB) + +GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) + +TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munlockall(SB) + +GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) + +TEXT libc_pipe2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pipe2(SB) + +GLOBL ·libc_pipe2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pipe2_trampoline_addr(SB)/8, $libc_pipe2_trampoline<>(SB) + +TEXT libc_getdents_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getdents(SB) + +GLOBL ·libc_getdents_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getdents_trampoline_addr(SB)/8, $libc_getdents_trampoline<>(SB) + +TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getcwd(SB) + +GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) + +TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ioctl(SB) + +GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) + +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ppoll(SB) + +GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ppoll_trampoline_addr(SB)/8, $libc_ppoll_trampoline<>(SB) + +TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_access(SB) + +GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 +DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) + +TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_adjtime(SB) + +GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 +DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) + +TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chdir(SB) + +GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) + +TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chflags(SB) + +GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) + +TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chmod(SB) + +GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) + +TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chown(SB) + +GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) + +TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_chroot(SB) + +GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 +DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) + +TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_close(SB) + +GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 +DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) + +TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup(SB) + +GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) + +TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup2(SB) + +GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) + +TEXT libc_dup3_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_dup3(SB) + +GLOBL ·libc_dup3_trampoline_addr(SB), RODATA, $8 +DATA ·libc_dup3_trampoline_addr(SB)/8, $libc_dup3_trampoline<>(SB) + +TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_exit(SB) + +GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) + +TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_faccessat(SB) + +GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) + +TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchdir(SB) + +GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) + +TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchflags(SB) + +GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) + +TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmod(SB) + +GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) + +TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchmodat(SB) + +GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) + +TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchown(SB) + +GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) + +TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fchownat(SB) + +GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) + +TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_flock(SB) + +GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 +DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) + +TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fpathconf(SB) + +GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) + +TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstat(SB) + +GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) + +TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatat(SB) + +GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) + +TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fstatfs(SB) + +GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) + +TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fsync(SB) + +GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) + +TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_ftruncate(SB) + +GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) + +TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getegid(SB) + +GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) + +TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_geteuid(SB) + +GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) + +TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getgid(SB) + +GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) + +TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgid(SB) + +GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) + +TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpgrp(SB) + +GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) + +TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpid(SB) + +GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) + +TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getppid(SB) + +GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) + +TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getpriority(SB) + +GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) + +TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrlimit(SB) + +GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) + +TEXT libc_getrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrtable(SB) + +GLOBL ·libc_getrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrtable_trampoline_addr(SB)/8, $libc_getrtable_trampoline<>(SB) + +TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getrusage(SB) + +GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) + +TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getsid(SB) + +GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) + +TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_gettimeofday(SB) + +GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) + +TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getuid(SB) + +GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) + +TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_issetugid(SB) + +GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) + +TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kill(SB) + +GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) + +TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_kqueue(SB) + +GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 +DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) + +TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lchown(SB) + +GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) + +TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_link(SB) + +GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 +DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) + +TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_linkat(SB) + +GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) + +TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_listen(SB) + +GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 +DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) + +TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lstat(SB) + +GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) + +TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdir(SB) + +GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) + +TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkdirat(SB) + +GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) + +TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifo(SB) + +GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) + +TEXT libc_mkfifoat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mkfifoat(SB) + +GLOBL ·libc_mkfifoat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mkfifoat_trampoline_addr(SB)/8, $libc_mkfifoat_trampoline<>(SB) + +TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknod(SB) + +GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) + +TEXT libc_mknodat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mknodat(SB) + +GLOBL ·libc_mknodat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mknodat_trampoline_addr(SB)/8, $libc_mknodat_trampoline<>(SB) + +TEXT libc_nanosleep_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_nanosleep(SB) + +GLOBL ·libc_nanosleep_trampoline_addr(SB), RODATA, $8 +DATA ·libc_nanosleep_trampoline_addr(SB)/8, $libc_nanosleep_trampoline<>(SB) + +TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_open(SB) + +GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 +DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) + +TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_openat(SB) + +GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) + +TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pathconf(SB) + +GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) + +TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pread(SB) + +GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) + +TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwrite(SB) + +GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) + +TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_read(SB) + +GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 +DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) + +TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlink(SB) + +GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) + +TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readlinkat(SB) + +GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) + +TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rename(SB) + +GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) + +TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_renameat(SB) + +GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) + +TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_revoke(SB) + +GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 +DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) + +TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_rmdir(SB) + +GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 +DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) + +TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_lseek(SB) + +GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 +DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) + +TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_select(SB) + +GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 +DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) + +TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setegid(SB) + +GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) + +TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_seteuid(SB) + +GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) + +TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setgid(SB) + +GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) + +TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setlogin(SB) + +GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) + +TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpgid(SB) + +GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) + +TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setpriority(SB) + +GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) + +TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setregid(SB) + +GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) + +TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setreuid(SB) + +GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) + +TEXT libc_setresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresgid(SB) + +GLOBL ·libc_setresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresgid_trampoline_addr(SB)/8, $libc_setresgid_trampoline<>(SB) + +TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setresuid(SB) + +GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) + +TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrlimit(SB) + +GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) + +TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setrtable(SB) + +GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setrtable_trampoline_addr(SB)/8, $libc_setrtable_trampoline<>(SB) + +TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setsid(SB) + +GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) + +TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_settimeofday(SB) + +GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 +DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) + +TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setuid(SB) + +GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) + +TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_stat(SB) + +GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) + +TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_statfs(SB) + +GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 +DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) + +TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlink(SB) + +GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) + +TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_symlinkat(SB) + +GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) + +TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sync(SB) + +GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) + +TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_truncate(SB) + +GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 +DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) + +TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_umask(SB) + +GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 +DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) + +TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlink(SB) + +GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) + +TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unlinkat(SB) + +GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) + +TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unmount(SB) + +GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) + +TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_write(SB) + +GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 +DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) + +TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mmap(SB) + +GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) + +TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_munmap(SB) + +GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 +DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) + +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) + +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index fdf53f8da..91f5a2bde 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -147,6 +147,8 @@ import ( //go:cgo_import_dynamic libc_port_dissociate port_dissociate "libc.so" //go:cgo_import_dynamic libc_port_get port_get "libc.so" //go:cgo_import_dynamic libc_port_getn port_getn "libc.so" +//go:cgo_import_dynamic libc_putmsg putmsg "libc.so" +//go:cgo_import_dynamic libc_getmsg getmsg "libc.so" //go:linkname procpipe libc_pipe //go:linkname procpipe2 libc_pipe2 @@ -284,6 +286,8 @@ import ( //go:linkname procport_dissociate libc_port_dissociate //go:linkname procport_get libc_port_get //go:linkname procport_getn libc_port_getn +//go:linkname procputmsg libc_putmsg +//go:linkname procgetmsg libc_getmsg var ( procpipe, @@ -421,7 +425,9 @@ var ( procport_associate, procport_dissociate, procport_get, - procport_getn syscallFunc + procport_getn, + procputmsg, + procgetmsg syscallFunc ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2065,3 +2071,23 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { + _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) + if e1 != 0 { + err = e1 + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { + _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) + if e1 != 0 { + err = e1 + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go new file mode 100644 index 000000000..e44054470 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go @@ -0,0 +1,281 @@ +// go run mksysctl_openbsd.go +// Code generated by the command above; DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +type mibentry struct { + ctlname string + ctloid []_C_int +} + +var sysctlMib = []mibentry{ + {"ddb.console", []_C_int{9, 6}}, + {"ddb.log", []_C_int{9, 7}}, + {"ddb.max_line", []_C_int{9, 3}}, + {"ddb.max_width", []_C_int{9, 2}}, + {"ddb.panic", []_C_int{9, 5}}, + {"ddb.profile", []_C_int{9, 9}}, + {"ddb.radix", []_C_int{9, 1}}, + {"ddb.tab_stop_width", []_C_int{9, 4}}, + {"ddb.trigger", []_C_int{9, 8}}, + {"fs.posix.setuid", []_C_int{3, 1, 1}}, + {"hw.allowpowerdown", []_C_int{6, 22}}, + {"hw.byteorder", []_C_int{6, 4}}, + {"hw.cpuspeed", []_C_int{6, 12}}, + {"hw.diskcount", []_C_int{6, 10}}, + {"hw.disknames", []_C_int{6, 8}}, + {"hw.diskstats", []_C_int{6, 9}}, + {"hw.machine", []_C_int{6, 1}}, + {"hw.model", []_C_int{6, 2}}, + {"hw.ncpu", []_C_int{6, 3}}, + {"hw.ncpufound", []_C_int{6, 21}}, + {"hw.ncpuonline", []_C_int{6, 25}}, + {"hw.pagesize", []_C_int{6, 7}}, + {"hw.perfpolicy", []_C_int{6, 23}}, + {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, + {"hw.product", []_C_int{6, 15}}, + {"hw.serialno", []_C_int{6, 17}}, + {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, + {"hw.usermem", []_C_int{6, 20}}, + {"hw.uuid", []_C_int{6, 18}}, + {"hw.vendor", []_C_int{6, 14}}, + {"hw.version", []_C_int{6, 16}}, + {"kern.allowdt", []_C_int{1, 65}}, + {"kern.allowkmem", []_C_int{1, 52}}, + {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, + {"kern.boottime", []_C_int{1, 21}}, + {"kern.bufcachepercent", []_C_int{1, 72}}, + {"kern.ccpu", []_C_int{1, 45}}, + {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, + {"kern.consdev", []_C_int{1, 75}}, + {"kern.cp_time", []_C_int{1, 40}}, + {"kern.cp_time2", []_C_int{1, 71}}, + {"kern.cpustats", []_C_int{1, 85}}, + {"kern.domainname", []_C_int{1, 22}}, + {"kern.file", []_C_int{1, 73}}, + {"kern.forkstat", []_C_int{1, 42}}, + {"kern.fscale", []_C_int{1, 46}}, + {"kern.fsync", []_C_int{1, 33}}, + {"kern.global_ptrace", []_C_int{1, 81}}, + {"kern.hostid", []_C_int{1, 11}}, + {"kern.hostname", []_C_int{1, 10}}, + {"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}}, + {"kern.job_control", []_C_int{1, 19}}, + {"kern.malloc.buckets", []_C_int{1, 39, 1}}, + {"kern.malloc.kmemnames", []_C_int{1, 39, 3}}, + {"kern.maxclusters", []_C_int{1, 67}}, + {"kern.maxfiles", []_C_int{1, 7}}, + {"kern.maxlocksperuid", []_C_int{1, 70}}, + {"kern.maxpartitions", []_C_int{1, 23}}, + {"kern.maxproc", []_C_int{1, 6}}, + {"kern.maxthread", []_C_int{1, 25}}, + {"kern.maxvnodes", []_C_int{1, 5}}, + {"kern.mbstat", []_C_int{1, 59}}, + {"kern.msgbuf", []_C_int{1, 48}}, + {"kern.msgbufsize", []_C_int{1, 38}}, + {"kern.nchstats", []_C_int{1, 41}}, + {"kern.netlivelocks", []_C_int{1, 76}}, + {"kern.nfiles", []_C_int{1, 56}}, + {"kern.ngroups", []_C_int{1, 18}}, + {"kern.nosuidcoredump", []_C_int{1, 32}}, + {"kern.nprocs", []_C_int{1, 47}}, + {"kern.nthreads", []_C_int{1, 26}}, + {"kern.numvnodes", []_C_int{1, 58}}, + {"kern.osrelease", []_C_int{1, 2}}, + {"kern.osrevision", []_C_int{1, 3}}, + {"kern.ostype", []_C_int{1, 1}}, + {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, + {"kern.pool_debug", []_C_int{1, 77}}, + {"kern.posix1version", []_C_int{1, 17}}, + {"kern.proc", []_C_int{1, 66}}, + {"kern.rawpartition", []_C_int{1, 24}}, + {"kern.saved_ids", []_C_int{1, 20}}, + {"kern.securelevel", []_C_int{1, 9}}, + {"kern.seminfo", []_C_int{1, 61}}, + {"kern.shminfo", []_C_int{1, 62}}, + {"kern.somaxconn", []_C_int{1, 28}}, + {"kern.sominconn", []_C_int{1, 29}}, + {"kern.splassert", []_C_int{1, 54}}, + {"kern.stackgap_random", []_C_int{1, 50}}, + {"kern.sysvipc_info", []_C_int{1, 51}}, + {"kern.sysvmsg", []_C_int{1, 34}}, + {"kern.sysvsem", []_C_int{1, 35}}, + {"kern.sysvshm", []_C_int{1, 36}}, + {"kern.timecounter.choice", []_C_int{1, 69, 4}}, + {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, + {"kern.timecounter.tick", []_C_int{1, 69, 1}}, + {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, + {"kern.timeout_stats", []_C_int{1, 87}}, + {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, + {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, + {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, + {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, + {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, + {"kern.ttycount", []_C_int{1, 57}}, + {"kern.utc_offset", []_C_int{1, 88}}, + {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, + {"kern.watchdog.auto", []_C_int{1, 64, 2}}, + {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, + {"kern.wxabort", []_C_int{1, 74}}, + {"net.bpf.bufsize", []_C_int{4, 31, 1}}, + {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, + {"net.inet.ah.enable", []_C_int{4, 2, 51, 1}}, + {"net.inet.ah.stats", []_C_int{4, 2, 51, 2}}, + {"net.inet.carp.allow", []_C_int{4, 2, 112, 1}}, + {"net.inet.carp.log", []_C_int{4, 2, 112, 3}}, + {"net.inet.carp.preempt", []_C_int{4, 2, 112, 2}}, + {"net.inet.carp.stats", []_C_int{4, 2, 112, 4}}, + {"net.inet.divert.recvspace", []_C_int{4, 2, 258, 1}}, + {"net.inet.divert.sendspace", []_C_int{4, 2, 258, 2}}, + {"net.inet.divert.stats", []_C_int{4, 2, 258, 3}}, + {"net.inet.esp.enable", []_C_int{4, 2, 50, 1}}, + {"net.inet.esp.stats", []_C_int{4, 2, 50, 4}}, + {"net.inet.esp.udpencap", []_C_int{4, 2, 50, 2}}, + {"net.inet.esp.udpencap_port", []_C_int{4, 2, 50, 3}}, + {"net.inet.etherip.allow", []_C_int{4, 2, 97, 1}}, + {"net.inet.etherip.stats", []_C_int{4, 2, 97, 2}}, + {"net.inet.gre.allow", []_C_int{4, 2, 47, 1}}, + {"net.inet.gre.wccp", []_C_int{4, 2, 47, 2}}, + {"net.inet.icmp.bmcastecho", []_C_int{4, 2, 1, 2}}, + {"net.inet.icmp.errppslimit", []_C_int{4, 2, 1, 3}}, + {"net.inet.icmp.maskrepl", []_C_int{4, 2, 1, 1}}, + {"net.inet.icmp.rediraccept", []_C_int{4, 2, 1, 4}}, + {"net.inet.icmp.redirtimeout", []_C_int{4, 2, 1, 5}}, + {"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}}, + {"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}}, + {"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}}, + {"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}}, + {"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}}, + {"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}}, + {"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}}, + {"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}}, + {"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}}, + {"net.inet.ip.ifq.drops", []_C_int{4, 2, 0, 30, 3}}, + {"net.inet.ip.ifq.len", []_C_int{4, 2, 0, 30, 1}}, + {"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}}, + {"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}}, + {"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}}, + {"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}}, + {"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}}, + {"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}}, + {"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}}, + {"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}}, + {"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}}, + {"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}}, + {"net.inet.ip.multipath", []_C_int{4, 2, 0, 32}}, + {"net.inet.ip.portfirst", []_C_int{4, 2, 0, 7}}, + {"net.inet.ip.porthifirst", []_C_int{4, 2, 0, 9}}, + {"net.inet.ip.porthilast", []_C_int{4, 2, 0, 10}}, + {"net.inet.ip.portlast", []_C_int{4, 2, 0, 8}}, + {"net.inet.ip.redirect", []_C_int{4, 2, 0, 2}}, + {"net.inet.ip.sourceroute", []_C_int{4, 2, 0, 5}}, + {"net.inet.ip.stats", []_C_int{4, 2, 0, 33}}, + {"net.inet.ip.ttl", []_C_int{4, 2, 0, 3}}, + {"net.inet.ipcomp.enable", []_C_int{4, 2, 108, 1}}, + {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, + {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, + {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, + {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, + {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, + {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, + {"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}}, + {"net.inet.tcp.drop", []_C_int{4, 2, 6, 19}}, + {"net.inet.tcp.ecn", []_C_int{4, 2, 6, 14}}, + {"net.inet.tcp.ident", []_C_int{4, 2, 6, 9}}, + {"net.inet.tcp.keepidle", []_C_int{4, 2, 6, 3}}, + {"net.inet.tcp.keepinittime", []_C_int{4, 2, 6, 2}}, + {"net.inet.tcp.keepintvl", []_C_int{4, 2, 6, 4}}, + {"net.inet.tcp.mssdflt", []_C_int{4, 2, 6, 11}}, + {"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}}, + {"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}}, + {"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}}, + {"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}}, + {"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}}, + {"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}}, + {"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}}, + {"net.inet.tcp.slowhz", []_C_int{4, 2, 6, 5}}, + {"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}}, + {"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}}, + {"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}}, + {"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}}, + {"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}}, + {"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}}, + {"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}}, + {"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}}, + {"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}}, + {"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}}, + {"net.inet.udp.stats", []_C_int{4, 2, 17, 5}}, + {"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}}, + {"net.inet6.divert.sendspace", []_C_int{4, 24, 86, 2}}, + {"net.inet6.divert.stats", []_C_int{4, 24, 86, 3}}, + {"net.inet6.icmp6.errppslimit", []_C_int{4, 24, 30, 14}}, + {"net.inet6.icmp6.mtudisc_hiwat", []_C_int{4, 24, 30, 16}}, + {"net.inet6.icmp6.mtudisc_lowat", []_C_int{4, 24, 30, 17}}, + {"net.inet6.icmp6.nd6_debug", []_C_int{4, 24, 30, 18}}, + {"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}}, + {"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}}, + {"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}}, + {"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}}, + {"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}}, + {"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}}, + {"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}}, + {"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}}, + {"net.inet6.ip6.defmcasthlim", []_C_int{4, 24, 17, 18}}, + {"net.inet6.ip6.forwarding", []_C_int{4, 24, 17, 1}}, + {"net.inet6.ip6.forwsrcrt", []_C_int{4, 24, 17, 5}}, + {"net.inet6.ip6.hdrnestlimit", []_C_int{4, 24, 17, 15}}, + {"net.inet6.ip6.hlim", []_C_int{4, 24, 17, 3}}, + {"net.inet6.ip6.log_interval", []_C_int{4, 24, 17, 14}}, + {"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}}, + {"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}}, + {"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}}, + {"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}}, + {"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}}, + {"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}}, + {"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}}, + {"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}}, + {"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}}, + {"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}}, + {"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}}, + {"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}}, + {"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}}, + {"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}}, + {"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}}, + {"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}}, + {"net.key.sadb_dump", []_C_int{4, 30, 1}}, + {"net.key.spd_dump", []_C_int{4, 30, 2}}, + {"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}}, + {"net.mpls.ifq.drops", []_C_int{4, 33, 3, 3}}, + {"net.mpls.ifq.len", []_C_int{4, 33, 3, 1}}, + {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, + {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, + {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, + {"net.mpls.ttl", []_C_int{4, 33, 2}}, + {"net.pflow.stats", []_C_int{4, 34, 1}}, + {"net.pipex.enable", []_C_int{4, 35, 1}}, + {"vm.anonmin", []_C_int{2, 7}}, + {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, + {"vm.maxslp", []_C_int{2, 10}}, + {"vm.nkmempages", []_C_int{2, 6}}, + {"vm.psstrings", []_C_int{2, 3}}, + {"vm.swapencrypt.enable", []_C_int{2, 5, 0}}, + {"vm.swapencrypt.keyscreated", []_C_int{2, 5, 1}}, + {"vm.swapencrypt.keysdeleted", []_C_int{2, 5, 2}}, + {"vm.uspace", []_C_int{2, 11}}, + {"vm.uvmexp", []_C_int{2, 4}}, + {"vm.vmmeter", []_C_int{2, 1}}, + {"vm.vnodemin", []_C_int{2, 9}}, + {"vm.vtextmin", []_C_int{2, 8}}, +} diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go new file mode 100644 index 000000000..a0db82fce --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go @@ -0,0 +1,282 @@ +// go run mksysctl_openbsd.go +// Code generated by the command above; DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +type mibentry struct { + ctlname string + ctloid []_C_int +} + +var sysctlMib = []mibentry{ + {"ddb.console", []_C_int{9, 6}}, + {"ddb.log", []_C_int{9, 7}}, + {"ddb.max_line", []_C_int{9, 3}}, + {"ddb.max_width", []_C_int{9, 2}}, + {"ddb.panic", []_C_int{9, 5}}, + {"ddb.profile", []_C_int{9, 9}}, + {"ddb.radix", []_C_int{9, 1}}, + {"ddb.tab_stop_width", []_C_int{9, 4}}, + {"ddb.trigger", []_C_int{9, 8}}, + {"fs.posix.setuid", []_C_int{3, 1, 1}}, + {"hw.allowpowerdown", []_C_int{6, 22}}, + {"hw.byteorder", []_C_int{6, 4}}, + {"hw.cpuspeed", []_C_int{6, 12}}, + {"hw.diskcount", []_C_int{6, 10}}, + {"hw.disknames", []_C_int{6, 8}}, + {"hw.diskstats", []_C_int{6, 9}}, + {"hw.machine", []_C_int{6, 1}}, + {"hw.model", []_C_int{6, 2}}, + {"hw.ncpu", []_C_int{6, 3}}, + {"hw.ncpufound", []_C_int{6, 21}}, + {"hw.ncpuonline", []_C_int{6, 25}}, + {"hw.pagesize", []_C_int{6, 7}}, + {"hw.perfpolicy", []_C_int{6, 23}}, + {"hw.physmem", []_C_int{6, 19}}, + {"hw.power", []_C_int{6, 26}}, + {"hw.product", []_C_int{6, 15}}, + {"hw.serialno", []_C_int{6, 17}}, + {"hw.setperf", []_C_int{6, 13}}, + {"hw.smt", []_C_int{6, 24}}, + {"hw.usermem", []_C_int{6, 20}}, + {"hw.uuid", []_C_int{6, 18}}, + {"hw.vendor", []_C_int{6, 14}}, + {"hw.version", []_C_int{6, 16}}, + {"kern.allowdt", []_C_int{1, 65}}, + {"kern.allowkmem", []_C_int{1, 52}}, + {"kern.argmax", []_C_int{1, 8}}, + {"kern.audio", []_C_int{1, 84}}, + {"kern.boottime", []_C_int{1, 21}}, + {"kern.bufcachepercent", []_C_int{1, 72}}, + {"kern.ccpu", []_C_int{1, 45}}, + {"kern.clockrate", []_C_int{1, 12}}, + {"kern.consbuf", []_C_int{1, 83}}, + {"kern.consbufsize", []_C_int{1, 82}}, + {"kern.consdev", []_C_int{1, 75}}, + {"kern.cp_time", []_C_int{1, 40}}, + {"kern.cp_time2", []_C_int{1, 71}}, + {"kern.cpustats", []_C_int{1, 85}}, + {"kern.domainname", []_C_int{1, 22}}, + {"kern.file", []_C_int{1, 73}}, + {"kern.forkstat", []_C_int{1, 42}}, + {"kern.fscale", []_C_int{1, 46}}, + {"kern.fsync", []_C_int{1, 33}}, + {"kern.global_ptrace", []_C_int{1, 81}}, + {"kern.hostid", []_C_int{1, 11}}, + {"kern.hostname", []_C_int{1, 10}}, + {"kern.intrcnt.nintrcnt", []_C_int{1, 63, 1}}, + {"kern.job_control", []_C_int{1, 19}}, + {"kern.malloc.buckets", []_C_int{1, 39, 1}}, + {"kern.malloc.kmemnames", []_C_int{1, 39, 3}}, + {"kern.maxclusters", []_C_int{1, 67}}, + {"kern.maxfiles", []_C_int{1, 7}}, + {"kern.maxlocksperuid", []_C_int{1, 70}}, + {"kern.maxpartitions", []_C_int{1, 23}}, + {"kern.maxproc", []_C_int{1, 6}}, + {"kern.maxthread", []_C_int{1, 25}}, + {"kern.maxvnodes", []_C_int{1, 5}}, + {"kern.mbstat", []_C_int{1, 59}}, + {"kern.msgbuf", []_C_int{1, 48}}, + {"kern.msgbufsize", []_C_int{1, 38}}, + {"kern.nchstats", []_C_int{1, 41}}, + {"kern.netlivelocks", []_C_int{1, 76}}, + {"kern.nfiles", []_C_int{1, 56}}, + {"kern.ngroups", []_C_int{1, 18}}, + {"kern.nosuidcoredump", []_C_int{1, 32}}, + {"kern.nprocs", []_C_int{1, 47}}, + {"kern.nselcoll", []_C_int{1, 43}}, + {"kern.nthreads", []_C_int{1, 26}}, + {"kern.numvnodes", []_C_int{1, 58}}, + {"kern.osrelease", []_C_int{1, 2}}, + {"kern.osrevision", []_C_int{1, 3}}, + {"kern.ostype", []_C_int{1, 1}}, + {"kern.osversion", []_C_int{1, 27}}, + {"kern.pfstatus", []_C_int{1, 86}}, + {"kern.pool_debug", []_C_int{1, 77}}, + {"kern.posix1version", []_C_int{1, 17}}, + {"kern.proc", []_C_int{1, 66}}, + {"kern.rawpartition", []_C_int{1, 24}}, + {"kern.saved_ids", []_C_int{1, 20}}, + {"kern.securelevel", []_C_int{1, 9}}, + {"kern.seminfo", []_C_int{1, 61}}, + {"kern.shminfo", []_C_int{1, 62}}, + {"kern.somaxconn", []_C_int{1, 28}}, + {"kern.sominconn", []_C_int{1, 29}}, + {"kern.splassert", []_C_int{1, 54}}, + {"kern.stackgap_random", []_C_int{1, 50}}, + {"kern.sysvipc_info", []_C_int{1, 51}}, + {"kern.sysvmsg", []_C_int{1, 34}}, + {"kern.sysvsem", []_C_int{1, 35}}, + {"kern.sysvshm", []_C_int{1, 36}}, + {"kern.timecounter.choice", []_C_int{1, 69, 4}}, + {"kern.timecounter.hardware", []_C_int{1, 69, 3}}, + {"kern.timecounter.tick", []_C_int{1, 69, 1}}, + {"kern.timecounter.timestepwarnings", []_C_int{1, 69, 2}}, + {"kern.timeout_stats", []_C_int{1, 87}}, + {"kern.tty.tk_cancc", []_C_int{1, 44, 4}}, + {"kern.tty.tk_nin", []_C_int{1, 44, 1}}, + {"kern.tty.tk_nout", []_C_int{1, 44, 2}}, + {"kern.tty.tk_rawcc", []_C_int{1, 44, 3}}, + {"kern.tty.ttyinfo", []_C_int{1, 44, 5}}, + {"kern.ttycount", []_C_int{1, 57}}, + {"kern.utc_offset", []_C_int{1, 88}}, + {"kern.version", []_C_int{1, 4}}, + {"kern.video", []_C_int{1, 89}}, + {"kern.watchdog.auto", []_C_int{1, 64, 2}}, + {"kern.watchdog.period", []_C_int{1, 64, 1}}, + {"kern.witnesswatch", []_C_int{1, 53}}, + {"kern.wxabort", []_C_int{1, 74}}, + {"net.bpf.bufsize", []_C_int{4, 31, 1}}, + {"net.bpf.maxbufsize", []_C_int{4, 31, 2}}, + {"net.inet.ah.enable", []_C_int{4, 2, 51, 1}}, + {"net.inet.ah.stats", []_C_int{4, 2, 51, 2}}, + {"net.inet.carp.allow", []_C_int{4, 2, 112, 1}}, + {"net.inet.carp.log", []_C_int{4, 2, 112, 3}}, + {"net.inet.carp.preempt", []_C_int{4, 2, 112, 2}}, + {"net.inet.carp.stats", []_C_int{4, 2, 112, 4}}, + {"net.inet.divert.recvspace", []_C_int{4, 2, 258, 1}}, + {"net.inet.divert.sendspace", []_C_int{4, 2, 258, 2}}, + {"net.inet.divert.stats", []_C_int{4, 2, 258, 3}}, + {"net.inet.esp.enable", []_C_int{4, 2, 50, 1}}, + {"net.inet.esp.stats", []_C_int{4, 2, 50, 4}}, + {"net.inet.esp.udpencap", []_C_int{4, 2, 50, 2}}, + {"net.inet.esp.udpencap_port", []_C_int{4, 2, 50, 3}}, + {"net.inet.etherip.allow", []_C_int{4, 2, 97, 1}}, + {"net.inet.etherip.stats", []_C_int{4, 2, 97, 2}}, + {"net.inet.gre.allow", []_C_int{4, 2, 47, 1}}, + {"net.inet.gre.wccp", []_C_int{4, 2, 47, 2}}, + {"net.inet.icmp.bmcastecho", []_C_int{4, 2, 1, 2}}, + {"net.inet.icmp.errppslimit", []_C_int{4, 2, 1, 3}}, + {"net.inet.icmp.maskrepl", []_C_int{4, 2, 1, 1}}, + {"net.inet.icmp.rediraccept", []_C_int{4, 2, 1, 4}}, + {"net.inet.icmp.redirtimeout", []_C_int{4, 2, 1, 5}}, + {"net.inet.icmp.stats", []_C_int{4, 2, 1, 7}}, + {"net.inet.icmp.tstamprepl", []_C_int{4, 2, 1, 6}}, + {"net.inet.igmp.stats", []_C_int{4, 2, 2, 1}}, + {"net.inet.ip.arpdown", []_C_int{4, 2, 0, 40}}, + {"net.inet.ip.arpqueued", []_C_int{4, 2, 0, 36}}, + {"net.inet.ip.arptimeout", []_C_int{4, 2, 0, 39}}, + {"net.inet.ip.encdebug", []_C_int{4, 2, 0, 12}}, + {"net.inet.ip.forwarding", []_C_int{4, 2, 0, 1}}, + {"net.inet.ip.ifq.congestion", []_C_int{4, 2, 0, 30, 4}}, + {"net.inet.ip.ifq.drops", []_C_int{4, 2, 0, 30, 3}}, + {"net.inet.ip.ifq.len", []_C_int{4, 2, 0, 30, 1}}, + {"net.inet.ip.ifq.maxlen", []_C_int{4, 2, 0, 30, 2}}, + {"net.inet.ip.maxqueue", []_C_int{4, 2, 0, 11}}, + {"net.inet.ip.mforwarding", []_C_int{4, 2, 0, 31}}, + {"net.inet.ip.mrtmfc", []_C_int{4, 2, 0, 37}}, + {"net.inet.ip.mrtproto", []_C_int{4, 2, 0, 34}}, + {"net.inet.ip.mrtstats", []_C_int{4, 2, 0, 35}}, + {"net.inet.ip.mrtvif", []_C_int{4, 2, 0, 38}}, + {"net.inet.ip.mtu", []_C_int{4, 2, 0, 4}}, + {"net.inet.ip.mtudisc", []_C_int{4, 2, 0, 27}}, + {"net.inet.ip.mtudisctimeout", []_C_int{4, 2, 0, 28}}, + {"net.inet.ip.multipath", []_C_int{4, 2, 0, 32}}, + {"net.inet.ip.portfirst", []_C_int{4, 2, 0, 7}}, + {"net.inet.ip.porthifirst", []_C_int{4, 2, 0, 9}}, + {"net.inet.ip.porthilast", []_C_int{4, 2, 0, 10}}, + {"net.inet.ip.portlast", []_C_int{4, 2, 0, 8}}, + {"net.inet.ip.redirect", []_C_int{4, 2, 0, 2}}, + {"net.inet.ip.sourceroute", []_C_int{4, 2, 0, 5}}, + {"net.inet.ip.stats", []_C_int{4, 2, 0, 33}}, + {"net.inet.ip.ttl", []_C_int{4, 2, 0, 3}}, + {"net.inet.ipcomp.enable", []_C_int{4, 2, 108, 1}}, + {"net.inet.ipcomp.stats", []_C_int{4, 2, 108, 2}}, + {"net.inet.ipip.allow", []_C_int{4, 2, 4, 1}}, + {"net.inet.ipip.stats", []_C_int{4, 2, 4, 2}}, + {"net.inet.pfsync.stats", []_C_int{4, 2, 240, 1}}, + {"net.inet.tcp.ackonpush", []_C_int{4, 2, 6, 13}}, + {"net.inet.tcp.always_keepalive", []_C_int{4, 2, 6, 22}}, + {"net.inet.tcp.baddynamic", []_C_int{4, 2, 6, 6}}, + {"net.inet.tcp.drop", []_C_int{4, 2, 6, 19}}, + {"net.inet.tcp.ecn", []_C_int{4, 2, 6, 14}}, + {"net.inet.tcp.ident", []_C_int{4, 2, 6, 9}}, + {"net.inet.tcp.keepidle", []_C_int{4, 2, 6, 3}}, + {"net.inet.tcp.keepinittime", []_C_int{4, 2, 6, 2}}, + {"net.inet.tcp.keepintvl", []_C_int{4, 2, 6, 4}}, + {"net.inet.tcp.mssdflt", []_C_int{4, 2, 6, 11}}, + {"net.inet.tcp.reasslimit", []_C_int{4, 2, 6, 18}}, + {"net.inet.tcp.rfc1323", []_C_int{4, 2, 6, 1}}, + {"net.inet.tcp.rfc3390", []_C_int{4, 2, 6, 17}}, + {"net.inet.tcp.rootonly", []_C_int{4, 2, 6, 24}}, + {"net.inet.tcp.rstppslimit", []_C_int{4, 2, 6, 12}}, + {"net.inet.tcp.sack", []_C_int{4, 2, 6, 10}}, + {"net.inet.tcp.sackholelimit", []_C_int{4, 2, 6, 20}}, + {"net.inet.tcp.slowhz", []_C_int{4, 2, 6, 5}}, + {"net.inet.tcp.stats", []_C_int{4, 2, 6, 21}}, + {"net.inet.tcp.synbucketlimit", []_C_int{4, 2, 6, 16}}, + {"net.inet.tcp.syncachelimit", []_C_int{4, 2, 6, 15}}, + {"net.inet.tcp.synhashsize", []_C_int{4, 2, 6, 25}}, + {"net.inet.tcp.synuselimit", []_C_int{4, 2, 6, 23}}, + {"net.inet.udp.baddynamic", []_C_int{4, 2, 17, 2}}, + {"net.inet.udp.checksum", []_C_int{4, 2, 17, 1}}, + {"net.inet.udp.recvspace", []_C_int{4, 2, 17, 3}}, + {"net.inet.udp.rootonly", []_C_int{4, 2, 17, 6}}, + {"net.inet.udp.sendspace", []_C_int{4, 2, 17, 4}}, + {"net.inet.udp.stats", []_C_int{4, 2, 17, 5}}, + {"net.inet6.divert.recvspace", []_C_int{4, 24, 86, 1}}, + {"net.inet6.divert.sendspace", []_C_int{4, 24, 86, 2}}, + {"net.inet6.divert.stats", []_C_int{4, 24, 86, 3}}, + {"net.inet6.icmp6.errppslimit", []_C_int{4, 24, 30, 14}}, + {"net.inet6.icmp6.mtudisc_hiwat", []_C_int{4, 24, 30, 16}}, + {"net.inet6.icmp6.mtudisc_lowat", []_C_int{4, 24, 30, 17}}, + {"net.inet6.icmp6.nd6_debug", []_C_int{4, 24, 30, 18}}, + {"net.inet6.icmp6.nd6_delay", []_C_int{4, 24, 30, 8}}, + {"net.inet6.icmp6.nd6_maxnudhint", []_C_int{4, 24, 30, 15}}, + {"net.inet6.icmp6.nd6_mmaxtries", []_C_int{4, 24, 30, 10}}, + {"net.inet6.icmp6.nd6_umaxtries", []_C_int{4, 24, 30, 9}}, + {"net.inet6.icmp6.redirtimeout", []_C_int{4, 24, 30, 3}}, + {"net.inet6.ip6.auto_flowlabel", []_C_int{4, 24, 17, 17}}, + {"net.inet6.ip6.dad_count", []_C_int{4, 24, 17, 16}}, + {"net.inet6.ip6.dad_pending", []_C_int{4, 24, 17, 49}}, + {"net.inet6.ip6.defmcasthlim", []_C_int{4, 24, 17, 18}}, + {"net.inet6.ip6.forwarding", []_C_int{4, 24, 17, 1}}, + {"net.inet6.ip6.forwsrcrt", []_C_int{4, 24, 17, 5}}, + {"net.inet6.ip6.hdrnestlimit", []_C_int{4, 24, 17, 15}}, + {"net.inet6.ip6.hlim", []_C_int{4, 24, 17, 3}}, + {"net.inet6.ip6.log_interval", []_C_int{4, 24, 17, 14}}, + {"net.inet6.ip6.maxdynroutes", []_C_int{4, 24, 17, 48}}, + {"net.inet6.ip6.maxfragpackets", []_C_int{4, 24, 17, 9}}, + {"net.inet6.ip6.maxfrags", []_C_int{4, 24, 17, 41}}, + {"net.inet6.ip6.mforwarding", []_C_int{4, 24, 17, 42}}, + {"net.inet6.ip6.mrtmfc", []_C_int{4, 24, 17, 53}}, + {"net.inet6.ip6.mrtmif", []_C_int{4, 24, 17, 52}}, + {"net.inet6.ip6.mrtproto", []_C_int{4, 24, 17, 8}}, + {"net.inet6.ip6.mtudisctimeout", []_C_int{4, 24, 17, 50}}, + {"net.inet6.ip6.multicast_mtudisc", []_C_int{4, 24, 17, 44}}, + {"net.inet6.ip6.multipath", []_C_int{4, 24, 17, 43}}, + {"net.inet6.ip6.neighborgcthresh", []_C_int{4, 24, 17, 45}}, + {"net.inet6.ip6.redirect", []_C_int{4, 24, 17, 2}}, + {"net.inet6.ip6.soiikey", []_C_int{4, 24, 17, 54}}, + {"net.inet6.ip6.sourcecheck", []_C_int{4, 24, 17, 10}}, + {"net.inet6.ip6.sourcecheck_logint", []_C_int{4, 24, 17, 11}}, + {"net.inet6.ip6.use_deprecated", []_C_int{4, 24, 17, 21}}, + {"net.key.sadb_dump", []_C_int{4, 30, 1}}, + {"net.key.spd_dump", []_C_int{4, 30, 2}}, + {"net.mpls.ifq.congestion", []_C_int{4, 33, 3, 4}}, + {"net.mpls.ifq.drops", []_C_int{4, 33, 3, 3}}, + {"net.mpls.ifq.len", []_C_int{4, 33, 3, 1}}, + {"net.mpls.ifq.maxlen", []_C_int{4, 33, 3, 2}}, + {"net.mpls.mapttl_ip", []_C_int{4, 33, 5}}, + {"net.mpls.mapttl_ip6", []_C_int{4, 33, 6}}, + {"net.mpls.ttl", []_C_int{4, 33, 2}}, + {"net.pflow.stats", []_C_int{4, 34, 1}}, + {"net.pipex.enable", []_C_int{4, 35, 1}}, + {"vm.anonmin", []_C_int{2, 7}}, + {"vm.loadavg", []_C_int{2, 2}}, + {"vm.malloc_conf", []_C_int{2, 12}}, + {"vm.maxslp", []_C_int{2, 10}}, + {"vm.nkmempages", []_C_int{2, 6}}, + {"vm.psstrings", []_C_int{2, 3}}, + {"vm.swapencrypt.enable", []_C_int{2, 5, 0}}, + {"vm.swapencrypt.keyscreated", []_C_int{2, 5, 1}}, + {"vm.swapencrypt.keysdeleted", []_C_int{2, 5, 2}}, + {"vm.uspace", []_C_int{2, 11}}, + {"vm.uvmexp", []_C_int{2, 4}}, + {"vm.vmmeter", []_C_int{2, 1}}, + {"vm.vnodemin", []_C_int{2, 9}}, + {"vm.vtextmin", []_C_int{2, 8}}, +} diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go new file mode 100644 index 000000000..f258cfa24 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go @@ -0,0 +1,218 @@ +// go run mksysnum.go https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +const ( + SYS_EXIT = 1 // { void sys_exit(int rval); } + SYS_FORK = 2 // { int sys_fork(void); } + SYS_READ = 3 // { ssize_t sys_read(int fd, void *buf, size_t nbyte); } + SYS_WRITE = 4 // { ssize_t sys_write(int fd, const void *buf, size_t nbyte); } + SYS_OPEN = 5 // { int sys_open(const char *path, int flags, ... mode_t mode); } + SYS_CLOSE = 6 // { int sys_close(int fd); } + SYS_GETENTROPY = 7 // { int sys_getentropy(void *buf, size_t nbyte); } + SYS___TFORK = 8 // { int sys___tfork(const struct __tfork *param, size_t psize); } + SYS_LINK = 9 // { int sys_link(const char *path, const char *link); } + SYS_UNLINK = 10 // { int sys_unlink(const char *path); } + SYS_WAIT4 = 11 // { pid_t sys_wait4(pid_t pid, int *status, int options, struct rusage *rusage); } + SYS_CHDIR = 12 // { int sys_chdir(const char *path); } + SYS_FCHDIR = 13 // { int sys_fchdir(int fd); } + SYS_MKNOD = 14 // { int sys_mknod(const char *path, mode_t mode, dev_t dev); } + SYS_CHMOD = 15 // { int sys_chmod(const char *path, mode_t mode); } + SYS_CHOWN = 16 // { int sys_chown(const char *path, uid_t uid, gid_t gid); } + SYS_OBREAK = 17 // { int sys_obreak(char *nsize); } break + SYS_GETDTABLECOUNT = 18 // { int sys_getdtablecount(void); } + SYS_GETRUSAGE = 19 // { int sys_getrusage(int who, struct rusage *rusage); } + SYS_GETPID = 20 // { pid_t sys_getpid(void); } + SYS_MOUNT = 21 // { int sys_mount(const char *type, const char *path, int flags, void *data); } + SYS_UNMOUNT = 22 // { int sys_unmount(const char *path, int flags); } + SYS_SETUID = 23 // { int sys_setuid(uid_t uid); } + SYS_GETUID = 24 // { uid_t sys_getuid(void); } + SYS_GETEUID = 25 // { uid_t sys_geteuid(void); } + SYS_PTRACE = 26 // { int sys_ptrace(int req, pid_t pid, caddr_t addr, int data); } + SYS_RECVMSG = 27 // { ssize_t sys_recvmsg(int s, struct msghdr *msg, int flags); } + SYS_SENDMSG = 28 // { ssize_t sys_sendmsg(int s, const struct msghdr *msg, int flags); } + SYS_RECVFROM = 29 // { ssize_t sys_recvfrom(int s, void *buf, size_t len, int flags, struct sockaddr *from, socklen_t *fromlenaddr); } + SYS_ACCEPT = 30 // { int sys_accept(int s, struct sockaddr *name, socklen_t *anamelen); } + SYS_GETPEERNAME = 31 // { int sys_getpeername(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_GETSOCKNAME = 32 // { int sys_getsockname(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_ACCESS = 33 // { int sys_access(const char *path, int amode); } + SYS_CHFLAGS = 34 // { int sys_chflags(const char *path, u_int flags); } + SYS_FCHFLAGS = 35 // { int sys_fchflags(int fd, u_int flags); } + SYS_SYNC = 36 // { void sys_sync(void); } + SYS_STAT = 38 // { int sys_stat(const char *path, struct stat *ub); } + SYS_GETPPID = 39 // { pid_t sys_getppid(void); } + SYS_LSTAT = 40 // { int sys_lstat(const char *path, struct stat *ub); } + SYS_DUP = 41 // { int sys_dup(int fd); } + SYS_FSTATAT = 42 // { int sys_fstatat(int fd, const char *path, struct stat *buf, int flag); } + SYS_GETEGID = 43 // { gid_t sys_getegid(void); } + SYS_PROFIL = 44 // { int sys_profil(caddr_t samples, size_t size, u_long offset, u_int scale); } + SYS_KTRACE = 45 // { int sys_ktrace(const char *fname, int ops, int facs, pid_t pid); } + SYS_SIGACTION = 46 // { int sys_sigaction(int signum, const struct sigaction *nsa, struct sigaction *osa); } + SYS_GETGID = 47 // { gid_t sys_getgid(void); } + SYS_SIGPROCMASK = 48 // { int sys_sigprocmask(int how, sigset_t mask); } + SYS_SETLOGIN = 50 // { int sys_setlogin(const char *namebuf); } + SYS_ACCT = 51 // { int sys_acct(const char *path); } + SYS_SIGPENDING = 52 // { int sys_sigpending(void); } + SYS_FSTAT = 53 // { int sys_fstat(int fd, struct stat *sb); } + SYS_IOCTL = 54 // { int sys_ioctl(int fd, u_long com, ... void *data); } + SYS_REBOOT = 55 // { int sys_reboot(int opt); } + SYS_REVOKE = 56 // { int sys_revoke(const char *path); } + SYS_SYMLINK = 57 // { int sys_symlink(const char *path, const char *link); } + SYS_READLINK = 58 // { ssize_t sys_readlink(const char *path, char *buf, size_t count); } + SYS_EXECVE = 59 // { int sys_execve(const char *path, char * const *argp, char * const *envp); } + SYS_UMASK = 60 // { mode_t sys_umask(mode_t newmask); } + SYS_CHROOT = 61 // { int sys_chroot(const char *path); } + SYS_GETFSSTAT = 62 // { int sys_getfsstat(struct statfs *buf, size_t bufsize, int flags); } + SYS_STATFS = 63 // { int sys_statfs(const char *path, struct statfs *buf); } + SYS_FSTATFS = 64 // { int sys_fstatfs(int fd, struct statfs *buf); } + SYS_FHSTATFS = 65 // { int sys_fhstatfs(const fhandle_t *fhp, struct statfs *buf); } + SYS_VFORK = 66 // { int sys_vfork(void); } + SYS_GETTIMEOFDAY = 67 // { int sys_gettimeofday(struct timeval *tp, struct timezone *tzp); } + SYS_SETTIMEOFDAY = 68 // { int sys_settimeofday(const struct timeval *tv, const struct timezone *tzp); } + SYS_SETITIMER = 69 // { int sys_setitimer(int which, const struct itimerval *itv, struct itimerval *oitv); } + SYS_GETITIMER = 70 // { int sys_getitimer(int which, struct itimerval *itv); } + SYS_SELECT = 71 // { int sys_select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); } + SYS_KEVENT = 72 // { int sys_kevent(int fd, const struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_MUNMAP = 73 // { int sys_munmap(void *addr, size_t len); } + SYS_MPROTECT = 74 // { int sys_mprotect(void *addr, size_t len, int prot); } + SYS_MADVISE = 75 // { int sys_madvise(void *addr, size_t len, int behav); } + SYS_UTIMES = 76 // { int sys_utimes(const char *path, const struct timeval *tptr); } + SYS_FUTIMES = 77 // { int sys_futimes(int fd, const struct timeval *tptr); } + SYS_GETGROUPS = 79 // { int sys_getgroups(int gidsetsize, gid_t *gidset); } + SYS_SETGROUPS = 80 // { int sys_setgroups(int gidsetsize, const gid_t *gidset); } + SYS_GETPGRP = 81 // { int sys_getpgrp(void); } + SYS_SETPGID = 82 // { int sys_setpgid(pid_t pid, pid_t pgid); } + SYS_FUTEX = 83 // { int sys_futex(uint32_t *f, int op, int val, const struct timespec *timeout, uint32_t *g); } + SYS_UTIMENSAT = 84 // { int sys_utimensat(int fd, const char *path, const struct timespec *times, int flag); } + SYS_FUTIMENS = 85 // { int sys_futimens(int fd, const struct timespec *times); } + SYS_KBIND = 86 // { int sys_kbind(const struct __kbind *param, size_t psize, int64_t proc_cookie); } + SYS_CLOCK_GETTIME = 87 // { int sys_clock_gettime(clockid_t clock_id, struct timespec *tp); } + SYS_CLOCK_SETTIME = 88 // { int sys_clock_settime(clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_GETRES = 89 // { int sys_clock_getres(clockid_t clock_id, struct timespec *tp); } + SYS_DUP2 = 90 // { int sys_dup2(int from, int to); } + SYS_NANOSLEEP = 91 // { int sys_nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } + SYS_FCNTL = 92 // { int sys_fcntl(int fd, int cmd, ... void *arg); } + SYS_ACCEPT4 = 93 // { int sys_accept4(int s, struct sockaddr *name, socklen_t *anamelen, int flags); } + SYS___THRSLEEP = 94 // { int sys___thrsleep(const volatile void *ident, clockid_t clock_id, const struct timespec *tp, void *lock, const int *abort); } + SYS_FSYNC = 95 // { int sys_fsync(int fd); } + SYS_SETPRIORITY = 96 // { int sys_setpriority(int which, id_t who, int prio); } + SYS_SOCKET = 97 // { int sys_socket(int domain, int type, int protocol); } + SYS_CONNECT = 98 // { int sys_connect(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_GETDENTS = 99 // { int sys_getdents(int fd, void *buf, size_t buflen); } + SYS_GETPRIORITY = 100 // { int sys_getpriority(int which, id_t who); } + SYS_PIPE2 = 101 // { int sys_pipe2(int *fdp, int flags); } + SYS_DUP3 = 102 // { int sys_dup3(int from, int to, int flags); } + SYS_SIGRETURN = 103 // { int sys_sigreturn(struct sigcontext *sigcntxp); } + SYS_BIND = 104 // { int sys_bind(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_SETSOCKOPT = 105 // { int sys_setsockopt(int s, int level, int name, const void *val, socklen_t valsize); } + SYS_LISTEN = 106 // { int sys_listen(int s, int backlog); } + SYS_CHFLAGSAT = 107 // { int sys_chflagsat(int fd, const char *path, u_int flags, int atflags); } + SYS_PLEDGE = 108 // { int sys_pledge(const char *promises, const char *execpromises); } + SYS_PPOLL = 109 // { int sys_ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *mask); } + SYS_PSELECT = 110 // { int sys_pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *mask); } + SYS_SIGSUSPEND = 111 // { int sys_sigsuspend(int mask); } + SYS_SENDSYSLOG = 112 // { int sys_sendsyslog(const char *buf, size_t nbyte, int flags); } + SYS_UNVEIL = 114 // { int sys_unveil(const char *path, const char *permissions); } + SYS_GETSOCKOPT = 118 // { int sys_getsockopt(int s, int level, int name, void *val, socklen_t *avalsize); } + SYS_THRKILL = 119 // { int sys_thrkill(pid_t tid, int signum, void *tcb); } + SYS_READV = 120 // { ssize_t sys_readv(int fd, const struct iovec *iovp, int iovcnt); } + SYS_WRITEV = 121 // { ssize_t sys_writev(int fd, const struct iovec *iovp, int iovcnt); } + SYS_KILL = 122 // { int sys_kill(int pid, int signum); } + SYS_FCHOWN = 123 // { int sys_fchown(int fd, uid_t uid, gid_t gid); } + SYS_FCHMOD = 124 // { int sys_fchmod(int fd, mode_t mode); } + SYS_SETREUID = 126 // { int sys_setreuid(uid_t ruid, uid_t euid); } + SYS_SETREGID = 127 // { int sys_setregid(gid_t rgid, gid_t egid); } + SYS_RENAME = 128 // { int sys_rename(const char *from, const char *to); } + SYS_FLOCK = 131 // { int sys_flock(int fd, int how); } + SYS_MKFIFO = 132 // { int sys_mkfifo(const char *path, mode_t mode); } + SYS_SENDTO = 133 // { ssize_t sys_sendto(int s, const void *buf, size_t len, int flags, const struct sockaddr *to, socklen_t tolen); } + SYS_SHUTDOWN = 134 // { int sys_shutdown(int s, int how); } + SYS_SOCKETPAIR = 135 // { int sys_socketpair(int domain, int type, int protocol, int *rsv); } + SYS_MKDIR = 136 // { int sys_mkdir(const char *path, mode_t mode); } + SYS_RMDIR = 137 // { int sys_rmdir(const char *path); } + SYS_ADJTIME = 140 // { int sys_adjtime(const struct timeval *delta, struct timeval *olddelta); } + SYS_GETLOGIN_R = 141 // { int sys_getlogin_r(char *namebuf, u_int namelen); } + SYS_SETSID = 147 // { int sys_setsid(void); } + SYS_QUOTACTL = 148 // { int sys_quotactl(const char *path, int cmd, int uid, char *arg); } + SYS_NFSSVC = 155 // { int sys_nfssvc(int flag, void *argp); } + SYS_GETFH = 161 // { int sys_getfh(const char *fname, fhandle_t *fhp); } + SYS_SYSARCH = 165 // { int sys_sysarch(int op, void *parms); } + SYS_PREAD = 173 // { ssize_t sys_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); } + SYS_PWRITE = 174 // { ssize_t sys_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); } + SYS_SETGID = 181 // { int sys_setgid(gid_t gid); } + SYS_SETEGID = 182 // { int sys_setegid(gid_t egid); } + SYS_SETEUID = 183 // { int sys_seteuid(uid_t euid); } + SYS_PATHCONF = 191 // { long sys_pathconf(const char *path, int name); } + SYS_FPATHCONF = 192 // { long sys_fpathconf(int fd, int name); } + SYS_SWAPCTL = 193 // { int sys_swapctl(int cmd, const void *arg, int misc); } + SYS_GETRLIMIT = 194 // { int sys_getrlimit(int which, struct rlimit *rlp); } + SYS_SETRLIMIT = 195 // { int sys_setrlimit(int which, const struct rlimit *rlp); } + SYS_MMAP = 197 // { void *sys_mmap(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_LSEEK = 199 // { off_t sys_lseek(int fd, int pad, off_t offset, int whence); } + SYS_TRUNCATE = 200 // { int sys_truncate(const char *path, int pad, off_t length); } + SYS_FTRUNCATE = 201 // { int sys_ftruncate(int fd, int pad, off_t length); } + SYS_SYSCTL = 202 // { int sys_sysctl(const int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_MLOCK = 203 // { int sys_mlock(const void *addr, size_t len); } + SYS_MUNLOCK = 204 // { int sys_munlock(const void *addr, size_t len); } + SYS_GETPGID = 207 // { pid_t sys_getpgid(pid_t pid); } + SYS_UTRACE = 209 // { int sys_utrace(const char *label, const void *addr, size_t len); } + SYS_SEMGET = 221 // { int sys_semget(key_t key, int nsems, int semflg); } + SYS_MSGGET = 225 // { int sys_msgget(key_t key, int msgflg); } + SYS_MSGSND = 226 // { int sys_msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } + SYS_MSGRCV = 227 // { int sys_msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_SHMAT = 228 // { void *sys_shmat(int shmid, const void *shmaddr, int shmflg); } + SYS_SHMDT = 230 // { int sys_shmdt(const void *shmaddr); } + SYS_MINHERIT = 250 // { int sys_minherit(void *addr, size_t len, int inherit); } + SYS_POLL = 252 // { int sys_poll(struct pollfd *fds, u_int nfds, int timeout); } + SYS_ISSETUGID = 253 // { int sys_issetugid(void); } + SYS_LCHOWN = 254 // { int sys_lchown(const char *path, uid_t uid, gid_t gid); } + SYS_GETSID = 255 // { pid_t sys_getsid(pid_t pid); } + SYS_MSYNC = 256 // { int sys_msync(void *addr, size_t len, int flags); } + SYS_PIPE = 263 // { int sys_pipe(int *fdp); } + SYS_FHOPEN = 264 // { int sys_fhopen(const fhandle_t *fhp, int flags); } + SYS_PREADV = 267 // { ssize_t sys_preadv(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_PWRITEV = 268 // { ssize_t sys_pwritev(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_KQUEUE = 269 // { int sys_kqueue(void); } + SYS_MLOCKALL = 271 // { int sys_mlockall(int flags); } + SYS_MUNLOCKALL = 272 // { int sys_munlockall(void); } + SYS_GETRESUID = 281 // { int sys_getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } + SYS_SETRESUID = 282 // { int sys_setresuid(uid_t ruid, uid_t euid, uid_t suid); } + SYS_GETRESGID = 283 // { int sys_getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } + SYS_SETRESGID = 284 // { int sys_setresgid(gid_t rgid, gid_t egid, gid_t sgid); } + SYS_MQUERY = 286 // { void *sys_mquery(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_CLOSEFROM = 287 // { int sys_closefrom(int fd); } + SYS_SIGALTSTACK = 288 // { int sys_sigaltstack(const struct sigaltstack *nss, struct sigaltstack *oss); } + SYS_SHMGET = 289 // { int sys_shmget(key_t key, size_t size, int shmflg); } + SYS_SEMOP = 290 // { int sys_semop(int semid, struct sembuf *sops, size_t nsops); } + SYS_FHSTAT = 294 // { int sys_fhstat(const fhandle_t *fhp, struct stat *sb); } + SYS___SEMCTL = 295 // { int sys___semctl(int semid, int semnum, int cmd, union semun *arg); } + SYS_SHMCTL = 296 // { int sys_shmctl(int shmid, int cmd, struct shmid_ds *buf); } + SYS_MSGCTL = 297 // { int sys_msgctl(int msqid, int cmd, struct msqid_ds *buf); } + SYS_SCHED_YIELD = 298 // { int sys_sched_yield(void); } + SYS_GETTHRID = 299 // { pid_t sys_getthrid(void); } + SYS___THRWAKEUP = 301 // { int sys___thrwakeup(const volatile void *ident, int n); } + SYS___THREXIT = 302 // { void sys___threxit(pid_t *notdead); } + SYS___THRSIGDIVERT = 303 // { int sys___thrsigdivert(sigset_t sigmask, siginfo_t *info, const struct timespec *timeout); } + SYS___GETCWD = 304 // { int sys___getcwd(char *buf, size_t len); } + SYS_ADJFREQ = 305 // { int sys_adjfreq(const int64_t *freq, int64_t *oldfreq); } + SYS_SETRTABLE = 310 // { int sys_setrtable(int rtableid); } + SYS_GETRTABLE = 311 // { int sys_getrtable(void); } + SYS_FACCESSAT = 313 // { int sys_faccessat(int fd, const char *path, int amode, int flag); } + SYS_FCHMODAT = 314 // { int sys_fchmodat(int fd, const char *path, mode_t mode, int flag); } + SYS_FCHOWNAT = 315 // { int sys_fchownat(int fd, const char *path, uid_t uid, gid_t gid, int flag); } + SYS_LINKAT = 317 // { int sys_linkat(int fd1, const char *path1, int fd2, const char *path2, int flag); } + SYS_MKDIRAT = 318 // { int sys_mkdirat(int fd, const char *path, mode_t mode); } + SYS_MKFIFOAT = 319 // { int sys_mkfifoat(int fd, const char *path, mode_t mode); } + SYS_MKNODAT = 320 // { int sys_mknodat(int fd, const char *path, mode_t mode, dev_t dev); } + SYS_OPENAT = 321 // { int sys_openat(int fd, const char *path, int flags, ... mode_t mode); } + SYS_READLINKAT = 322 // { ssize_t sys_readlinkat(int fd, const char *path, char *buf, size_t count); } + SYS_RENAMEAT = 323 // { int sys_renameat(int fromfd, const char *from, int tofd, const char *to); } + SYS_SYMLINKAT = 324 // { int sys_symlinkat(const char *path, int fd, const char *link); } + SYS_UNLINKAT = 325 // { int sys_unlinkat(int fd, const char *path, int flag); } + SYS___SET_TCB = 329 // { void sys___set_tcb(void *tcb); } + SYS___GET_TCB = 330 // { void *sys___get_tcb(void); } +) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go new file mode 100644 index 000000000..07919e0ec --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go @@ -0,0 +1,219 @@ +// go run mksysnum.go https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +// Deprecated: Use libc wrappers instead of direct syscalls. +const ( + SYS_EXIT = 1 // { void sys_exit(int rval); } + SYS_FORK = 2 // { int sys_fork(void); } + SYS_READ = 3 // { ssize_t sys_read(int fd, void *buf, size_t nbyte); } + SYS_WRITE = 4 // { ssize_t sys_write(int fd, const void *buf, size_t nbyte); } + SYS_OPEN = 5 // { int sys_open(const char *path, int flags, ... mode_t mode); } + SYS_CLOSE = 6 // { int sys_close(int fd); } + SYS_GETENTROPY = 7 // { int sys_getentropy(void *buf, size_t nbyte); } + SYS___TFORK = 8 // { int sys___tfork(const struct __tfork *param, size_t psize); } + SYS_LINK = 9 // { int sys_link(const char *path, const char *link); } + SYS_UNLINK = 10 // { int sys_unlink(const char *path); } + SYS_WAIT4 = 11 // { pid_t sys_wait4(pid_t pid, int *status, int options, struct rusage *rusage); } + SYS_CHDIR = 12 // { int sys_chdir(const char *path); } + SYS_FCHDIR = 13 // { int sys_fchdir(int fd); } + SYS_MKNOD = 14 // { int sys_mknod(const char *path, mode_t mode, dev_t dev); } + SYS_CHMOD = 15 // { int sys_chmod(const char *path, mode_t mode); } + SYS_CHOWN = 16 // { int sys_chown(const char *path, uid_t uid, gid_t gid); } + SYS_OBREAK = 17 // { int sys_obreak(char *nsize); } break + SYS_GETDTABLECOUNT = 18 // { int sys_getdtablecount(void); } + SYS_GETRUSAGE = 19 // { int sys_getrusage(int who, struct rusage *rusage); } + SYS_GETPID = 20 // { pid_t sys_getpid(void); } + SYS_MOUNT = 21 // { int sys_mount(const char *type, const char *path, int flags, void *data); } + SYS_UNMOUNT = 22 // { int sys_unmount(const char *path, int flags); } + SYS_SETUID = 23 // { int sys_setuid(uid_t uid); } + SYS_GETUID = 24 // { uid_t sys_getuid(void); } + SYS_GETEUID = 25 // { uid_t sys_geteuid(void); } + SYS_PTRACE = 26 // { int sys_ptrace(int req, pid_t pid, caddr_t addr, int data); } + SYS_RECVMSG = 27 // { ssize_t sys_recvmsg(int s, struct msghdr *msg, int flags); } + SYS_SENDMSG = 28 // { ssize_t sys_sendmsg(int s, const struct msghdr *msg, int flags); } + SYS_RECVFROM = 29 // { ssize_t sys_recvfrom(int s, void *buf, size_t len, int flags, struct sockaddr *from, socklen_t *fromlenaddr); } + SYS_ACCEPT = 30 // { int sys_accept(int s, struct sockaddr *name, socklen_t *anamelen); } + SYS_GETPEERNAME = 31 // { int sys_getpeername(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_GETSOCKNAME = 32 // { int sys_getsockname(int fdes, struct sockaddr *asa, socklen_t *alen); } + SYS_ACCESS = 33 // { int sys_access(const char *path, int amode); } + SYS_CHFLAGS = 34 // { int sys_chflags(const char *path, u_int flags); } + SYS_FCHFLAGS = 35 // { int sys_fchflags(int fd, u_int flags); } + SYS_SYNC = 36 // { void sys_sync(void); } + SYS_STAT = 38 // { int sys_stat(const char *path, struct stat *ub); } + SYS_GETPPID = 39 // { pid_t sys_getppid(void); } + SYS_LSTAT = 40 // { int sys_lstat(const char *path, struct stat *ub); } + SYS_DUP = 41 // { int sys_dup(int fd); } + SYS_FSTATAT = 42 // { int sys_fstatat(int fd, const char *path, struct stat *buf, int flag); } + SYS_GETEGID = 43 // { gid_t sys_getegid(void); } + SYS_PROFIL = 44 // { int sys_profil(caddr_t samples, size_t size, u_long offset, u_int scale); } + SYS_KTRACE = 45 // { int sys_ktrace(const char *fname, int ops, int facs, pid_t pid); } + SYS_SIGACTION = 46 // { int sys_sigaction(int signum, const struct sigaction *nsa, struct sigaction *osa); } + SYS_GETGID = 47 // { gid_t sys_getgid(void); } + SYS_SIGPROCMASK = 48 // { int sys_sigprocmask(int how, sigset_t mask); } + SYS_SETLOGIN = 50 // { int sys_setlogin(const char *namebuf); } + SYS_ACCT = 51 // { int sys_acct(const char *path); } + SYS_SIGPENDING = 52 // { int sys_sigpending(void); } + SYS_FSTAT = 53 // { int sys_fstat(int fd, struct stat *sb); } + SYS_IOCTL = 54 // { int sys_ioctl(int fd, u_long com, ... void *data); } + SYS_REBOOT = 55 // { int sys_reboot(int opt); } + SYS_REVOKE = 56 // { int sys_revoke(const char *path); } + SYS_SYMLINK = 57 // { int sys_symlink(const char *path, const char *link); } + SYS_READLINK = 58 // { ssize_t sys_readlink(const char *path, char *buf, size_t count); } + SYS_EXECVE = 59 // { int sys_execve(const char *path, char * const *argp, char * const *envp); } + SYS_UMASK = 60 // { mode_t sys_umask(mode_t newmask); } + SYS_CHROOT = 61 // { int sys_chroot(const char *path); } + SYS_GETFSSTAT = 62 // { int sys_getfsstat(struct statfs *buf, size_t bufsize, int flags); } + SYS_STATFS = 63 // { int sys_statfs(const char *path, struct statfs *buf); } + SYS_FSTATFS = 64 // { int sys_fstatfs(int fd, struct statfs *buf); } + SYS_FHSTATFS = 65 // { int sys_fhstatfs(const fhandle_t *fhp, struct statfs *buf); } + SYS_VFORK = 66 // { int sys_vfork(void); } + SYS_GETTIMEOFDAY = 67 // { int sys_gettimeofday(struct timeval *tp, struct timezone *tzp); } + SYS_SETTIMEOFDAY = 68 // { int sys_settimeofday(const struct timeval *tv, const struct timezone *tzp); } + SYS_SETITIMER = 69 // { int sys_setitimer(int which, const struct itimerval *itv, struct itimerval *oitv); } + SYS_GETITIMER = 70 // { int sys_getitimer(int which, struct itimerval *itv); } + SYS_SELECT = 71 // { int sys_select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); } + SYS_KEVENT = 72 // { int sys_kevent(int fd, const struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_MUNMAP = 73 // { int sys_munmap(void *addr, size_t len); } + SYS_MPROTECT = 74 // { int sys_mprotect(void *addr, size_t len, int prot); } + SYS_MADVISE = 75 // { int sys_madvise(void *addr, size_t len, int behav); } + SYS_UTIMES = 76 // { int sys_utimes(const char *path, const struct timeval *tptr); } + SYS_FUTIMES = 77 // { int sys_futimes(int fd, const struct timeval *tptr); } + SYS_GETGROUPS = 79 // { int sys_getgroups(int gidsetsize, gid_t *gidset); } + SYS_SETGROUPS = 80 // { int sys_setgroups(int gidsetsize, const gid_t *gidset); } + SYS_GETPGRP = 81 // { int sys_getpgrp(void); } + SYS_SETPGID = 82 // { int sys_setpgid(pid_t pid, pid_t pgid); } + SYS_FUTEX = 83 // { int sys_futex(uint32_t *f, int op, int val, const struct timespec *timeout, uint32_t *g); } + SYS_UTIMENSAT = 84 // { int sys_utimensat(int fd, const char *path, const struct timespec *times, int flag); } + SYS_FUTIMENS = 85 // { int sys_futimens(int fd, const struct timespec *times); } + SYS_KBIND = 86 // { int sys_kbind(const struct __kbind *param, size_t psize, int64_t proc_cookie); } + SYS_CLOCK_GETTIME = 87 // { int sys_clock_gettime(clockid_t clock_id, struct timespec *tp); } + SYS_CLOCK_SETTIME = 88 // { int sys_clock_settime(clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_GETRES = 89 // { int sys_clock_getres(clockid_t clock_id, struct timespec *tp); } + SYS_DUP2 = 90 // { int sys_dup2(int from, int to); } + SYS_NANOSLEEP = 91 // { int sys_nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } + SYS_FCNTL = 92 // { int sys_fcntl(int fd, int cmd, ... void *arg); } + SYS_ACCEPT4 = 93 // { int sys_accept4(int s, struct sockaddr *name, socklen_t *anamelen, int flags); } + SYS___THRSLEEP = 94 // { int sys___thrsleep(const volatile void *ident, clockid_t clock_id, const struct timespec *tp, void *lock, const int *abort); } + SYS_FSYNC = 95 // { int sys_fsync(int fd); } + SYS_SETPRIORITY = 96 // { int sys_setpriority(int which, id_t who, int prio); } + SYS_SOCKET = 97 // { int sys_socket(int domain, int type, int protocol); } + SYS_CONNECT = 98 // { int sys_connect(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_GETDENTS = 99 // { int sys_getdents(int fd, void *buf, size_t buflen); } + SYS_GETPRIORITY = 100 // { int sys_getpriority(int which, id_t who); } + SYS_PIPE2 = 101 // { int sys_pipe2(int *fdp, int flags); } + SYS_DUP3 = 102 // { int sys_dup3(int from, int to, int flags); } + SYS_SIGRETURN = 103 // { int sys_sigreturn(struct sigcontext *sigcntxp); } + SYS_BIND = 104 // { int sys_bind(int s, const struct sockaddr *name, socklen_t namelen); } + SYS_SETSOCKOPT = 105 // { int sys_setsockopt(int s, int level, int name, const void *val, socklen_t valsize); } + SYS_LISTEN = 106 // { int sys_listen(int s, int backlog); } + SYS_CHFLAGSAT = 107 // { int sys_chflagsat(int fd, const char *path, u_int flags, int atflags); } + SYS_PLEDGE = 108 // { int sys_pledge(const char *promises, const char *execpromises); } + SYS_PPOLL = 109 // { int sys_ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *mask); } + SYS_PSELECT = 110 // { int sys_pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *mask); } + SYS_SIGSUSPEND = 111 // { int sys_sigsuspend(int mask); } + SYS_SENDSYSLOG = 112 // { int sys_sendsyslog(const char *buf, size_t nbyte, int flags); } + SYS_UNVEIL = 114 // { int sys_unveil(const char *path, const char *permissions); } + SYS_GETSOCKOPT = 118 // { int sys_getsockopt(int s, int level, int name, void *val, socklen_t *avalsize); } + SYS_THRKILL = 119 // { int sys_thrkill(pid_t tid, int signum, void *tcb); } + SYS_READV = 120 // { ssize_t sys_readv(int fd, const struct iovec *iovp, int iovcnt); } + SYS_WRITEV = 121 // { ssize_t sys_writev(int fd, const struct iovec *iovp, int iovcnt); } + SYS_KILL = 122 // { int sys_kill(int pid, int signum); } + SYS_FCHOWN = 123 // { int sys_fchown(int fd, uid_t uid, gid_t gid); } + SYS_FCHMOD = 124 // { int sys_fchmod(int fd, mode_t mode); } + SYS_SETREUID = 126 // { int sys_setreuid(uid_t ruid, uid_t euid); } + SYS_SETREGID = 127 // { int sys_setregid(gid_t rgid, gid_t egid); } + SYS_RENAME = 128 // { int sys_rename(const char *from, const char *to); } + SYS_FLOCK = 131 // { int sys_flock(int fd, int how); } + SYS_MKFIFO = 132 // { int sys_mkfifo(const char *path, mode_t mode); } + SYS_SENDTO = 133 // { ssize_t sys_sendto(int s, const void *buf, size_t len, int flags, const struct sockaddr *to, socklen_t tolen); } + SYS_SHUTDOWN = 134 // { int sys_shutdown(int s, int how); } + SYS_SOCKETPAIR = 135 // { int sys_socketpair(int domain, int type, int protocol, int *rsv); } + SYS_MKDIR = 136 // { int sys_mkdir(const char *path, mode_t mode); } + SYS_RMDIR = 137 // { int sys_rmdir(const char *path); } + SYS_ADJTIME = 140 // { int sys_adjtime(const struct timeval *delta, struct timeval *olddelta); } + SYS_GETLOGIN_R = 141 // { int sys_getlogin_r(char *namebuf, u_int namelen); } + SYS_SETSID = 147 // { int sys_setsid(void); } + SYS_QUOTACTL = 148 // { int sys_quotactl(const char *path, int cmd, int uid, char *arg); } + SYS_NFSSVC = 155 // { int sys_nfssvc(int flag, void *argp); } + SYS_GETFH = 161 // { int sys_getfh(const char *fname, fhandle_t *fhp); } + SYS_SYSARCH = 165 // { int sys_sysarch(int op, void *parms); } + SYS_PREAD = 173 // { ssize_t sys_pread(int fd, void *buf, size_t nbyte, int pad, off_t offset); } + SYS_PWRITE = 174 // { ssize_t sys_pwrite(int fd, const void *buf, size_t nbyte, int pad, off_t offset); } + SYS_SETGID = 181 // { int sys_setgid(gid_t gid); } + SYS_SETEGID = 182 // { int sys_setegid(gid_t egid); } + SYS_SETEUID = 183 // { int sys_seteuid(uid_t euid); } + SYS_PATHCONF = 191 // { long sys_pathconf(const char *path, int name); } + SYS_FPATHCONF = 192 // { long sys_fpathconf(int fd, int name); } + SYS_SWAPCTL = 193 // { int sys_swapctl(int cmd, const void *arg, int misc); } + SYS_GETRLIMIT = 194 // { int sys_getrlimit(int which, struct rlimit *rlp); } + SYS_SETRLIMIT = 195 // { int sys_setrlimit(int which, const struct rlimit *rlp); } + SYS_MMAP = 197 // { void *sys_mmap(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_LSEEK = 199 // { off_t sys_lseek(int fd, int pad, off_t offset, int whence); } + SYS_TRUNCATE = 200 // { int sys_truncate(const char *path, int pad, off_t length); } + SYS_FTRUNCATE = 201 // { int sys_ftruncate(int fd, int pad, off_t length); } + SYS_SYSCTL = 202 // { int sys_sysctl(const int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_MLOCK = 203 // { int sys_mlock(const void *addr, size_t len); } + SYS_MUNLOCK = 204 // { int sys_munlock(const void *addr, size_t len); } + SYS_GETPGID = 207 // { pid_t sys_getpgid(pid_t pid); } + SYS_UTRACE = 209 // { int sys_utrace(const char *label, const void *addr, size_t len); } + SYS_SEMGET = 221 // { int sys_semget(key_t key, int nsems, int semflg); } + SYS_MSGGET = 225 // { int sys_msgget(key_t key, int msgflg); } + SYS_MSGSND = 226 // { int sys_msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } + SYS_MSGRCV = 227 // { int sys_msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_SHMAT = 228 // { void *sys_shmat(int shmid, const void *shmaddr, int shmflg); } + SYS_SHMDT = 230 // { int sys_shmdt(const void *shmaddr); } + SYS_MINHERIT = 250 // { int sys_minherit(void *addr, size_t len, int inherit); } + SYS_POLL = 252 // { int sys_poll(struct pollfd *fds, u_int nfds, int timeout); } + SYS_ISSETUGID = 253 // { int sys_issetugid(void); } + SYS_LCHOWN = 254 // { int sys_lchown(const char *path, uid_t uid, gid_t gid); } + SYS_GETSID = 255 // { pid_t sys_getsid(pid_t pid); } + SYS_MSYNC = 256 // { int sys_msync(void *addr, size_t len, int flags); } + SYS_PIPE = 263 // { int sys_pipe(int *fdp); } + SYS_FHOPEN = 264 // { int sys_fhopen(const fhandle_t *fhp, int flags); } + SYS_PREADV = 267 // { ssize_t sys_preadv(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_PWRITEV = 268 // { ssize_t sys_pwritev(int fd, const struct iovec *iovp, int iovcnt, int pad, off_t offset); } + SYS_KQUEUE = 269 // { int sys_kqueue(void); } + SYS_MLOCKALL = 271 // { int sys_mlockall(int flags); } + SYS_MUNLOCKALL = 272 // { int sys_munlockall(void); } + SYS_GETRESUID = 281 // { int sys_getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } + SYS_SETRESUID = 282 // { int sys_setresuid(uid_t ruid, uid_t euid, uid_t suid); } + SYS_GETRESGID = 283 // { int sys_getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } + SYS_SETRESGID = 284 // { int sys_setresgid(gid_t rgid, gid_t egid, gid_t sgid); } + SYS_MQUERY = 286 // { void *sys_mquery(void *addr, size_t len, int prot, int flags, int fd, long pad, off_t pos); } + SYS_CLOSEFROM = 287 // { int sys_closefrom(int fd); } + SYS_SIGALTSTACK = 288 // { int sys_sigaltstack(const struct sigaltstack *nss, struct sigaltstack *oss); } + SYS_SHMGET = 289 // { int sys_shmget(key_t key, size_t size, int shmflg); } + SYS_SEMOP = 290 // { int sys_semop(int semid, struct sembuf *sops, size_t nsops); } + SYS_FHSTAT = 294 // { int sys_fhstat(const fhandle_t *fhp, struct stat *sb); } + SYS___SEMCTL = 295 // { int sys___semctl(int semid, int semnum, int cmd, union semun *arg); } + SYS_SHMCTL = 296 // { int sys_shmctl(int shmid, int cmd, struct shmid_ds *buf); } + SYS_MSGCTL = 297 // { int sys_msgctl(int msqid, int cmd, struct msqid_ds *buf); } + SYS_SCHED_YIELD = 298 // { int sys_sched_yield(void); } + SYS_GETTHRID = 299 // { pid_t sys_getthrid(void); } + SYS___THRWAKEUP = 301 // { int sys___thrwakeup(const volatile void *ident, int n); } + SYS___THREXIT = 302 // { void sys___threxit(pid_t *notdead); } + SYS___THRSIGDIVERT = 303 // { int sys___thrsigdivert(sigset_t sigmask, siginfo_t *info, const struct timespec *timeout); } + SYS___GETCWD = 304 // { int sys___getcwd(char *buf, size_t len); } + SYS_ADJFREQ = 305 // { int sys_adjfreq(const int64_t *freq, int64_t *oldfreq); } + SYS_SETRTABLE = 310 // { int sys_setrtable(int rtableid); } + SYS_GETRTABLE = 311 // { int sys_getrtable(void); } + SYS_FACCESSAT = 313 // { int sys_faccessat(int fd, const char *path, int amode, int flag); } + SYS_FCHMODAT = 314 // { int sys_fchmodat(int fd, const char *path, mode_t mode, int flag); } + SYS_FCHOWNAT = 315 // { int sys_fchownat(int fd, const char *path, uid_t uid, gid_t gid, int flag); } + SYS_LINKAT = 317 // { int sys_linkat(int fd1, const char *path1, int fd2, const char *path2, int flag); } + SYS_MKDIRAT = 318 // { int sys_mkdirat(int fd, const char *path, mode_t mode); } + SYS_MKFIFOAT = 319 // { int sys_mkfifoat(int fd, const char *path, mode_t mode); } + SYS_MKNODAT = 320 // { int sys_mknodat(int fd, const char *path, mode_t mode, dev_t dev); } + SYS_OPENAT = 321 // { int sys_openat(int fd, const char *path, int flags, ... mode_t mode); } + SYS_READLINKAT = 322 // { ssize_t sys_readlinkat(int fd, const char *path, char *buf, size_t count); } + SYS_RENAMEAT = 323 // { int sys_renameat(int fromfd, const char *from, int tofd, const char *to); } + SYS_SYMLINKAT = 324 // { int sys_symlinkat(const char *path, int fd, const char *link); } + SYS_UNLINKAT = 325 // { int sys_unlinkat(int fd, const char *path, int flag); } + SYS___SET_TCB = 329 // { void sys___set_tcb(void *tcb); } + SYS___GET_TCB = 330 // { void *sys___get_tcb(void); } +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go index dea0c9a60..d9c78cdcb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go @@ -294,7 +294,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -312,6 +312,17 @@ type __Siginfo struct { Value [4]byte _ [32]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [4]byte + _ [32]byte +} type Sigset_t struct { Val [4]uint32 @@ -350,8 +361,8 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte - Addr *byte + Offs uintptr + Addr uintptr Len uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go index da0ea0d60..26991b165 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go @@ -291,7 +291,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -310,6 +310,18 @@ type __Siginfo struct { _ [40]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [8]byte + _ [40]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -354,8 +366,8 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte - Addr *byte + Offs uintptr + Addr uintptr Len uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go index da8f74045..f8324e7e7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go @@ -293,7 +293,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -312,6 +312,18 @@ type __Siginfo struct { _ [32]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [4]byte + _ [32]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -337,8 +349,8 @@ type FpExtendedPrecision struct { type PtraceIoDesc struct { Op int32 - Offs *byte - Addr *byte + Offs uintptr + Addr uintptr Len uint32 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go index d69988e5e..4220411f3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go @@ -291,7 +291,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -310,6 +310,18 @@ type __Siginfo struct { _ [40]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [8]byte + _ [40]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -334,8 +346,8 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte - Addr *byte + Offs uintptr + Addr uintptr Len uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go index d6fd9e883..0660fd45c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go @@ -291,7 +291,7 @@ type PtraceLwpInfoStruct struct { Flags int32 Sigmask Sigset_t Siglist Sigset_t - Siginfo __Siginfo + Siginfo __PtraceSiginfo Tdname [20]int8 Child_pid int32 Syscall_code uint32 @@ -310,6 +310,18 @@ type __Siginfo struct { _ [40]byte } +type __PtraceSiginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr uintptr + Value [8]byte + _ [40]byte +} + type Sigset_t struct { Val [4]uint32 } @@ -335,8 +347,8 @@ type FpExtendedPrecision struct{} type PtraceIoDesc struct { Op int32 - Offs *byte - Addr *byte + Offs uintptr + Addr uintptr Len uint64 } diff --git a/vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go deleted file mode 100644 index 4c485261d..000000000 --- a/vendor/golang.org/x/sys/unix/ztypes_illumos_amd64.go +++ /dev/null @@ -1,42 +0,0 @@ -// cgo -godefs types_illumos.go | go run mkpost.go -// Code generated by the command above; see README.md. DO NOT EDIT. - -//go:build amd64 && illumos -// +build amd64,illumos - -package unix - -const ( - TUNNEWPPA = 0x540001 - TUNSETPPA = 0x540002 - - I_STR = 0x5308 - I_POP = 0x5303 - I_PUSH = 0x5302 - I_LINK = 0x530c - I_UNLINK = 0x530d - I_PLINK = 0x5316 - I_PUNLINK = 0x5317 - - IF_UNITSEL = -0x7ffb8cca -) - -type strbuf struct { - Maxlen int32 - Len int32 - Buf *int8 -} - -type Strioctl struct { - Cmd int32 - Timout int32 - Len int32 - Dp *int8 -} - -type Lifreq struct { - Name [32]int8 - Lifru1 [4]byte - Type uint32 - Lifru [336]byte -} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 263604401..89c516a29 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -254,6 +254,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 8187489d1..62b4fb269 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -269,6 +269,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index d1612335f..e86b35893 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -245,6 +245,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index c28e5556b..6c6be4c91 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -248,6 +248,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 187061f9f..4982ea355 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -249,6 +249,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index 369129917..173141a67 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -250,6 +250,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 7473468d7..93ae4c516 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -251,6 +251,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index ed9448524..4e4e510ca 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -251,6 +251,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 0892a73a4..3f5ba013d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -250,6 +250,12 @@ type Sigset_t struct { const _C__NSIG = 0x80 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x3 +) + type Siginfo struct { Signo int32 Code int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index e1dd48333..71dfe7cdb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -257,6 +257,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index d9f654c7b..3a2b7f0a6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -258,6 +258,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 74acda9fe..a52d62756 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -258,6 +258,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index 50ebe69eb..dfc007d8a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -276,6 +276,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index 75b34c259..b53cb9103 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -271,6 +271,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x0 + SIG_UNBLOCK = 0x1 + SIG_SETMASK = 0x2 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index 429c3bf7d..fe0aa3547 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -253,6 +253,12 @@ type Sigset_t struct { const _C__NSIG = 0x41 +const ( + SIG_BLOCK = 0x1 + SIG_UNBLOCK = 0x2 + SIG_SETMASK = 0x4 +) + type Siginfo struct { Signo int32 Errno int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go new file mode 100644 index 000000000..d6724c010 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go @@ -0,0 +1,571 @@ +// cgo -godefs -- -fsigned-char types_openbsd.go | go run mkpost.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build ppc64 && openbsd +// +build ppc64,openbsd + +package unix + +const ( + SizeofPtr = 0x8 + SizeofShort = 0x2 + SizeofInt = 0x4 + SizeofLong = 0x8 + SizeofLongLong = 0x8 +) + +type ( + _C_short int16 + _C_int int32 + _C_long int64 + _C_long_long int64 +) + +type Timespec struct { + Sec int64 + Nsec int64 +} + +type Timeval struct { + Sec int64 + Usec int64 +} + +type Rusage struct { + Utime Timeval + Stime Timeval + Maxrss int64 + Ixrss int64 + Idrss int64 + Isrss int64 + Minflt int64 + Majflt int64 + Nswap int64 + Inblock int64 + Oublock int64 + Msgsnd int64 + Msgrcv int64 + Nsignals int64 + Nvcsw int64 + Nivcsw int64 +} + +type Rlimit struct { + Cur uint64 + Max uint64 +} + +type _Gid_t uint32 + +type Stat_t struct { + Mode uint32 + Dev int32 + Ino uint64 + Nlink uint32 + Uid uint32 + Gid uint32 + Rdev int32 + Atim Timespec + Mtim Timespec + Ctim Timespec + Size int64 + Blocks int64 + Blksize int32 + Flags uint32 + Gen uint32 + _ Timespec +} + +type Statfs_t struct { + F_flags uint32 + F_bsize uint32 + F_iosize uint32 + F_blocks uint64 + F_bfree uint64 + F_bavail int64 + F_files uint64 + F_ffree uint64 + F_favail int64 + F_syncwrites uint64 + F_syncreads uint64 + F_asyncwrites uint64 + F_asyncreads uint64 + F_fsid Fsid + F_namemax uint32 + F_owner uint32 + F_ctime uint64 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte + _ [2]byte + Mount_info [160]byte +} + +type Flock_t struct { + Start int64 + Len int64 + Pid int32 + Type int16 + Whence int16 +} + +type Dirent struct { + Fileno uint64 + Off int64 + Reclen uint16 + Type uint8 + Namlen uint8 + _ [4]uint8 + Name [256]int8 +} + +type Fsid struct { + Val [2]int32 +} + +const ( + PathMax = 0x400 +) + +type RawSockaddrInet4 struct { + Len uint8 + Family uint8 + Port uint16 + Addr [4]byte /* in_addr */ + Zero [8]int8 +} + +type RawSockaddrInet6 struct { + Len uint8 + Family uint8 + Port uint16 + Flowinfo uint32 + Addr [16]byte /* in6_addr */ + Scope_id uint32 +} + +type RawSockaddrUnix struct { + Len uint8 + Family uint8 + Path [104]int8 +} + +type RawSockaddrDatalink struct { + Len uint8 + Family uint8 + Index uint16 + Type uint8 + Nlen uint8 + Alen uint8 + Slen uint8 + Data [24]int8 +} + +type RawSockaddr struct { + Len uint8 + Family uint8 + Data [14]int8 +} + +type RawSockaddrAny struct { + Addr RawSockaddr + Pad [92]int8 +} + +type _Socklen uint32 + +type Linger struct { + Onoff int32 + Linger int32 +} + +type Iovec struct { + Base *byte + Len uint64 +} + +type IPMreq struct { + Multiaddr [4]byte /* in_addr */ + Interface [4]byte /* in_addr */ +} + +type IPv6Mreq struct { + Multiaddr [16]byte /* in6_addr */ + Interface uint32 +} + +type Msghdr struct { + Name *byte + Namelen uint32 + Iov *Iovec + Iovlen uint32 + Control *byte + Controllen uint32 + Flags int32 +} + +type Cmsghdr struct { + Len uint32 + Level int32 + Type int32 +} + +type Inet6Pktinfo struct { + Addr [16]byte /* in6_addr */ + Ifindex uint32 +} + +type IPv6MTUInfo struct { + Addr RawSockaddrInet6 + Mtu uint32 +} + +type ICMPv6Filter struct { + Filt [8]uint32 +} + +const ( + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x20 + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 +) + +const ( + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 +) + +type Kevent_t struct { + Ident uint64 + Filter int16 + Flags uint16 + Fflags uint32 + Data int64 + Udata *byte +} + +type FdSet struct { + Bits [32]uint32 +} + +const ( + SizeofIfMsghdr = 0xa8 + SizeofIfData = 0x90 + SizeofIfaMsghdr = 0x18 + SizeofIfAnnounceMsghdr = 0x1a + SizeofRtMsghdr = 0x60 + SizeofRtMetrics = 0x38 +) + +type IfMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Xflags int32 + Data IfData +} + +type IfData struct { + Type uint8 + Addrlen uint8 + Hdrlen uint8 + Link_state uint8 + Mtu uint32 + Metric uint32 + Rdomain uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Oqdrops uint64 + Noproto uint64 + Capabilities uint32 + Lastchange Timeval +} + +type IfaMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Metric int32 +} + +type IfAnnounceMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + What uint16 + Name [16]int8 +} + +type RtMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Priority uint8 + Mpls uint8 + Addrs int32 + Flags int32 + Fmask int32 + Pid int32 + Seq int32 + Errno int32 + Inits uint32 + Rmx RtMetrics +} + +type RtMetrics struct { + Pksent uint64 + Expire int64 + Locks uint32 + Mtu uint32 + Refcnt uint32 + Hopcount uint32 + Recvpipe uint32 + Sendpipe uint32 + Ssthresh uint32 + Rtt uint32 + Rttvar uint32 + Pad uint32 +} + +type Mclpool struct{} + +const ( + SizeofBpfVersion = 0x4 + SizeofBpfStat = 0x8 + SizeofBpfProgram = 0x10 + SizeofBpfInsn = 0x8 + SizeofBpfHdr = 0x18 +) + +type BpfVersion struct { + Major uint16 + Minor uint16 +} + +type BpfStat struct { + Recv uint32 + Drop uint32 +} + +type BpfProgram struct { + Len uint32 + Insns *BpfInsn +} + +type BpfInsn struct { + Code uint16 + Jt uint8 + Jf uint8 + K uint32 +} + +type BpfHdr struct { + Tstamp BpfTimeval + Caplen uint32 + Datalen uint32 + Hdrlen uint16 + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 +} + +type BpfTimeval struct { + Sec uint32 + Usec uint32 +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Cc [20]uint8 + Ispeed int32 + Ospeed int32 +} + +type Winsize struct { + Row uint16 + Col uint16 + Xpixel uint16 + Ypixel uint16 +} + +const ( + AT_FDCWD = -0x64 + AT_EACCESS = 0x1 + AT_SYMLINK_NOFOLLOW = 0x2 + AT_SYMLINK_FOLLOW = 0x4 + AT_REMOVEDIR = 0x8 +) + +type PollFd struct { + Fd int32 + Events int16 + Revents int16 +} + +const ( + POLLERR = 0x8 + POLLHUP = 0x10 + POLLIN = 0x1 + POLLNVAL = 0x20 + POLLOUT = 0x4 + POLLPRI = 0x2 + POLLRDBAND = 0x80 + POLLRDNORM = 0x40 + POLLWRBAND = 0x100 + POLLWRNORM = 0x4 +) + +type Sigset_t uint32 + +type Utsname struct { + Sysname [256]byte + Nodename [256]byte + Release [256]byte + Version [256]byte + Machine [256]byte +} + +const SizeofUvmexp = 0x158 + +type Uvmexp struct { + Pagesize int32 + Pagemask int32 + Pageshift int32 + Npages int32 + Free int32 + Active int32 + Inactive int32 + Paging int32 + Wired int32 + Zeropages int32 + Reserve_pagedaemon int32 + Reserve_kernel int32 + Unused01 int32 + Vnodepages int32 + Vtextpages int32 + Freemin int32 + Freetarg int32 + Inactarg int32 + Wiredmax int32 + Anonmin int32 + Vtextmin int32 + Vnodemin int32 + Anonminpct int32 + Vtextminpct int32 + Vnodeminpct int32 + Nswapdev int32 + Swpages int32 + Swpginuse int32 + Swpgonly int32 + Nswget int32 + Nanon int32 + Unused05 int32 + Unused06 int32 + Faults int32 + Traps int32 + Intrs int32 + Swtch int32 + Softs int32 + Syscalls int32 + Pageins int32 + Unused07 int32 + Unused08 int32 + Pgswapin int32 + Pgswapout int32 + Forks int32 + Forks_ppwait int32 + Forks_sharevm int32 + Pga_zerohit int32 + Pga_zeromiss int32 + Unused09 int32 + Fltnoram int32 + Fltnoanon int32 + Fltnoamap int32 + Fltpgwait int32 + Fltpgrele int32 + Fltrelck int32 + Fltrelckok int32 + Fltanget int32 + Fltanretry int32 + Fltamcopy int32 + Fltnamap int32 + Fltnomap int32 + Fltlget int32 + Fltget int32 + Flt_anon int32 + Flt_acow int32 + Flt_obj int32 + Flt_prcopy int32 + Flt_przero int32 + Pdwoke int32 + Pdrevs int32 + Pdswout int32 + Pdfreed int32 + Pdscans int32 + Pdanscan int32 + Pdobscan int32 + Pdreact int32 + Pdbusy int32 + Pdpageouts int32 + Pdpending int32 + Pddeact int32 + Unused11 int32 + Unused12 int32 + Unused13 int32 + Fpswtch int32 + Kmapent int32 +} + +const SizeofClockinfo = 0x10 + +type Clockinfo struct { + Hz int32 + Tick int32 + Stathz int32 + Profhz int32 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go new file mode 100644 index 000000000..ddfd27a43 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go @@ -0,0 +1,571 @@ +// cgo -godefs -- -fsigned-char types_openbsd.go | go run mkpost.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && openbsd +// +build riscv64,openbsd + +package unix + +const ( + SizeofPtr = 0x8 + SizeofShort = 0x2 + SizeofInt = 0x4 + SizeofLong = 0x8 + SizeofLongLong = 0x8 +) + +type ( + _C_short int16 + _C_int int32 + _C_long int64 + _C_long_long int64 +) + +type Timespec struct { + Sec int64 + Nsec int64 +} + +type Timeval struct { + Sec int64 + Usec int64 +} + +type Rusage struct { + Utime Timeval + Stime Timeval + Maxrss int64 + Ixrss int64 + Idrss int64 + Isrss int64 + Minflt int64 + Majflt int64 + Nswap int64 + Inblock int64 + Oublock int64 + Msgsnd int64 + Msgrcv int64 + Nsignals int64 + Nvcsw int64 + Nivcsw int64 +} + +type Rlimit struct { + Cur uint64 + Max uint64 +} + +type _Gid_t uint32 + +type Stat_t struct { + Mode uint32 + Dev int32 + Ino uint64 + Nlink uint32 + Uid uint32 + Gid uint32 + Rdev int32 + Atim Timespec + Mtim Timespec + Ctim Timespec + Size int64 + Blocks int64 + Blksize int32 + Flags uint32 + Gen uint32 + _ Timespec +} + +type Statfs_t struct { + F_flags uint32 + F_bsize uint32 + F_iosize uint32 + F_blocks uint64 + F_bfree uint64 + F_bavail int64 + F_files uint64 + F_ffree uint64 + F_favail int64 + F_syncwrites uint64 + F_syncreads uint64 + F_asyncwrites uint64 + F_asyncreads uint64 + F_fsid Fsid + F_namemax uint32 + F_owner uint32 + F_ctime uint64 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte + _ [2]byte + Mount_info [160]byte +} + +type Flock_t struct { + Start int64 + Len int64 + Pid int32 + Type int16 + Whence int16 +} + +type Dirent struct { + Fileno uint64 + Off int64 + Reclen uint16 + Type uint8 + Namlen uint8 + _ [4]uint8 + Name [256]int8 +} + +type Fsid struct { + Val [2]int32 +} + +const ( + PathMax = 0x400 +) + +type RawSockaddrInet4 struct { + Len uint8 + Family uint8 + Port uint16 + Addr [4]byte /* in_addr */ + Zero [8]int8 +} + +type RawSockaddrInet6 struct { + Len uint8 + Family uint8 + Port uint16 + Flowinfo uint32 + Addr [16]byte /* in6_addr */ + Scope_id uint32 +} + +type RawSockaddrUnix struct { + Len uint8 + Family uint8 + Path [104]int8 +} + +type RawSockaddrDatalink struct { + Len uint8 + Family uint8 + Index uint16 + Type uint8 + Nlen uint8 + Alen uint8 + Slen uint8 + Data [24]int8 +} + +type RawSockaddr struct { + Len uint8 + Family uint8 + Data [14]int8 +} + +type RawSockaddrAny struct { + Addr RawSockaddr + Pad [92]int8 +} + +type _Socklen uint32 + +type Linger struct { + Onoff int32 + Linger int32 +} + +type Iovec struct { + Base *byte + Len uint64 +} + +type IPMreq struct { + Multiaddr [4]byte /* in_addr */ + Interface [4]byte /* in_addr */ +} + +type IPv6Mreq struct { + Multiaddr [16]byte /* in6_addr */ + Interface uint32 +} + +type Msghdr struct { + Name *byte + Namelen uint32 + Iov *Iovec + Iovlen uint32 + Control *byte + Controllen uint32 + Flags int32 +} + +type Cmsghdr struct { + Len uint32 + Level int32 + Type int32 +} + +type Inet6Pktinfo struct { + Addr [16]byte /* in6_addr */ + Ifindex uint32 +} + +type IPv6MTUInfo struct { + Addr RawSockaddrInet6 + Mtu uint32 +} + +type ICMPv6Filter struct { + Filt [8]uint32 +} + +const ( + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x20 + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 +) + +const ( + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 +) + +type Kevent_t struct { + Ident uint64 + Filter int16 + Flags uint16 + Fflags uint32 + Data int64 + Udata *byte +} + +type FdSet struct { + Bits [32]uint32 +} + +const ( + SizeofIfMsghdr = 0xa8 + SizeofIfData = 0x90 + SizeofIfaMsghdr = 0x18 + SizeofIfAnnounceMsghdr = 0x1a + SizeofRtMsghdr = 0x60 + SizeofRtMetrics = 0x38 +) + +type IfMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Xflags int32 + Data IfData +} + +type IfData struct { + Type uint8 + Addrlen uint8 + Hdrlen uint8 + Link_state uint8 + Mtu uint32 + Metric uint32 + Rdomain uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Oqdrops uint64 + Noproto uint64 + Capabilities uint32 + Lastchange Timeval +} + +type IfaMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Pad1 uint8 + Pad2 uint8 + Addrs int32 + Flags int32 + Metric int32 +} + +type IfAnnounceMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + What uint16 + Name [16]int8 +} + +type RtMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Hdrlen uint16 + Index uint16 + Tableid uint16 + Priority uint8 + Mpls uint8 + Addrs int32 + Flags int32 + Fmask int32 + Pid int32 + Seq int32 + Errno int32 + Inits uint32 + Rmx RtMetrics +} + +type RtMetrics struct { + Pksent uint64 + Expire int64 + Locks uint32 + Mtu uint32 + Refcnt uint32 + Hopcount uint32 + Recvpipe uint32 + Sendpipe uint32 + Ssthresh uint32 + Rtt uint32 + Rttvar uint32 + Pad uint32 +} + +type Mclpool struct{} + +const ( + SizeofBpfVersion = 0x4 + SizeofBpfStat = 0x8 + SizeofBpfProgram = 0x10 + SizeofBpfInsn = 0x8 + SizeofBpfHdr = 0x18 +) + +type BpfVersion struct { + Major uint16 + Minor uint16 +} + +type BpfStat struct { + Recv uint32 + Drop uint32 +} + +type BpfProgram struct { + Len uint32 + Insns *BpfInsn +} + +type BpfInsn struct { + Code uint16 + Jt uint8 + Jf uint8 + K uint32 +} + +type BpfHdr struct { + Tstamp BpfTimeval + Caplen uint32 + Datalen uint32 + Hdrlen uint16 + Ifidx uint16 + Flowid uint16 + Flags uint8 + Drops uint8 +} + +type BpfTimeval struct { + Sec uint32 + Usec uint32 +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Cc [20]uint8 + Ispeed int32 + Ospeed int32 +} + +type Winsize struct { + Row uint16 + Col uint16 + Xpixel uint16 + Ypixel uint16 +} + +const ( + AT_FDCWD = -0x64 + AT_EACCESS = 0x1 + AT_SYMLINK_NOFOLLOW = 0x2 + AT_SYMLINK_FOLLOW = 0x4 + AT_REMOVEDIR = 0x8 +) + +type PollFd struct { + Fd int32 + Events int16 + Revents int16 +} + +const ( + POLLERR = 0x8 + POLLHUP = 0x10 + POLLIN = 0x1 + POLLNVAL = 0x20 + POLLOUT = 0x4 + POLLPRI = 0x2 + POLLRDBAND = 0x80 + POLLRDNORM = 0x40 + POLLWRBAND = 0x100 + POLLWRNORM = 0x4 +) + +type Sigset_t uint32 + +type Utsname struct { + Sysname [256]byte + Nodename [256]byte + Release [256]byte + Version [256]byte + Machine [256]byte +} + +const SizeofUvmexp = 0x158 + +type Uvmexp struct { + Pagesize int32 + Pagemask int32 + Pageshift int32 + Npages int32 + Free int32 + Active int32 + Inactive int32 + Paging int32 + Wired int32 + Zeropages int32 + Reserve_pagedaemon int32 + Reserve_kernel int32 + Unused01 int32 + Vnodepages int32 + Vtextpages int32 + Freemin int32 + Freetarg int32 + Inactarg int32 + Wiredmax int32 + Anonmin int32 + Vtextmin int32 + Vnodemin int32 + Anonminpct int32 + Vtextminpct int32 + Vnodeminpct int32 + Nswapdev int32 + Swpages int32 + Swpginuse int32 + Swpgonly int32 + Nswget int32 + Nanon int32 + Unused05 int32 + Unused06 int32 + Faults int32 + Traps int32 + Intrs int32 + Swtch int32 + Softs int32 + Syscalls int32 + Pageins int32 + Unused07 int32 + Unused08 int32 + Pgswapin int32 + Pgswapout int32 + Forks int32 + Forks_ppwait int32 + Forks_sharevm int32 + Pga_zerohit int32 + Pga_zeromiss int32 + Unused09 int32 + Fltnoram int32 + Fltnoanon int32 + Fltnoamap int32 + Fltpgwait int32 + Fltpgrele int32 + Fltrelck int32 + Fltrelckok int32 + Fltanget int32 + Fltanretry int32 + Fltamcopy int32 + Fltnamap int32 + Fltnomap int32 + Fltlget int32 + Fltget int32 + Flt_anon int32 + Flt_acow int32 + Flt_obj int32 + Flt_prcopy int32 + Flt_przero int32 + Pdwoke int32 + Pdrevs int32 + Pdswout int32 + Pdfreed int32 + Pdscans int32 + Pdanscan int32 + Pdobscan int32 + Pdreact int32 + Pdbusy int32 + Pdpageouts int32 + Pdpending int32 + Pddeact int32 + Unused11 int32 + Unused12 int32 + Unused13 int32 + Fpswtch int32 + Kmapent int32 +} + +const SizeofClockinfo = 0x10 + +type Clockinfo struct { + Hz int32 + Tick int32 + Stathz int32 + Profhz int32 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index c1a9b83ad..0400747c6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -480,3 +480,38 @@ const ( MOUNTEDOVER = 0x40000000 FILE_EXCEPTION = 0x60000070 ) + +const ( + TUNNEWPPA = 0x540001 + TUNSETPPA = 0x540002 + + I_STR = 0x5308 + I_POP = 0x5303 + I_PUSH = 0x5302 + I_LINK = 0x530c + I_UNLINK = 0x530d + I_PLINK = 0x5316 + I_PUNLINK = 0x5317 + + IF_UNITSEL = -0x7ffb8cca +) + +type strbuf struct { + Maxlen int32 + Len int32 + Buf *int8 +} + +type Strioctl struct { + Cmd int32 + Timout int32 + Len int32 + Dp *int8 +} + +type Lifreq struct { + Name [32]int8 + Lifru1 [4]byte + Type uint32 + Lifru [336]byte +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index 4ab638cb9..aec1efcb3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -339,7 +339,7 @@ type Statfs_t struct { Flags uint64 } -type Dirent struct { +type direntLE struct { Reclen uint16 Namlen uint16 Ino uint32 @@ -347,6 +347,15 @@ type Dirent struct { Name [256]byte } +type Dirent struct { + Ino uint64 + Off int64 + Reclen uint16 + Type uint8 + Name [256]uint8 + _ [5]byte +} + type FdSet struct { Bits [64]int32 } diff --git a/vendor/golang.org/x/text/AUTHORS b/vendor/golang.org/x/text/AUTHORS deleted file mode 100644 index 15167cd74..000000000 --- a/vendor/golang.org/x/text/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/text/CONTRIBUTORS b/vendor/golang.org/x/text/CONTRIBUTORS deleted file mode 100644 index 1c4577e96..000000000 --- a/vendor/golang.org/x/text/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go new file mode 100644 index 000000000..752cdf031 --- /dev/null +++ b/vendor/golang.org/x/text/cases/cases.go @@ -0,0 +1,162 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go + +// Package cases provides general and language-specific case mappers. +package cases // import "golang.org/x/text/cases" + +import ( + "golang.org/x/text/language" + "golang.org/x/text/transform" +) + +// References: +// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. +// - https://www.unicode.org/reports/tr29/ +// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt +// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt +// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt +// - http://userguide.icu-project.org/transforms/casemappings + +// TODO: +// - Case folding +// - Wide and Narrow? +// - Segmenter option for title casing. +// - ASCII fast paths +// - Encode Soft-Dotted property within trie somehow. + +// A Caser transforms given input to a certain case. It implements +// transform.Transformer. +// +// A Caser may be stateful and should therefore not be shared between +// goroutines. +type Caser struct { + t transform.SpanningTransformer +} + +// Bytes returns a new byte slice with the result of converting b to the case +// form implemented by c. +func (c Caser) Bytes(b []byte) []byte { + b, _, _ = transform.Bytes(c.t, b) + return b +} + +// String returns a string with the result of transforming s to the case form +// implemented by c. +func (c Caser) String(s string) string { + s, _, _ = transform.String(c.t, s) + return s +} + +// Reset resets the Caser to be reused for new input after a previous call to +// Transform. +func (c Caser) Reset() { c.t.Reset() } + +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. +func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return c.t.Transform(dst, src, atEOF) +} + +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + +// Upper returns a Caser for language-specific uppercasing. +func Upper(t language.Tag, opts ...Option) Caser { + return Caser{makeUpper(t, getOpts(opts...))} +} + +// Lower returns a Caser for language-specific lowercasing. +func Lower(t language.Tag, opts ...Option) Caser { + return Caser{makeLower(t, getOpts(opts...))} +} + +// Title returns a Caser for language-specific title casing. It uses an +// approximation of the default Unicode Word Break algorithm. +func Title(t language.Tag, opts ...Option) Caser { + return Caser{makeTitle(t, getOpts(opts...))} +} + +// Fold returns a Caser that implements Unicode case folding. The returned Caser +// is stateless and safe to use concurrently by multiple goroutines. +// +// Case folding does not normalize the input and may not preserve a normal form. +// Use the collate or search package for more convenient and linguistically +// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons +// where security aspects are a concern. +func Fold(opts ...Option) Caser { + return Caser{makeFold(getOpts(opts...))} +} + +// An Option is used to modify the behavior of a Caser. +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. + +var ( + // NoLower disables the lowercasing of non-leading letters for a title + // caser. + NoLower Option = noLower + + // Compact omits mappings in case folding for characters that would grow the + // input. (Unimplemented.) + Compact Option = compact +) + +// TODO: option to preserve a normal form, if applicable? + +type options struct { + noLower bool + simple bool + + // TODO: segmenter, max ignorable, alternative versions, etc. + + ignoreFinalSigma bool +} + +func getOpts(o ...Option) (res options) { + for _, f := range o { + res = f(res) + } + return +} + +func noLower(o options) options { + o.noLower = true + return o +} + +func compact(o options) options { + o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o +} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go new file mode 100644 index 000000000..e9aa9e193 --- /dev/null +++ b/vendor/golang.org/x/text/cases/context.go @@ -0,0 +1,376 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +// A context is used for iterating over source bytes, fetching case info and +// writing to a destination buffer. +// +// Casing operations may need more than one rune of context to decide how a rune +// should be cased. Casing implementations should call checkpoint on context +// whenever it is known to be safe to return the runes processed so far. +// +// It is recommended for implementations to not allow for more than 30 case +// ignorables as lookahead (analogous to the limit in norm) and to use state if +// unbounded lookahead is needed for cased runes. +type context struct { + dst, src []byte + atEOF bool + + pDst int // pDst points past the last written rune in dst. + pSrc int // pSrc points to the start of the currently scanned rune. + + // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. + nDst, nSrc int + err error + + sz int // size of current rune + info info // case information of currently scanned rune + + // State preserved across calls to Transform. + isMidWord bool // false if next cased letter needs to be title-cased. +} + +func (c *context) Reset() { + c.isMidWord = false +} + +// ret returns the return values for the Transform method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) ret() (nDst, nSrc int, err error) { + if c.err != nil || c.nSrc == len(c.src) { + return c.nDst, c.nSrc, c.err + } + // This point is only reached by mappers if there was no short destination + // buffer. This means that the source buffer was exhausted and that c.sz was + // set to 0 by next. + if c.atEOF && c.pSrc == len(c.src) { + return c.pDst, c.pSrc, nil + } + return c.nDst, c.nSrc, transform.ErrShortSrc +} + +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + +// checkpoint sets the return value buffer points for Transform to the current +// positions. +func (c *context) checkpoint() { + if c.err == nil { + c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz + } +} + +// unreadRune causes the last rune read by next to be reread on the next +// invocation of next. Only one unreadRune may be called after a call to next. +func (c *context) unreadRune() { + c.sz = 0 +} + +func (c *context) next() bool { + c.pSrc += c.sz + if c.pSrc == len(c.src) || c.err != nil { + c.info, c.sz = 0, 0 + return false + } + v, sz := trie.lookup(c.src[c.pSrc:]) + c.info, c.sz = info(v), sz + if c.sz == 0 { + if c.atEOF { + // A zero size means we have an incomplete rune. If we are atEOF, + // this means it is an illegal rune, which we will consume one + // byte at a time. + c.sz = 1 + } else { + c.err = transform.ErrShortSrc + return false + } + } + return true +} + +// writeBytes adds bytes to dst. +func (c *context) writeBytes(b []byte) bool { + if len(c.dst)-c.pDst < len(b) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for _, ch := range b { + c.dst[c.pDst] = ch + c.pDst++ + } + return true +} + +// writeString writes the given string to dst. +func (c *context) writeString(s string) bool { + if len(c.dst)-c.pDst < len(s) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for i := 0; i < len(s); i++ { + c.dst[c.pDst] = s[i] + c.pDst++ + } + return true +} + +// copy writes the current rune to dst. +func (c *context) copy() bool { + return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) +} + +// copyXOR copies the current rune to dst and modifies it by applying the XOR +// pattern of the case info. It is the responsibility of the caller to ensure +// that this is a rune with a XOR pattern defined. +func (c *context) copyXOR() bool { + if !c.copy() { + return false + } + if c.info&xorIndexBit == 0 { + // Fast path for 6-bit XOR pattern, which covers most cases. + c.dst[c.pDst-1] ^= byte(c.info >> xorShift) + } else { + // Interpret XOR bits as an index. + // TODO: test performance for unrolling this loop. Verify that we have + // at least two bytes and at most three. + idx := c.info >> xorShift + for p := c.pDst - 1; ; p-- { + c.dst[p] ^= xorData[idx] + idx-- + if xorData[idx] == 0 { + break + } + } + } + return true +} + +// hasPrefix returns true if src[pSrc:] starts with the given string. +func (c *context) hasPrefix(s string) bool { + b := c.src[c.pSrc:] + if len(b) < len(s) { + return false + } + for i, c := range b[:len(s)] { + if c != s[i] { + return false + } + } + return true +} + +// caseType returns an info with only the case bits, normalized to either +// cLower, cUpper, cTitle or cUncased. +func (c *context) caseType() info { + cm := c.info & 0x7 + if cm < 4 { + return cm + } + if cm >= cXORCase { + // xor the last bit of the rune with the case type bits. + b := c.src[c.pSrc+c.sz-1] + return info(b&1) ^ cm&0x3 + } + if cm == cIgnorableCased { + return cLower + } + return cUncased +} + +// lower writes the lowercase version of the current rune to dst. +func lower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + return c.writeString(e[offset : offset+nLower]) + } + return c.copy() +} + +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// upper writes the uppercase version of the current rune to dst. +func upper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + // The first special case mapping is for lower. Set n to the second. + if n == noChange { + n = 0 + } + n, e = e[1]&lengthMask, e[n:] + } + if n != noChange { + return c.writeString(e[offset : offset+n]) + } + return c.copy() +} + +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// title writes the title case version of the current rune to dst. +func title(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return c.copy() + } + if c.info&exceptionBit == 0 { + if ct == cLower { + return c.copyXOR() + } + return c.copy() + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + + nFirst := (e[1] >> lengthBits) & lengthMask + if nTitle := e[1] & lengthMask; nTitle != noChange { + if nFirst != noChange { + e = e[nFirst:] + } + return c.writeString(e[offset : offset+nTitle]) + } + if ct == cLower && nFirst != noChange { + // Use the uppercase version instead. + return c.writeString(e[offset : offset+nFirst]) + } + // Already in correct case. + return c.copy() +} + +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// foldFull writes the foldFull version of the current rune to dst. +func foldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return c.copy() + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + return c.copyXOR() + } + return c.copy() + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 { + if ct == cLower { + return c.copy() + } + n = (e[1] >> lengthBits) & lengthMask + } + return c.writeString(e[2 : 2+n]) +} + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go new file mode 100644 index 000000000..85cc434fa --- /dev/null +++ b/vendor/golang.org/x/text/cases/fold.go @@ -0,0 +1,34 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +type caseFolder struct{ transform.NopResetter } + +// caseFolder implements the Transformer interface for doing case folding. +func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + foldFull(&c) + c.checkpoint() + } + return c.ret() +} + +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { + // TODO: Special case folding, through option Language, Special/Turkic, or + // both. + // TODO: Implement Compact options. + return &caseFolder{} +} diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 000000000..2dc84b39e --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,62 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build icu +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include +#include +#include +#include +#include +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go new file mode 100644 index 000000000..87a7c3e95 --- /dev/null +++ b/vendor/golang.org/x/text/cases/info.go @@ -0,0 +1,82 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +func (c info) cccVal() info { + if c&exceptionBit != 0 { + return info(exceptions[c>>exceptionShift]) & cccMask + } + return c & cccMask +} + +func (c info) cccType() info { + ccc := c.cccVal() + if ccc <= cccZero { + return cccZero + } + return ccc +} + +// TODO: Implement full Unicode breaking algorithm: +// 1) Implement breaking in separate package. +// 2) Use the breaker here. +// 3) Compare table size and performance of using the more generic breaker. +// +// Note that we can extend the current algorithm to be much more accurate. This +// only makes sense, though, if the performance and/or space penalty of using +// the generic breaker is big. Extra data will only be needed for non-cased +// runes, which means there are sufficient bits left in the caseType. +// ICU prohibits breaking in such cases as well. + +// For the purpose of title casing we use an approximation of the Unicode Word +// Breaking algorithm defined in Annex #29: +// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. +// +// For our approximation, we group the Word Break types into the following +// categories, with associated rules: +// +// 1) Letter: +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. +// Rule: Never break between consecutive runes of this category. +// +// 2) Mid: +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). +// Rule: Don't break between Letter and Mid, but break between two Mids. +// +// 3) Break: +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. +// Rule: Always break. +// +// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in +// preventing a break between two cased letters. For now we will ignore this +// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and +// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) +// +// Note 2: the rule for Mid is very approximate, but works in most cases. To +// improve, we could store the categories in the trie value and use a FA to +// manage breaks. See TODO comment above. +// +// Note 3: according to the spec, it is possible for the Extend category to +// introduce breaks between other categories grouped in Letter. However, this +// is undesirable for our purposes. ICU prevents breaks in such cases as well. + +// isBreak returns whether this rune should introduce a break. +func (c info) isBreak() bool { + return c.cccVal() == cccBreak +} + +// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, +// Numeric, ExtendNumLet, or Extend. +func (c info) isLetter() bool { + ccc := c.cccVal() + if ccc == cccZero { + return !c.isCaseIgnorable() + } + return ccc != cccBreak +} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go new file mode 100644 index 000000000..0f7c6a14b --- /dev/null +++ b/vendor/golang.org/x/text/cases/map.go @@ -0,0 +1,816 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +// This file contains the definitions of case mappings for all supported +// languages. The rules for the language-specific tailorings were taken and +// modified from the CLDR transform definitions in common/transforms. + +import ( + "strings" + "unicode" + "unicode/utf8" + + "golang.org/x/text/internal" + "golang.org/x/text/language" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +// A mapFunc takes a context set to the current rune and writes the mapped +// version to the same context. It may advance the context to the next rune. It +// returns whether a checkpoint is possible: whether the pDst bytes written to +// dst so far won't need changing as we see more source bytes. +type mapFunc func(*context) bool + +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + +// maxIgnorable defines the maximum number of ignorables to consider for +// lookahead operations. +const maxIgnorable = 30 + +// supported lists the language tags for which we have tailorings. +const supported = "und af az el lt nl tr" + +func init() { + tags := []language.Tag{} + for _, s := range strings.Split(supported, " ") { + tags = append(tags, language.MustParse(s)) + } + matcher = internal.NewInheritanceMatcher(tags) + Supported = language.NewCoverage(tags) +} + +var ( + matcher *internal.InheritanceMatcher + + Supported language.Coverage + + // We keep the following lists separate, instead of having a single per- + // language struct, to give the compiler a chance to remove unused code. + + // Some uppercase mappers are stateless, so we can precompute the + // Transformers and save a bit on runtime allocations. + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr + } + + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} + + lowerFunc = []mapFunc{ + nil, // und + nil, // af + aztrLower, // az + nil, // el + ltLower, // lt + nil, // nl + aztrLower, // tr + } + + titleInfos = []struct { + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) + }{ + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr + } +) + +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := upperFunc[i].upper + if f == nil { + return undUpper + } + return &simpleCaser{f: f, span: upperFunc[i].span} +} + +func makeLower(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := lowerFunc[i] + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} + } + return &lowerCaser{ + first: f, + midWord: finalSigma(f), + } +} + +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + x := &titleInfos[i] + lower := x.lower + if o.noLower { + lower = (*context).copy + } else if !o.ignoreFinalSigma { + lower = finalSigma(lower) + } + return &titleCaser{ + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, + } +} + +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + +// TODO: consider a similar special case for the fast majority lower case. This +// is a bit more involved so will require some more precise benchmarking to +// justify it. + +type undUpperCaser struct{ transform.NopResetter } + +// undUpperCaser implements the Transformer interface for doing an upper case +// mapping for the root locale (und). It eliminates the need for an allocation +// as it prevents escaping by not using function pointers. +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + upper(&c) + c.checkpoint() + } + return c.ret() +} + +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +type simpleCaser struct { + context + f mapFunc + span spanFunc +} + +// simpleCaser implements the Transformer interface for doing a case operation +// on a rune-by-rune basis. +func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { + c.checkpoint() + } + return c.ret() +} + +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// lowerCaser implements the Transformer interface. The default Unicode lower +// casing requires different treatment for the first and subsequent characters +// of a word, most notably to handle the Greek final Sigma. +type lowerCaser struct { + undLowerIgnoreSigmaCaser + + context + + first, midWord mapFunc +} + +func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF} + c := &t.context + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !t.first(c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !t.midWord(c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +// titleCaser implements the Transformer interface. Title casing algorithms +// distinguish between the first letter of a word and subsequent letters of the +// same word. It uses state to avoid requiring a potentially infinite lookahead. +type titleCaser struct { + context + + // rune mappings used by the actual casing algorithms. + title mapFunc + lower mapFunc + titleSpan spanFunc + + rewrite func(*context) +} + +// Transform implements the standard Unicode title case algorithm as defined in +// Chapter 3 of The Unicode Standard: +// toTitlecase(X): Find the word boundaries in X according to Unicode Standard +// Annex #29, "Unicode Text Segmentation." For each word boundary, find the +// first cased character F following the word boundary. If F exists, map F to +// Titlecase_Mapping(F); then map all characters C between F and the following +// word boundary to Lowercase_Mapping(C). +func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.ret() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.title(c) { + break + } + c.isMidWord = true + } else if !t.lower(c) { + break + } + } else if !c.copy() { + break + } else if p.isBreak() { + c.isMidWord = false + } + + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.ret() +} + +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.retSpan() +} + +// finalSigma adds Greek final Sigma handing to another casing function. It +// determines whether a lowercased sigma should be σ or ς, by looking ahead for +// case-ignorables and a cased letters. +func finalSigma(f mapFunc) mapFunc { + return func(c *context) bool { + if !c.hasPrefix("Σ") { + return f(c) + } + return finalSigmaBody(c) + } +} + +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ + } + c.unreadRune() + return true + } + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() + } + return true +} + +// finalSigmaSpan would be the same as isLower. + +// elUpper implements Greek upper casing, which entails removing a predefined +// set of non-blocked modifiers. Note that these accents should not be removed +// for title casing! +// Example: "Οδός" -> "ΟΔΟΣ". +func elUpper(c *context) bool { + // From CLDR: + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; + + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !upper(c) { + return false + } + if !unicode.Is(unicode.Greek, r) { + return true + } + i := 0 + // Take the properties of the uppercased rune that is already written to the + // destination. This saves us the trouble of having to uppercase the + // decomposed rune again. + if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { + // Restore the destination position and process the decomposed rune. + r, sz := utf8.DecodeRune(b) + if r <= 0xFF { // See A.6.1 + return true + } + c.pDst = oldPDst + // Insert the first rune and ignore the modifiers. See A.6.2. + c.writeBytes(b[:sz]) + i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. + } + + for ; i < maxIgnorable && c.next(); i++ { + switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { + // Above and Iota Subscript + case 0x0300, // U+0300 COMBINING GRAVE ACCENT + 0x0301, // U+0301 COMBINING ACUTE ACCENT + 0x0304, // U+0304 COMBINING MACRON + 0x0306, // U+0306 COMBINING BREVE + 0x0308, // U+0308 COMBINING DIAERESIS + 0x0313, // U+0313 COMBINING COMMA ABOVE + 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE + 0x0342, // U+0342 COMBINING GREEK PERISPOMENI + 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI + // No-op. Gobble the modifier. + + default: + switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { + case cccZero: + c.unreadRune() + return true + + // We don't need to test for IotaSubscript as the only rune that + // qualifies (U+0345) was already excluded in the switch statement + // above. See A.4. + + case cccAbove: + return c.copy() + default: + // Some other modifier. We're still allowed to gobble Greek + // modifiers after this. + c.copy() + } + } + } + return i == maxIgnorable +} + +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + +func ltLower(c *context) bool { + // From CLDR: + // # Introduce an explicit dot above when lowercasing capital I's and J's + // # whenever there are more accents above. + // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) + // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I + // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J + // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK + // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE + // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE + // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE + // ::NFD(); + // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; + // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; + // ::Any-Lower(); + // ::NFC(); + + i := 0 + if r := c.src[c.pSrc]; r < utf8.RuneSelf { + lower(c) + if r != 'I' && r != 'J' { + return true + } + } else { + p := norm.NFD.Properties(c.src[c.pSrc:]) + if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { + // UTF-8 optimization: the decomposition will only have an above + // modifier if the last rune of the decomposition is in [U+300-U+311]. + // In all other cases, a decomposition starting with I is always + // an I followed by modifiers that are not cased themselves. See A.2. + if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. + if !c.writeBytes(d[:1]) { + return false + } + c.dst[c.pDst-1] += 'a' - 'A' // lower + + // Assumption: modifier never changes on lowercase. See A.1. + // Assumption: all modifiers added have CCC = Above. See A.2.3. + return c.writeString("\u0307") && c.writeBytes(d[1:]) + } + // In all other cases the additional modifiers will have a CCC + // that is less than 230 (Above). We will insert the U+0307, if + // needed, after these modifiers so that a string in FCD form + // will remain so. See A.2.2. + lower(c) + i = 1 + } else { + return lower(c) + } + } + + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + return c.writeString("\u0307") && c.copy() // See A.1. + default: + c.copy() // See A.1. + } + } + return i == maxIgnorable +} + +// ltLowerSpan would be the same as isLower. + +func ltUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // + // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. + // ::NFD(); + // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; + // ::Any-Upper(); + // ::NFC(); + + // TODO: See A.5. A soft-dotted rune never has an exception. This would + // allow us to overload the exception bit and encode this property in + // info. Need to measure performance impact of this. + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !f(c) { + return false + } + if !unicode.Is(unicode.Soft_Dotted, r) { + return true + } + + // We don't need to do an NFD normalization, as a soft-dotted rune never + // contains U+0307. See A.3. + + i := 0 + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + if c.hasPrefix("\u0307") { + // We don't do a full NFC, but rather combine runes for + // some of the common cases. (Returning NFC or + // preserving normal form is neither a requirement nor + // a possibility anyway). + if !c.next() { + return false + } + if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { + s := "" + switch c.src[c.pSrc+1] { + case 0x80: // U+0300 COMBINING GRAVE ACCENT + s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE + case 0x81: // U+0301 COMBINING ACUTE ACCENT + s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE + case 0x83: // U+0303 COMBINING TILDE + s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE + case 0x88: // U+0308 COMBINING DIAERESIS + s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS + default: + } + if s != "" { + c.pDst = oldPDst + return c.writeString(s) + } + } + } + return c.copy() + default: + c.copy() + } + } + return i == maxIgnorable + } +} + +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + +func aztrUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // i→İ; + if c.src[c.pSrc] == 'i' { + return c.writeString("İ") + } + return f(c) + } +} + +func aztrLower(c *context) (done bool) { + // From CLDR: + // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri + // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE + // İ→i; + // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. + // # This matches the behavior of the canonically equivalent I-dot_above + // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE + // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. + // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I + // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; + // I→ı ; + // ::Any-Lower(); + if c.hasPrefix("\u0130") { // İ + return c.writeString("i") + } + if c.src[c.pSrc] != 'I' { + return lower(c) + } + + // We ignore the lower-case I for now, but insert it later when we know + // which form we need. + start := c.pSrc + c.sz + + i := 0 +Loop: + // We check for up to n ignorables before \u0307. As \u0307 is an + // ignorable as well, n is maxIgnorable-1. + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccAbove: + if c.hasPrefix("\u0307") { + return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 + } + done = true + break Loop + case cccZero: + c.unreadRune() + done = true + break Loop + default: + // We'll write this rune after we know which starter to use. + } + } + if i == maxIgnorable { + done = true + } + return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done +} + +// aztrLowerSpan would be the same as isLower. + +func nlTitle(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { + return title(c) + } + + if !c.writeString("I") || !c.next() { + return false + } + if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { + return c.writeString("J") + } + c.unreadRune() + return true +} + +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + +// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078. +func afnlRewrite(c *context) { + if c.hasPrefix("'") || c.hasPrefix("’") { + c.isMidWord = true + } +} diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go new file mode 100644 index 000000000..ca9923105 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables10.0.0.go @@ -0,0 +1,2256 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.10 && !go1.13 +// +build go1.10,!go1.13 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11892 bytes (11.61 KiB). Checksum: c6f15484b7653775. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0014, 0x40a: 0x0014, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x368: 0xed, 0x369: 0xee, 0x36a: 0xef, 0x36b: 0xf0, + 0x370: 0xf1, 0x371: 0xf2, 0x372: 0xf3, 0x374: 0xf4, 0x375: 0xf5, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf6, + 0x390: 0x23, 0x391: 0xf7, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf8, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf7, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf9, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xf0, 0x469: 0xfa, 0x46b: 0xfb, 0x46c: 0xfc, 0x46d: 0xfd, 0x46e: 0xfe, + 0x47c: 0x23, 0x47d: 0xff, 0x47e: 0x100, 0x47f: 0x101, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0x102, 0x4b2: 0x103, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x104, 0x4c6: 0x105, + 0x4c9: 0x106, + 0x4d0: 0x107, 0x4d1: 0x108, 0x4d2: 0x109, 0x4d3: 0x10a, 0x4d4: 0x10b, 0x4d5: 0x10c, 0x4d6: 0x10d, 0x4d7: 0x10e, + 0x4d8: 0x10f, 0x4d9: 0x110, 0x4da: 0x111, 0x4db: 0x112, 0x4dc: 0x113, 0x4dd: 0x114, 0x4de: 0x115, 0x4df: 0x116, + 0x4e8: 0x117, 0x4e9: 0x118, 0x4ea: 0x119, + // Block 0x14, offset 0x500 + 0x500: 0x11a, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x11b, 0x524: 0x10, 0x525: 0x11c, + 0x538: 0x11d, 0x539: 0x11, 0x53a: 0x11e, + // Block 0x15, offset 0x540 + 0x544: 0x11f, 0x545: 0x120, 0x546: 0x121, + 0x54f: 0x122, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x123, 0x5c1: 0x124, 0x5c4: 0x124, 0x5c5: 0x124, 0x5c6: 0x124, 0x5c7: 0x125, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 277 entries, 554 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x54, 0x64, 0x6b, 0x70, 0x7e, 0x7f, 0x8d, 0x9c, 0xa6, 0xa9, 0xaf, 0xb7, 0xba, 0xbc, 0xca, 0xd0, 0xde, 0xe9, 0xf5, 0x100, 0x10c, 0x116, 0x122, 0x12d, 0x139, 0x145, 0x14d, 0x155, 0x15f, 0x16a, 0x176, 0x17d, 0x188, 0x18d, 0x195, 0x198, 0x19d, 0x1a1, 0x1a5, 0x1ac, 0x1b5, 0x1bd, 0x1be, 0x1c7, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e7, 0x1eb, 0x1ee, 0x1f0, 0x1f3, 0x1f8, 0x1f9, 0x1fb, 0x1fd, 0x1ff, 0x206, 0x20b, 0x20f, 0x218, 0x21b, 0x21e, 0x224, 0x225, 0x230, 0x231, 0x232, 0x237, 0x244, 0x24c, 0x254, 0x25d, 0x266, 0x26f, 0x274, 0x277, 0x280, 0x28d, 0x28f, 0x296, 0x298, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x326, 0x32d, 0x331, 0x33a, 0x33b, 0x343, 0x347, 0x34c, 0x354, 0x35a, 0x360, 0x36a, 0x36f, 0x378, 0x37e, 0x385, 0x389, 0x391, 0x393, 0x395, 0x398, 0x39a, 0x39c, 0x39d, 0x39e, 0x3a0, 0x3a2, 0x3a8, 0x3ad, 0x3af, 0x3b5, 0x3b8, 0x3ba, 0x3c0, 0x3c5, 0x3c7, 0x3c8, 0x3c9, 0x3ca, 0x3cc, 0x3ce, 0x3d0, 0x3d3, 0x3d5, 0x3d8, 0x3e0, 0x3e3, 0x3e7, 0x3ef, 0x3f1, 0x3f2, 0x3f3, 0x3f5, 0x3fb, 0x3fd, 0x3fe, 0x400, 0x402, 0x404, 0x411, 0x412, 0x413, 0x417, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x421, 0x425, 0x42b, 0x42d, 0x434, 0x437, 0x43b, 0x441, 0x44a, 0x450, 0x456, 0x460, 0x46a, 0x46c, 0x473, 0x479, 0x47f, 0x485, 0x488, 0x48e, 0x491, 0x499, 0x49a, 0x4a1, 0x4a2, 0x4a5, 0x4af, 0x4b5, 0x4bb, 0x4bc, 0x4c2, 0x4c5, 0x4cd, 0x4d4, 0x4db, 0x4dc, 0x4dd, 0x4de, 0x4df, 0x4e1, 0x4e3, 0x4e5, 0x4e9, 0x4ea, 0x4ec, 0x4ed, 0x4ee, 0x4f0, 0x4f5, 0x4fa, 0x4fe, 0x4ff, 0x502, 0x506, 0x511, 0x515, 0x51d, 0x522, 0x526, 0x529, 0x52d, 0x530, 0x533, 0x538, 0x53c, 0x540, 0x544, 0x548, 0x54a, 0x54c, 0x54f, 0x554, 0x556, 0x55b, 0x564, 0x569, 0x56a, 0x56d, 0x56e, 0x56f, 0x571, 0x572, 0x573} + +// sparseValues: 1395 entries, 5580 bytes +var sparseValues = [1395]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x54 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x64 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x6b + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x7e + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x7f + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8d + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0x9c + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xa6 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xa9 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xb7 + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x19, offset 0xba + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xbc + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xca + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xe9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x1f, offset 0xf5 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x100 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10c + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x116 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x23, offset 0x122 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x139 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x155 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x15f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16a + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x176 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x188 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a1 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1bd + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1ce + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d6 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f3 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f8 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1f9 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fb + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fd + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x1ff + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20b + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x218 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21e + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x230 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x231 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x232 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x237 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x244 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24c + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x254 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x26f + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x274 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x277 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x280 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x296 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xae}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33a + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x343 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x347 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34c + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x354 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35a + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x360 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36a + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x36f + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x378 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37e + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x385 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x391 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39a + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39d + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39e + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a2 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a8 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ad + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3af + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b5 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b8 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3ba + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3c9 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3ce + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa7, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e0 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e7 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f5 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fb + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fd + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x404 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x411 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x412 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41b + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41c + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42b + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42d + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x437 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43b + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x441 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x460 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46a + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x473 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x479 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x47f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x485 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48e + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x499 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49a + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a1 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a2 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xdc, offset 0x4af + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + // Block 0xde, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdf, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe1, offset 0x4c5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe2, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4d4 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe4, offset 0x4db + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe6, offset 0x4dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe7, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe8, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe9, offset 0x4e1 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xea, offset 0x4e3 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xeb, offset 0x4e5 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xec, offset 0x4e9 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xed, offset 0x4ea + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xee, offset 0x4ec + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xef, offset 0x4ed + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf0, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf1, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf2, offset 0x4f5 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf3, offset 0x4fa + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf4, offset 0x4fe + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf5, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf6, offset 0x502 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf7, offset 0x506 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf9, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xfa, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xfb, offset 0x522 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xfc, offset 0x526 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xfd, offset 0x529 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xfe, offset 0x52d + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xff, offset 0x530 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x533 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x101, offset 0x538 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x102, offset 0x53c + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x103, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x104, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x105, offset 0x548 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x106, offset 0x54a + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x107, offset 0x54c + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x108, offset 0x54f + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x109, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10a, offset 0x556 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x10b, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x10c, offset 0x564 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x10d, offset 0x569 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x56a + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10f, offset 0x56d + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x110, offset 0x56e + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x111, offset 0x56f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x112, offset 0x571 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x113, offset 0x572 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14177 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go new file mode 100644 index 000000000..b1106b417 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables11.0.0.go @@ -0,0 +1,2317 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.13 && !go1.14 +// +build go1.13,!go1.14 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "11.0.0" + +var xorData string = "" + // Size: 188 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a" + + "\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&" + + "\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00" + + "\x01\x22" + +var exceptions string = "" + // Size: 2436 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ" + + "\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი" + + "\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ" + + "\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ" + + "\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ" + + "\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ" + + "\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ" + + "\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12сСС\x12\x12" + + "тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗ" + + "T̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14" + + "$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ" + + "\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈ" + + "Ι\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15" + + "\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ" + + "\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ" + + "\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠι" + + "ὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧι" + + "ὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ" + + "\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ" + + "\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ" + + "\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΙ" + + "̈́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓" + + "\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x16" + + "6ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽ" + + "ɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ" + + "\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ" + + "\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl" + + "\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄ" + + "ն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12250 bytes (11.96 KiB). Checksum: 53ff6cb7321675e1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x198a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1a6a, 0x2d1: 0x1aea, + 0x2d2: 0x1b6a, 0x2d3: 0x1bea, 0x2d4: 0x1c6a, 0x2d5: 0x1cea, 0x2d6: 0x1d6a, 0x2d7: 0x1dea, + 0x2d8: 0x1e6a, 0x2d9: 0x1eea, 0x2da: 0x1f6a, 0x2db: 0x1fea, 0x2dc: 0x206a, 0x2dd: 0x20ea, + 0x2de: 0x216a, 0x2df: 0x21ea, 0x2e0: 0x226a, 0x2e1: 0x22ea, 0x2e2: 0x236a, 0x2e3: 0x23ea, + 0x2e4: 0x246a, 0x2e5: 0x24ea, 0x2e6: 0x256a, 0x2e7: 0x25ea, 0x2e8: 0x266a, 0x2e9: 0x26ea, + 0x2ea: 0x276a, 0x2eb: 0x27ea, 0x2ec: 0x286a, 0x2ed: 0x28ea, 0x2ee: 0x296a, 0x2ef: 0x29ea, + 0x2f0: 0x2a6a, 0x2f1: 0x2aea, 0x2f2: 0x2b6a, 0x2f3: 0x2bea, 0x2f4: 0x2c6a, 0x2f5: 0x2cea, + 0x2f6: 0x2d6a, 0x2f7: 0x2dea, 0x2f8: 0x2e6a, 0x2f9: 0x2eea, 0x2fa: 0x2f6a, + 0x2fc: 0x0014, 0x2fd: 0x2fea, 0x2fe: 0x306a, 0x2ff: 0x30ea, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3a9a, 0x311: 0x0812, + 0x312: 0x3b7a, 0x313: 0x0812, 0x314: 0x3cba, 0x315: 0x0812, 0x316: 0x3dfa, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x8e52, 0x331: 0x8e52, 0x332: 0x9152, 0x333: 0x9152, 0x334: 0x9452, 0x335: 0x9452, + 0x336: 0x9752, 0x337: 0x9752, 0x338: 0x9a52, 0x339: 0x9a52, 0x33a: 0x9d52, 0x33b: 0x9d52, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3f3a, 0x341: 0x402a, 0x342: 0x411a, 0x343: 0x420a, 0x344: 0x42fa, 0x345: 0x43ea, + 0x346: 0x44da, 0x347: 0x45ca, 0x348: 0x46b9, 0x349: 0x47a9, 0x34a: 0x4899, 0x34b: 0x4989, + 0x34c: 0x4a79, 0x34d: 0x4b69, 0x34e: 0x4c59, 0x34f: 0x4d49, 0x350: 0x4e3a, 0x351: 0x4f2a, + 0x352: 0x501a, 0x353: 0x510a, 0x354: 0x51fa, 0x355: 0x52ea, 0x356: 0x53da, 0x357: 0x54ca, + 0x358: 0x55b9, 0x359: 0x56a9, 0x35a: 0x5799, 0x35b: 0x5889, 0x35c: 0x5979, 0x35d: 0x5a69, + 0x35e: 0x5b59, 0x35f: 0x5c49, 0x360: 0x5d3a, 0x361: 0x5e2a, 0x362: 0x5f1a, 0x363: 0x600a, + 0x364: 0x60fa, 0x365: 0x61ea, 0x366: 0x62da, 0x367: 0x63ca, 0x368: 0x64b9, 0x369: 0x65a9, + 0x36a: 0x6699, 0x36b: 0x6789, 0x36c: 0x6879, 0x36d: 0x6969, 0x36e: 0x6a59, 0x36f: 0x6b49, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6c3a, 0x373: 0x6d4a, 0x374: 0x6e1a, + 0x376: 0x6efa, 0x377: 0x6fda, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x8e53, 0x37b: 0x8e53, + 0x37c: 0x7119, 0x37d: 0x0004, 0x37e: 0x71ea, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x726a, 0x383: 0x737a, 0x384: 0x744a, + 0x386: 0x752a, 0x387: 0x760a, 0x388: 0x9153, 0x389: 0x9153, 0x38a: 0x9453, 0x38b: 0x9453, + 0x38c: 0x7749, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x781a, 0x393: 0x795a, 0x396: 0x7a9a, 0x397: 0x7b7a, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9753, 0x39b: 0x9753, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7cba, 0x3a3: 0x7dfa, + 0x3a4: 0x7f3a, 0x3a5: 0x0912, 0x3a6: 0x801a, 0x3a7: 0x80fa, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0x9d53, 0x3ab: 0x9d53, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x823a, 0x3b3: 0x834a, 0x3b4: 0x841a, + 0x3b6: 0x84fa, 0x3b7: 0x85da, 0x3b8: 0x9a53, 0x3b9: 0x9a53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8719, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x87eb, 0x3e8: 0x0013, + 0x3ea: 0x884b, 0x3eb: 0x888b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa053, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa352, 0x411: 0xa352, + 0x412: 0xa652, 0x413: 0xa652, 0x414: 0xa952, 0x415: 0xa952, 0x416: 0xa652, 0x417: 0xa652, + 0x418: 0xa352, 0x419: 0xa352, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xac52, 0x451: 0xac52, + 0x452: 0xac52, 0x453: 0xac52, 0x454: 0xac52, 0x455: 0xac52, 0x456: 0xac52, 0x457: 0xac52, + 0x458: 0xac52, 0x459: 0xac52, 0x45a: 0xac52, 0x45b: 0xac52, 0x45c: 0xac52, 0x45d: 0xac52, + 0x45e: 0xac52, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x88eb, 0x463: 0x8b53, + 0x464: 0x894b, 0x465: 0x89aa, 0x466: 0x8a0a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8a6b, 0x46e: 0x8acb, 0x46f: 0x8b2b, + 0x470: 0x8b8b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8beb, 0x47f: 0x8c4b, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8cab, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x0012, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d0b, 0x4ab: 0x8d6b, 0x4ac: 0x8dcb, 0x4ad: 0x8e2b, 0x4ae: 0x8e8b, 0x4af: 0x0012, + 0x4b0: 0x8eeb, 0x4b1: 0x8f4b, 0x4b2: 0x8fab, 0x4b3: 0xaf53, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x900a, 0x4c1: 0x908a, 0x4c2: 0x910a, 0x4c3: 0x918a, 0x4c4: 0x923a, 0x4c5: 0x92ea, + 0x4c6: 0x936a, + 0x4d3: 0x93ea, 0x4d4: 0x94ca, 0x4d5: 0x95aa, 0x4d6: 0x968a, 0x4d7: 0x976a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xb853, 0x51f: 0xb853, 0x520: 0xbb53, 0x521: 0xbb53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, + // Block 0xd, offset 0x340 + 0x340: 0xd6, 0x341: 0xd7, 0x342: 0xd8, 0x343: 0xd9, 0x344: 0xda, 0x345: 0xdb, 0x346: 0xdc, 0x347: 0xdd, + 0x348: 0xde, 0x34a: 0xdf, 0x34b: 0xe0, 0x34c: 0xe1, 0x34d: 0xe2, + 0x350: 0xe3, 0x351: 0xe4, 0x352: 0xe5, 0x353: 0xe6, 0x356: 0xe7, 0x357: 0xe8, + 0x358: 0xe9, 0x359: 0xea, 0x35a: 0xeb, 0x35b: 0xec, 0x35c: 0xed, + 0x360: 0xee, 0x362: 0xef, 0x363: 0xf0, + 0x368: 0xf1, 0x369: 0xf2, 0x36a: 0xf3, 0x36b: 0xf4, + 0x370: 0xf5, 0x371: 0xf6, 0x372: 0xf7, 0x374: 0xf8, 0x375: 0xf9, 0x376: 0xfa, + 0x37b: 0xfb, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xfc, + 0x390: 0x24, 0x391: 0xfd, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0xfe, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0xfd, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0xff, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf4, 0x469: 0x100, 0x46b: 0x101, 0x46c: 0x102, 0x46d: 0x103, 0x46e: 0x104, + 0x479: 0x105, 0x47c: 0x24, 0x47d: 0x106, 0x47e: 0x107, 0x47f: 0x108, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x109, 0x4b2: 0x10a, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c9: 0x10d, + 0x4d0: 0x10e, 0x4d1: 0x10f, 0x4d2: 0x110, 0x4d3: 0x111, 0x4d4: 0x112, 0x4d5: 0x113, 0x4d6: 0x114, 0x4d7: 0x115, + 0x4d8: 0x116, 0x4d9: 0x117, 0x4da: 0x118, 0x4db: 0x119, 0x4dc: 0x11a, 0x4dd: 0x11b, 0x4de: 0x11c, 0x4df: 0x11d, + 0x4e8: 0x11e, 0x4e9: 0x11f, 0x4ea: 0x120, + // Block 0x14, offset 0x500 + 0x500: 0x121, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x122, 0x524: 0x12, 0x525: 0x123, + 0x538: 0x124, 0x539: 0x13, 0x53a: 0x125, + // Block 0x15, offset 0x540 + 0x544: 0x126, 0x545: 0x127, 0x546: 0x128, + 0x54f: 0x129, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x12a, 0x5c1: 0x12b, 0x5c4: 0x12b, 0x5c5: 0x12b, 0x5c6: 0x12b, 0x5c7: 0x12c, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 282 entries, 564 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x280, 0x282, 0x289, 0x28b, 0x297, 0x298, 0x2a3, 0x2ab, 0x2b3, 0x2b9, 0x2ba, 0x2c8, 0x2cd, 0x2d0, 0x2d5, 0x2d9, 0x2df, 0x2e4, 0x2e7, 0x2ec, 0x2f1, 0x2f2, 0x2f8, 0x2fa, 0x2fb, 0x2fd, 0x2ff, 0x302, 0x303, 0x305, 0x308, 0x30e, 0x312, 0x314, 0x319, 0x320, 0x324, 0x32d, 0x32e, 0x337, 0x33b, 0x340, 0x348, 0x34e, 0x354, 0x35e, 0x363, 0x36c, 0x372, 0x379, 0x37d, 0x385, 0x387, 0x389, 0x38c, 0x38e, 0x390, 0x391, 0x392, 0x394, 0x396, 0x39c, 0x3a1, 0x3a3, 0x3a9, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3bc, 0x3bd, 0x3be, 0x3c0, 0x3c2, 0x3c4, 0x3c7, 0x3c9, 0x3cc, 0x3d4, 0x3d7, 0x3db, 0x3e3, 0x3e5, 0x3e6, 0x3e7, 0x3e9, 0x3ef, 0x3f1, 0x3f2, 0x3f4, 0x3f6, 0x3f8, 0x405, 0x406, 0x407, 0x40b, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x414, 0x417, 0x41d, 0x421, 0x425, 0x42b, 0x42e, 0x435, 0x439, 0x43d, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x477, 0x47d, 0x483, 0x489, 0x48c, 0x492, 0x495, 0x49d, 0x49e, 0x4a5, 0x4a9, 0x4aa, 0x4ad, 0x4b5, 0x4bb, 0x4c2, 0x4c3, 0x4c9, 0x4cc, 0x4d4, 0x4db, 0x4e5, 0x4ed, 0x4f0, 0x4f1, 0x4f2, 0x4f3, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fe, 0x4ff, 0x501, 0x503, 0x504, 0x505, 0x507, 0x50c, 0x511, 0x515, 0x516, 0x519, 0x51d, 0x528, 0x52c, 0x534, 0x539, 0x53d, 0x540, 0x544, 0x547, 0x54a, 0x54f, 0x553, 0x557, 0x55b, 0x55f, 0x561, 0x563, 0x566, 0x56b, 0x56d, 0x572, 0x57b, 0x580, 0x581, 0x584, 0x585, 0x586, 0x588, 0x589, 0x58a} + +// sparseValues: 1418 entries, 5672 bytes +var sparseValues = [1418]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x316a, lo: 0x80, hi: 0x80}, + {value: 0x31ea, lo: 0x81, hi: 0x81}, + {value: 0x326a, lo: 0x82, hi: 0x82}, + {value: 0x32ea, lo: 0x83, hi: 0x83}, + {value: 0x336a, lo: 0x84, hi: 0x84}, + {value: 0x33ea, lo: 0x85, hi: 0x85}, + {value: 0x346a, lo: 0x86, hi: 0x86}, + {value: 0x34ea, lo: 0x87, hi: 0x87}, + {value: 0x356a, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5a, offset 0x280 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x282 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x289 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28b + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x361a, lo: 0x96, hi: 0x96}, + {value: 0x36ca, lo: 0x97, hi: 0x97}, + {value: 0x377a, lo: 0x98, hi: 0x98}, + {value: 0x382a, lo: 0x99, hi: 0x99}, + {value: 0x38da, lo: 0x9a, hi: 0x9a}, + {value: 0x398a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3a3b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a3 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ab + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2ba + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2c8 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa052, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2cd + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d0 + {value: 0xa353, lo: 0xb6, hi: 0xb7}, + {value: 0xa653, lo: 0xb8, hi: 0xb9}, + {value: 0xa953, lo: 0xba, hi: 0xbb}, + {value: 0xa653, lo: 0xbc, hi: 0xbd}, + {value: 0xa353, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d5 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xac53, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2d9 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2df + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ec + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f1 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f2 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2f8 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fa + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fb + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x2fd + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x2ff + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x303 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x308 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x314 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x319 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x320 + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x324 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x32e + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x337 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x340 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x34e + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x354 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x35e + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x363 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x36c + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x372 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xaf52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x379 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x385 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x387 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x38e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x391 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x396 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x39c + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3a3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3a9 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3ac + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3ae + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3b9 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3bb + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3bd + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3be + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3c2 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3cc + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb253, lo: 0x98, hi: 0x9f}, + {value: 0xb553, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3d4 + {value: 0xb252, lo: 0x80, hi: 0x87}, + {value: 0xb552, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3d7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb553, lo: 0xb0, hi: 0xb7}, + {value: 0xb253, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3db + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb552, lo: 0x98, hi: 0x9f}, + {value: 0xb252, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3e5 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3e6 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3e7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3e9 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3f2 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x405 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x406 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x40b + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x40d + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x40f + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x410 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc3, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc4, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc5, offset 0x42b + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc6, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc7, offset 0x435 + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc8, offset 0x439 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x43d + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xca, offset 0x444 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcc, offset 0x453 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcd, offset 0x459 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xce, offset 0x463 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd0, offset 0x46f + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + // Block 0xd1, offset 0x477 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x47d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd3, offset 0x483 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd4, offset 0x489 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd5, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x492 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x495 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd8, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd9, offset 0x49e + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xda, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdb, offset 0x4a9 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdc, offset 0x4aa + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xde, offset 0x4b5 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdf, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe1, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4c9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe3, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe4, offset 0x4d4 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4db + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4e5 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe7, offset 0x4ed + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xe8, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe9, offset 0x4f1 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xea, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xeb, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xec, offset 0x4f4 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xed, offset 0x4f6 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xee, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xef, offset 0x4fa + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf0, offset 0x4fe + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf1, offset 0x4ff + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf2, offset 0x501 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xf3, offset 0x503 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf4, offset 0x504 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf5, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf6, offset 0x507 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf7, offset 0x50c + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf9, offset 0x515 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfa, offset 0x516 + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xfb, offset 0x519 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfc, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xfd, offset 0x528 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xfe, offset 0x52c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xff, offset 0x534 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x100, offset 0x539 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x101, offset 0x53d + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x102, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x103, offset 0x544 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x104, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x105, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x106, offset 0x54f + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x107, offset 0x553 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x557 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x109, offset 0x55b + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10a, offset 0x55f + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10b, offset 0x561 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x10c, offset 0x563 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x10d, offset 0x566 + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x10e, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10f, offset 0x56d + {value: 0xb852, lo: 0x80, hi: 0x81}, + {value: 0xbb52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x110, offset 0x572 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x111, offset 0x57b + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x112, offset 0x580 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x113, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x584 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x115, offset 0x585 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x116, offset 0x586 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x117, offset 0x588 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x118, offset 0x589 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14906 bytes (14KiB); checksum: 362795C7 diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go new file mode 100644 index 000000000..ae7dc2407 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables12.0.0.go @@ -0,0 +1,2360 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.14 && !go1.16 +// +build go1.14,!go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "12.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12396 bytes (12.11 KiB). Checksum: c0656238384c3da1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, 0x33f: 0xd6, + // Block 0xd, offset 0x340 + 0x340: 0xd7, 0x341: 0xd8, 0x342: 0xd9, 0x343: 0xda, 0x344: 0xdb, 0x345: 0xdc, 0x346: 0xdd, 0x347: 0xde, + 0x348: 0xdf, 0x34a: 0xe0, 0x34b: 0xe1, 0x34c: 0xe2, 0x34d: 0xe3, + 0x350: 0xe4, 0x351: 0xe5, 0x352: 0xe6, 0x353: 0xe7, 0x356: 0xe8, 0x357: 0xe9, + 0x358: 0xea, 0x359: 0xeb, 0x35a: 0xec, 0x35b: 0xed, 0x35c: 0xee, + 0x360: 0xef, 0x362: 0xf0, 0x363: 0xf1, 0x366: 0xf2, 0x367: 0xf3, + 0x368: 0xf4, 0x369: 0xf5, 0x36a: 0xf6, 0x36b: 0xf7, + 0x370: 0xf8, 0x371: 0xf9, 0x372: 0xfa, 0x374: 0xfb, 0x375: 0xfc, 0x376: 0xfd, + 0x37b: 0xfe, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xff, + 0x390: 0x24, 0x391: 0x100, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x101, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x102, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x103, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf7, 0x469: 0x104, 0x46b: 0x105, 0x46c: 0x106, 0x46d: 0x107, 0x46e: 0x108, + 0x479: 0x109, 0x47c: 0x24, 0x47d: 0x10a, 0x47e: 0x10b, 0x47f: 0x10c, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x10d, 0x4b2: 0x10e, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10f, 0x4c6: 0x110, + 0x4c9: 0x111, + 0x4d0: 0x112, 0x4d1: 0x113, 0x4d2: 0x114, 0x4d3: 0x115, 0x4d4: 0x116, 0x4d5: 0x117, 0x4d6: 0x118, 0x4d7: 0x119, + 0x4d8: 0x11a, 0x4d9: 0x11b, 0x4da: 0x11c, 0x4db: 0x11d, 0x4dc: 0x11e, 0x4dd: 0x11f, 0x4de: 0x120, 0x4df: 0x121, + 0x4e8: 0x122, 0x4e9: 0x123, 0x4ea: 0x124, + // Block 0x14, offset 0x500 + 0x500: 0x125, 0x504: 0x126, 0x505: 0x127, + 0x50b: 0x128, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x129, 0x524: 0x12, 0x525: 0x12a, + 0x538: 0x12b, 0x539: 0x13, 0x53a: 0x12c, + // Block 0x15, offset 0x540 + 0x544: 0x12d, 0x545: 0x12e, 0x546: 0x12f, + 0x54f: 0x130, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x131, 0x5c1: 0x132, 0x5c4: 0x132, 0x5c5: 0x132, 0x5c6: 0x132, 0x5c7: 0x133, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 289 entries, 578 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x281, 0x283, 0x28a, 0x28e, 0x29a, 0x29b, 0x2a6, 0x2ae, 0x2b6, 0x2bc, 0x2bd, 0x2cb, 0x2d0, 0x2d3, 0x2d8, 0x2dc, 0x2e2, 0x2e7, 0x2ea, 0x2ef, 0x2f4, 0x2f5, 0x2fb, 0x2fd, 0x2fe, 0x300, 0x302, 0x305, 0x306, 0x308, 0x30b, 0x311, 0x315, 0x317, 0x31c, 0x323, 0x32b, 0x334, 0x335, 0x33e, 0x342, 0x347, 0x34f, 0x355, 0x35b, 0x365, 0x36a, 0x373, 0x379, 0x380, 0x384, 0x38c, 0x38e, 0x390, 0x393, 0x395, 0x397, 0x398, 0x399, 0x39b, 0x39d, 0x3a3, 0x3a8, 0x3aa, 0x3b1, 0x3b4, 0x3b6, 0x3bc, 0x3c1, 0x3c3, 0x3c4, 0x3c5, 0x3c6, 0x3c8, 0x3ca, 0x3cc, 0x3cf, 0x3d1, 0x3d4, 0x3dc, 0x3df, 0x3e3, 0x3eb, 0x3ed, 0x3ee, 0x3ef, 0x3f1, 0x3f7, 0x3f9, 0x3fa, 0x3fc, 0x3fe, 0x400, 0x40d, 0x40e, 0x40f, 0x413, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41c, 0x41f, 0x425, 0x426, 0x42a, 0x42e, 0x434, 0x437, 0x43e, 0x442, 0x446, 0x44d, 0x456, 0x45c, 0x462, 0x46c, 0x476, 0x478, 0x481, 0x487, 0x48d, 0x493, 0x496, 0x49c, 0x49f, 0x4a8, 0x4a9, 0x4b0, 0x4b4, 0x4b5, 0x4b8, 0x4ba, 0x4c1, 0x4c9, 0x4cf, 0x4d5, 0x4d6, 0x4dc, 0x4df, 0x4e7, 0x4ee, 0x4f8, 0x500, 0x503, 0x504, 0x505, 0x506, 0x508, 0x509, 0x50b, 0x50d, 0x50f, 0x513, 0x514, 0x516, 0x519, 0x51b, 0x51d, 0x51f, 0x524, 0x529, 0x52d, 0x52e, 0x531, 0x535, 0x540, 0x544, 0x54c, 0x551, 0x555, 0x558, 0x55c, 0x55f, 0x562, 0x567, 0x56b, 0x56f, 0x573, 0x577, 0x579, 0x57b, 0x57e, 0x583, 0x586, 0x588, 0x58b, 0x58d, 0x593, 0x59c, 0x5a1, 0x5a2, 0x5a5, 0x5a6, 0x5a7, 0x5a9, 0x5aa, 0x5ab} + +// sparseValues: 1451 entries, 5804 bytes +var sparseValues = [1451]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x281 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x283 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28a + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28e + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29a + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a6 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ae + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bc + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2bd + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cb + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d0 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d3 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d8 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dc + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e2 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ef + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f5 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fb + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fd + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fe + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x300 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x306 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30b + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x311 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x315 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x317 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x323 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x32b + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x335 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x342 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x347 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x34f + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x355 + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x365 + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x36a + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x373 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x379 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa7}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x384 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x395 + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x398 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x39b + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x39d + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3a3 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a8 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3aa + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b1 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3b4 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3b6 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3c3 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3c5 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3d4 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3dc + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3df + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e3 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3ed + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3ee + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3fa + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x40d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x40f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x415 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x416 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x417 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x418 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x425 + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc3, offset 0x426 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc4, offset 0x42a + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc5, offset 0x42e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc6, offset 0x434 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc7, offset 0x437 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc8, offset 0x43e + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xca, offset 0x446 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcc, offset 0x456 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcd, offset 0x45c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xce, offset 0x462 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd0, offset 0x476 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd1, offset 0x478 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0x9f}, + // Block 0xd2, offset 0x481 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x487 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd4, offset 0x48d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x493 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd6, offset 0x496 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd7, offset 0x49c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd8, offset 0x49f + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xd9, offset 0x4a8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xda, offset 0x4a9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xdb, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdc, offset 0x4b4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xde, offset 0x4b8 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xdf, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe0, offset 0x4c1 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe1, offset 0x4c9 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe2, offset 0x4cf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe4, offset 0x4d6 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe6, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe7, offset 0x4e7 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe8, offset 0x4ee + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe9, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xea, offset 0x500 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xeb, offset 0x503 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xed, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xee, offset 0x506 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xef, offset 0x508 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf0, offset 0x509 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x50b + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf2, offset 0x50d + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf3, offset 0x50f + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf4, offset 0x513 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf5, offset 0x514 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf6, offset 0x516 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xf7, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf8, offset 0x51b + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa3}, + // Block 0xf9, offset 0x51d + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xfa, offset 0x51f + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xfb, offset 0x524 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xfc, offset 0x529 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xfd, offset 0x52d + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfe, offset 0x52e + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xff, offset 0x531 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x535 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x102, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x103, offset 0x54c + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x104, offset 0x551 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x105, offset 0x555 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x106, offset 0x558 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x107, offset 0x55c + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x55f + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x109, offset 0x562 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x10a, offset 0x567 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x10b, offset 0x56b + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x10c, offset 0x56f + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x10d, offset 0x573 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10e, offset 0x577 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10f, offset 0x579 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x110, offset 0x57b + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x111, offset 0x57e + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x112, offset 0x583 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x113, offset 0x586 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x114, offset 0x588 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x115, offset 0x58b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x116, offset 0x58d + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x117, offset 0x593 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x118, offset 0x59c + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x119, offset 0x5a1 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11a, offset 0x5a2 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11b, offset 0x5a5 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x11c, offset 0x5a6 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11d, offset 0x5a7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x5a9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x11f, offset 0x5aa + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15070 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go new file mode 100644 index 000000000..cd874775b --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -0,0 +1,2400 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.16 +// +build go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "13.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12538 bytes (12.24 KiB). Checksum: af4dfa7d60c71d4c. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16b: 0x66, 0x16c: 0x67, 0x16d: 0x68, 0x16e: 0x69, 0x16f: 0x6a, + 0x170: 0x6b, 0x171: 0x6c, 0x172: 0x6d, 0x173: 0x6e, 0x174: 0x6f, 0x175: 0x70, 0x176: 0x71, 0x177: 0x72, + 0x178: 0x73, 0x179: 0x73, 0x17a: 0x74, 0x17b: 0x73, 0x17c: 0x75, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x76, 0x181: 0x77, 0x182: 0x78, 0x183: 0x79, 0x184: 0x0d, 0x185: 0x7a, 0x186: 0x7b, + 0x192: 0x7c, 0x193: 0x0e, + 0x1b0: 0x7d, 0x1b1: 0x0f, 0x1b2: 0x73, 0x1b3: 0x7e, 0x1b4: 0x7f, 0x1b5: 0x80, 0x1b6: 0x81, 0x1b7: 0x82, + 0x1b8: 0x83, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x84, 0x1c2: 0x85, 0x1c3: 0x86, 0x1c4: 0x87, 0x1c5: 0x24, 0x1c6: 0x88, + // Block 0x8, offset 0x200 + 0x200: 0x89, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x8a, 0x213: 0x8b, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8c, 0x219: 0x8d, 0x21a: 0x8e, 0x21b: 0x8f, 0x21c: 0x90, 0x21d: 0x91, 0x21e: 0x10, 0x21f: 0x92, + 0x220: 0x93, 0x221: 0x94, 0x222: 0x24, 0x223: 0x95, 0x224: 0x96, 0x225: 0x97, 0x226: 0x98, 0x227: 0x99, + 0x228: 0x9a, 0x229: 0x9b, 0x22a: 0x9c, 0x22b: 0x9d, 0x22c: 0x9e, 0x22d: 0x9f, 0x22e: 0xa0, 0x22f: 0xa1, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa2, 0x29f: 0xa3, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa4, 0x2ee: 0xa5, 0x2ef: 0xa6, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa7, 0x2f5: 0xa8, 0x2f6: 0xa9, 0x2f7: 0xaa, + 0x2f8: 0xab, 0x2f9: 0xac, 0x2fa: 0x24, 0x2fb: 0xad, 0x2fc: 0xae, 0x2fd: 0xaf, 0x2fe: 0xb0, 0x2ff: 0xb1, + // Block 0xc, offset 0x300 + 0x300: 0xb2, 0x301: 0xb3, 0x302: 0x24, 0x303: 0xb4, 0x305: 0xb5, 0x307: 0xb6, + 0x30a: 0xb7, 0x30b: 0xb8, 0x30c: 0xb9, 0x30d: 0xba, 0x30e: 0xbb, 0x30f: 0xbc, + 0x310: 0xbd, 0x311: 0xbe, 0x312: 0xbf, 0x313: 0xc0, 0x314: 0xc1, 0x315: 0xc2, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc3, 0x31d: 0xc4, + 0x320: 0xc5, 0x321: 0xc6, 0x322: 0xc7, 0x323: 0xc8, 0x324: 0xc9, 0x326: 0xca, + 0x328: 0xcb, 0x329: 0xcc, 0x32a: 0xcd, 0x32b: 0xce, 0x32c: 0x5f, 0x32d: 0xcf, 0x32e: 0xd0, + 0x330: 0x24, 0x331: 0xd1, 0x332: 0xd2, 0x333: 0xd3, 0x334: 0xd4, + 0x33a: 0xd5, 0x33c: 0xd6, 0x33d: 0xd7, 0x33e: 0xd8, 0x33f: 0xd9, + // Block 0xd, offset 0x340 + 0x340: 0xda, 0x341: 0xdb, 0x342: 0xdc, 0x343: 0xdd, 0x344: 0xde, 0x345: 0xdf, 0x346: 0xe0, 0x347: 0xe1, + 0x348: 0xe2, 0x34a: 0xe3, 0x34b: 0xe4, 0x34c: 0xe5, 0x34d: 0xe6, + 0x350: 0xe7, 0x351: 0xe8, 0x352: 0xe9, 0x353: 0xea, 0x356: 0xeb, 0x357: 0xec, + 0x358: 0xed, 0x359: 0xee, 0x35a: 0xef, 0x35b: 0xf0, 0x35c: 0xf1, + 0x360: 0xf2, 0x362: 0xf3, 0x363: 0xf4, 0x364: 0xf5, 0x365: 0xf6, 0x366: 0xf7, 0x367: 0xf8, + 0x368: 0xf9, 0x369: 0xfa, 0x36a: 0xfb, 0x36b: 0xfc, + 0x370: 0xfd, 0x371: 0xfe, 0x372: 0xff, 0x374: 0x100, 0x375: 0x101, 0x376: 0x102, + 0x37b: 0x103, 0x37e: 0x104, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0x105, + 0x390: 0x24, 0x391: 0x106, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x107, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x108, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x109, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xfc, 0x469: 0x10a, 0x46b: 0x10b, 0x46c: 0x10c, 0x46d: 0x10d, 0x46e: 0x10e, + 0x479: 0x10f, 0x47c: 0x24, 0x47d: 0x110, 0x47e: 0x111, 0x47f: 0x112, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x113, 0x4b2: 0x114, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x115, 0x4c6: 0x116, + 0x4c9: 0x117, + 0x4d0: 0x118, 0x4d1: 0x119, 0x4d2: 0x11a, 0x4d3: 0x11b, 0x4d4: 0x11c, 0x4d5: 0x11d, 0x4d6: 0x11e, 0x4d7: 0x11f, + 0x4d8: 0x120, 0x4d9: 0x121, 0x4da: 0x122, 0x4db: 0x123, 0x4dc: 0x124, 0x4dd: 0x125, 0x4de: 0x126, 0x4df: 0x127, + 0x4e8: 0x128, 0x4e9: 0x129, 0x4ea: 0x12a, + // Block 0x14, offset 0x500 + 0x500: 0x12b, 0x504: 0x12c, 0x505: 0x12d, + 0x50b: 0x12e, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x12f, 0x524: 0x12, 0x525: 0x130, + 0x538: 0x131, 0x539: 0x13, 0x53a: 0x132, + // Block 0x15, offset 0x540 + 0x544: 0x133, 0x545: 0x134, 0x546: 0x135, + 0x54f: 0x136, + 0x56f: 0x137, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x138, 0x5c1: 0x139, 0x5c4: 0x139, 0x5c5: 0x139, 0x5c6: 0x139, 0x5c7: 0x13a, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 296 entries, 592 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xc0, 0xc6, 0xd4, 0xdf, 0xec, 0xf7, 0x103, 0x10d, 0x119, 0x124, 0x130, 0x13c, 0x144, 0x14d, 0x157, 0x162, 0x16e, 0x174, 0x17f, 0x185, 0x18d, 0x190, 0x195, 0x199, 0x19d, 0x1a4, 0x1ad, 0x1b5, 0x1b6, 0x1bf, 0x1c6, 0x1ce, 0x1d4, 0x1d9, 0x1dd, 0x1e0, 0x1e2, 0x1e5, 0x1ea, 0x1eb, 0x1ed, 0x1ef, 0x1f1, 0x1f8, 0x1fd, 0x201, 0x20a, 0x20d, 0x210, 0x216, 0x217, 0x222, 0x223, 0x224, 0x229, 0x236, 0x23f, 0x240, 0x248, 0x251, 0x25a, 0x263, 0x268, 0x26b, 0x276, 0x284, 0x286, 0x28d, 0x291, 0x29d, 0x29e, 0x2a9, 0x2b1, 0x2b9, 0x2bf, 0x2c0, 0x2ce, 0x2d3, 0x2d6, 0x2db, 0x2df, 0x2e5, 0x2ea, 0x2ed, 0x2f2, 0x2f7, 0x2f8, 0x2fe, 0x300, 0x301, 0x303, 0x305, 0x308, 0x309, 0x30b, 0x30e, 0x314, 0x318, 0x31a, 0x31f, 0x326, 0x331, 0x33b, 0x33c, 0x345, 0x349, 0x34e, 0x356, 0x35c, 0x362, 0x36c, 0x371, 0x37a, 0x380, 0x389, 0x38d, 0x395, 0x397, 0x399, 0x39c, 0x39e, 0x3a0, 0x3a1, 0x3a2, 0x3a4, 0x3a6, 0x3ac, 0x3b1, 0x3b3, 0x3ba, 0x3bd, 0x3bf, 0x3c5, 0x3ca, 0x3cc, 0x3cd, 0x3ce, 0x3cf, 0x3d1, 0x3d3, 0x3d5, 0x3d8, 0x3da, 0x3dd, 0x3e5, 0x3e8, 0x3ec, 0x3f4, 0x3f6, 0x3f7, 0x3f8, 0x3fa, 0x400, 0x402, 0x403, 0x405, 0x407, 0x409, 0x416, 0x417, 0x418, 0x41c, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x425, 0x428, 0x42b, 0x431, 0x432, 0x434, 0x438, 0x43c, 0x442, 0x445, 0x44c, 0x450, 0x454, 0x45d, 0x466, 0x46c, 0x472, 0x47c, 0x486, 0x488, 0x491, 0x497, 0x49d, 0x4a3, 0x4a6, 0x4ac, 0x4af, 0x4b8, 0x4b9, 0x4c0, 0x4c4, 0x4c5, 0x4c8, 0x4d2, 0x4d5, 0x4d7, 0x4de, 0x4e6, 0x4ec, 0x4f2, 0x4f3, 0x4f9, 0x4fc, 0x504, 0x50b, 0x515, 0x51d, 0x520, 0x521, 0x522, 0x523, 0x524, 0x526, 0x527, 0x529, 0x52b, 0x52d, 0x531, 0x532, 0x534, 0x537, 0x539, 0x53c, 0x53e, 0x543, 0x548, 0x54c, 0x54d, 0x550, 0x554, 0x55f, 0x563, 0x56b, 0x570, 0x574, 0x577, 0x57b, 0x57e, 0x581, 0x586, 0x58a, 0x58e, 0x592, 0x596, 0x598, 0x59a, 0x59d, 0x5a2, 0x5a5, 0x5a7, 0x5aa, 0x5ac, 0x5b2, 0x5bb, 0x5c0, 0x5c1, 0x5c4, 0x5c5, 0x5c6, 0x5c7, 0x5c9, 0x5ca, 0x5cb} + +// sparseValues: 1483 entries, 5932 bytes +var sparseValues = [1483]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x19, offset 0xb0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xc0 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xdf + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xec + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x103 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x124 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x130 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x144 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x157 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x162 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x185 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x190 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b6 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c6 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1ce + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d4 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1e0 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e5 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1ea + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ed + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f8 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fd + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x201 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x20a + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20d + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x217 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x222 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x223 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x229 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x236 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x52, offset 0x23f + {value: 0x0034, lo: 0x80, hi: 0x80}, + // Block 0x53, offset 0x240 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x54, offset 0x248 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x55, offset 0x251 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x56, offset 0x25a + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x57, offset 0x263 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x58, offset 0x268 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x59, offset 0x26b + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x5a, offset 0x276 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5b, offset 0x284 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5c, offset 0x286 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5d, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5e, offset 0x291 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5f, offset 0x29d + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x60, offset 0x29e + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x61, offset 0x2a9 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x62, offset 0x2b1 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2bf + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x65, offset 0x2c0 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x66, offset 0x2ce + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x67, offset 0x2d3 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x68, offset 0x2d6 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x69, offset 0x2db + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6a, offset 0x2df + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6b, offset 0x2e5 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x2ed + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6e, offset 0x2f2 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6f, offset 0x2f7 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x70, offset 0x2f8 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x71, offset 0x2fe + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x72, offset 0x300 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x76, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x78, offset 0x30b + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7a, offset 0x314 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7b, offset 0x318 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7c, offset 0x31a + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7d, offset 0x31f + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7f, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x80, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x81, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x345 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x83, offset 0x349 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x84, offset 0x34e + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x85, offset 0x356 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x86, offset 0x35c + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x87, offset 0x362 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x88, offset 0x36c + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x89, offset 0x371 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8a, offset 0x37a + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x389 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x38d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8e, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8f, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x90, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x91, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x92, offset 0x39e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x93, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x94, offset 0x3a1 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x95, offset 0x3a2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x96, offset 0x3a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x97, offset 0x3a6 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x98, offset 0x3ac + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x99, offset 0x3b1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3ba + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9c, offset 0x3bd + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9d, offset 0x3bf + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9e, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9f, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa0, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa1, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa2, offset 0x3ce + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa3, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa4, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa5, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa6, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa7, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa8, offset 0x3da + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa9, offset 0x3dd + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xaa, offset 0x3e5 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xab, offset 0x3e8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xac, offset 0x3ec + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xad, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xae, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xaf, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb0, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb1, offset 0x3fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x403 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x416 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x420 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x421 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x422 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x425 + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x428 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc3, offset 0x42b + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc4, offset 0x431 + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x432 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xca, offset 0x445 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcb, offset 0x44c + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcc, offset 0x450 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x454 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xce, offset 0x45d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcf, offset 0x466 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd0, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd1, offset 0x472 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd2, offset 0x47c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd3, offset 0x486 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd5, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x497 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4a3 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd9, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4ac + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdb, offset 0x4af + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xdc, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdd, offset 0x4b9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xde, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdf, offset 0x4c4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe0, offset 0x4c5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe1, offset 0x4c8 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4d2 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe4, offset 0x4d7 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe5, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe6, offset 0x4e6 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe7, offset 0x4ec + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe8, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe9, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xea, offset 0x4f9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xeb, offset 0x4fc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xed, offset 0x50b + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xee, offset 0x515 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xef, offset 0x51d + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf0, offset 0x520 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf1, offset 0x521 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf2, offset 0x522 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf3, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf4, offset 0x524 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xf5, offset 0x526 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf6, offset 0x527 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf7, offset 0x529 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf8, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf9, offset 0x52d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xfa, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xfb, offset 0x532 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xfc, offset 0x534 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xfd, offset 0x537 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xfe, offset 0x539 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0xff, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x100, offset 0x53e + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x101, offset 0x543 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x102, offset 0x548 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x103, offset 0x54c + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x104, offset 0x54d + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x105, offset 0x550 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x106, offset 0x554 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x107, offset 0x55f + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x108, offset 0x563 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x109, offset 0x56b + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x10a, offset 0x570 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x10b, offset 0x574 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x10c, offset 0x577 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x10d, offset 0x57b + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x57e + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x10f, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x110, offset 0x586 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x111, offset 0x58a + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x112, offset 0x58e + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x113, offset 0x592 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x114, offset 0x596 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x115, offset 0x598 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x116, offset 0x59a + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x117, offset 0x59d + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x118, offset 0x5a2 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x119, offset 0x5a5 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x11a, offset 0x5a7 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x11b, offset 0x5aa + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x11c, offset 0x5ac + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x11d, offset 0x5b2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x11e, offset 0x5bb + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x11f, offset 0x5c0 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x120, offset 0x5c1 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x121, offset 0x5c4 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x122, offset 0x5c5 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x123, offset 0x5c6 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x124, offset 0x5c7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x5c9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x126, offset 0x5ca + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15212 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go new file mode 100644 index 000000000..636d5d14d --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables9.0.0.go @@ -0,0 +1,2216 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build !go1.10 +// +build !go1.10 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 795fe57ee5135873. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x36b: 0xed, + 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, + 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf2, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf4, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, + 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, + // Block 0x13, offset 0x4c0 + 0x4c5: 0xff, 0x4c6: 0x100, + 0x4c9: 0x101, + 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, + 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, + 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, + // Block 0x14, offset 0x500 + 0x500: 0x115, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, + 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, + // Block 0x15, offset 0x540 + 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, + 0x54f: 0x11d, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 272 entries, 544 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} + +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0004, lo: 0x82, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x91}, + {value: 0x0004, lo: 0x92, hi: 0x96}, + {value: 0x0054, lo: 0x97, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xac}, + {value: 0x0004, lo: 0xad, hi: 0xad}, + {value: 0x0014, lo: 0xae, hi: 0xae}, + {value: 0x0004, lo: 0xaf, hi: 0xbf}, + // Block 0x6, offset 0x3a + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x3d + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x41 + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x44 + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x48 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x52 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x54 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x59 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x69 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x75 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x83 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x84 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x92 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0xa1 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xae + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xb4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xbc + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + // Block 0x19, offset 0xbe + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xc0 + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xce + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xe2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xed + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + // Block 0x1f, offset 0xf8 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x103 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10f + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + // Block 0x23, offset 0x124 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x147 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x157 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16c + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x189 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x196 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a2 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1be + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1cf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d7 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1ec + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fc + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fe + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x207 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20c + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x219 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x226 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x231 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x232 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x233 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x238 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x255 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x267 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x270 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x275 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x278 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x281 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28e + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x290 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x299 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xad}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0x9f}, + {value: 0x0004, lo: 0xa0, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x327 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32e + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x332 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x344 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34d + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x355 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x361 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36b + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x370 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x379 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37f + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x386 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38a + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x396 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39b + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39d + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39e + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a3 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a9 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ae + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b6 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b9 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3bb + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3ca + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3cb + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d9 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e1 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3f0 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3ff + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x401 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x403 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x412 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41b + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41c + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41d + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x422 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x426 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42c + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x435 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x442 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x451 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x457 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x461 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46b + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x474 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x47a + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x486 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x489 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x49a + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49b + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a2 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a3 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdc, offset 0x4a7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xde, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xdf, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe0, offset 0x4b9 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe1, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe2, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe3, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe4, offset 0x4be + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xe5, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xe6, offset 0x4c2 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xe7, offset 0x4c6 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xe8, offset 0x4c7 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xe9, offset 0x4c9 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xea, offset 0x4ca + {value: 0x0014, lo: 0xa0, hi: 0xa0}, + // Block 0xeb, offset 0x4cb + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xec, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xed, offset 0x4d2 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xee, offset 0x4d7 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xef, offset 0x4db + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf0, offset 0x4dc + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf1, offset 0x4df + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf2, offset 0x4e3 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf3, offset 0x4ee + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf4, offset 0x4f2 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xf5, offset 0x4fa + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xf6, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xf7, offset 0x503 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xf8, offset 0x506 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xf9, offset 0x50a + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x50d + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfb, offset 0x510 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0xfc, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0xfd, offset 0x519 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0xfe, offset 0x51d + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xff, offset 0x521 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x100, offset 0x525 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x101, offset 0x527 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x102, offset 0x529 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x103, offset 0x52c + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x104, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x105, offset 0x533 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x106, offset 0x538 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x107, offset 0x541 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x108, offset 0x546 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x109, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x10b, offset 0x54b + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x54c + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x10d, offset 0x54e + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x10e, offset 0x54f + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14027 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go new file mode 100644 index 000000000..4e4d13fe5 --- /dev/null +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -0,0 +1,217 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package cases + +// This file contains definitions for interpreting the trie value of the case +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds case information for a single rune. It is the value returned +// by a trie lookup. Most mapping information can be stored in a single 16-bit +// value. If not, for example when a rune is mapped to multiple runes, the value +// stores some basic case data and an index into an array with additional data. +// +// The per-rune values have the following format: +// +// if (exception) { +// 15..4 unsigned exception index +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode +// +// For the non-exceptional cases, a rune must be either uncased, lowercase or +// uppercase. If the rune is cased, the XOR pattern maps either a lowercase +// rune to uppercase or an uppercase rune to lowercase (applied to the 10 +// least-significant bits of the rune). +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + casedMask = 0x0003 + fullCasedMask = 0x0007 + ignorableMask = 0x0006 + ignorableValue = 0x0004 + + inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 + + exceptionBit = 1 << 3 + exceptionShift = 4 + numExceptionBits = 12 + + xorIndexBit = 1 << 6 + xorShift = 8 + + // There is no mapping if all xor bits and the exception bit are zero. + hasMappingMask = 0xff80 | exceptionBit +) + +// The case mode bits encodes the case type of a rune. This includes uncased, +// title, upper and lower case and case ignorable. (For a definition of these +// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare +// cases, a rune can be both cased and case-ignorable. This is encoded by +// cIgnorableCased. A rune of this type is always lower case. Some runes are +// cased while not having a mapping. +// +// A common pattern for scripts in the Unicode standard is for upper and lower +// case runes to alternate for increasing rune values (e.g. the accented Latin +// ranges starting from U+0100 and U+1E00 among others and some Cyrillic +// characters). We use this property by defining a cXORCase mode, where the case +// mode (always upper or lower case) is derived from the rune value. As the XOR +// pattern for case mappings is often identical for successive runes, using +// cXORCase can result in large series of identical trie values. This, in turn, +// allows us to better compress the trie blocks. +const ( + cUncased info = iota // 000 + cTitle // 001 + cLower // 010 + cUpper // 011 + cIgnorableUncased // 100 + cIgnorableCased // 101 // lower case if mappings exist + cXORCase // 11x // case is cLower | ((rune&1) ^ x) + + maxCaseMode = cUpper +) + +func (c info) isCased() bool { + return c&casedMask != 0 +} + +func (c info) isCaseIgnorable() bool { + return c&ignorableMask == ignorableValue +} + +func (c info) isNotCasedAndNotCaseIgnorable() bool { + return c&fullCasedMask == 0 +} + +func (c info) isCaseIgnorableAndNotCased() bool { + return c&fullCasedMask == cIgnorableUncased +} + +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + +// The case mapping implementation will need to know about various Canonical +// Combining Class (CCC) values. We encode two of these in the trie value: +// cccZero (0) and cccAbove (230). If the value is cccOther, it means that +// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that +// the rune also has the break category Break (see below). +const ( + cccBreak info = iota << 4 + cccZero + cccAbove + cccOther + + cccMask = cccBreak | cccZero | cccAbove | cccOther +) + +const ( + starter = 0 + above = 230 + iotaSubscript = 240 +) + +// The exceptions slice holds data that does not fit in a normal info entry. +// The entry is pointed to by the exception index in an entry. It has the +// following format: +// +// Header: +// +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold +// +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper +// +// Lengths with the value 0x7 indicate no value and implies no change. +// A length of 0 indicates a mapping to zero-length string. +// +// Body bytes: +// +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// Fallbacks: +// +// missing fold -> lower +// missing title -> upper +// all missing -> original rune +// +// exceptions starts with a dummy byte to enforce that there is no zero index +// value. +const ( + lengthMask = 0x07 + lengthBits = 3 + noChange = 0 +) + +// References to generated trie. + +var trie = newCaseTrie(0) + +var sparse = sparseBlocks{ + values: sparseValues[:], + offsets: sparseOffsets[:], +} + +// Sparse block lookup code. + +// valueRange is an entry in a sparse block. +type valueRange struct { + value uint16 + lo, hi byte +} + +type sparseBlocks struct { + values []valueRange + offsets []uint16 +} + +// lookup returns the value from values block n for byte b using binary search. +func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { + lo := s.offsets[n] + hi := s.offsets[n+1] + for lo < hi { + m := lo + (hi-lo)/2 + r := s.values[m] + if r.lo <= b && b <= r.hi { + return r.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} + +// lastRuneForTesting is the last rune used for testing. Everything after this +// is boring. +const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 000000000..3cddbbdda --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,49 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 000000000..cdfdb7497 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 000000000..46a001507 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 000000000..1b36935ef --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 000000000..83816a72a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 000000000..8d810723c --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 000000000..32af9de59 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x05820000, + 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x43220000, 0x43220033, 0x432200bd, 0x43220105, + 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, + 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, + 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, + 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + // Entry 300 - 31F + 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 6772C83C diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 000000000..ca135d295 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 000000000..4ae78e0fa --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 000000000..9b20b88fe --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 000000000..6105bc7fa --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 000000000..231b4fbde --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 000000000..75a2dbca7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 000000000..aad1e0acf --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 000000000..fb6b58378 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3472 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8752 + +const NumScripts = 258 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 716 bytes, 179 elements +var AliasMap = [179]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x709, To: 0x3625}, + 20: {From: 0x73e, To: 0x21a1}, + 21: {From: 0x7b3, To: 0x56}, + 22: {From: 0x7b9, To: 0x299b}, + 23: {From: 0x7c5, To: 0x58}, + 24: {From: 0x7e6, To: 0x145}, + 25: {From: 0x80c, To: 0x5a}, + 26: {From: 0x815, To: 0x8d}, + 27: {From: 0x87e, To: 0x810}, + 28: {From: 0x8a8, To: 0x8b7}, + 29: {From: 0x8c3, To: 0xee3}, + 30: {From: 0x8fa, To: 0x1dc}, + 31: {From: 0x9ef, To: 0x331}, + 32: {From: 0xa36, To: 0x2c5}, + 33: {From: 0xa3d, To: 0xbf}, + 34: {From: 0xabe, To: 0x3322}, + 35: {From: 0xb38, To: 0x529}, + 36: {From: 0xb75, To: 0x265a}, + 37: {From: 0xb7e, To: 0xbc3}, + 38: {From: 0xb9b, To: 0x44e}, + 39: {From: 0xbbc, To: 0x4229}, + 40: {From: 0xbbf, To: 0x529}, + 41: {From: 0xbfe, To: 0x2da7}, + 42: {From: 0xc2e, To: 0x3181}, + 43: {From: 0xcb9, To: 0xf3}, + 44: {From: 0xd08, To: 0xfa}, + 45: {From: 0xdc8, To: 0x11a}, + 46: {From: 0xdd7, To: 0x32d}, + 47: {From: 0xdf8, To: 0xdfb}, + 48: {From: 0xdfe, To: 0x531}, + 49: {From: 0xe01, To: 0xdf3}, + 50: {From: 0xedf, To: 0x205a}, + 51: {From: 0xee9, To: 0x222e}, + 52: {From: 0xeee, To: 0x2e9a}, + 53: {From: 0xf39, To: 0x367}, + 54: {From: 0x10d0, To: 0x140}, + 55: {From: 0x1104, To: 0x2d0}, + 56: {From: 0x11a0, To: 0x1ec}, + 57: {From: 0x1279, To: 0x21}, + 58: {From: 0x1424, To: 0x15e}, + 59: {From: 0x1470, To: 0x14e}, + 60: {From: 0x151f, To: 0xd9b}, + 61: {From: 0x1523, To: 0x390}, + 62: {From: 0x1532, To: 0x19f}, + 63: {From: 0x1580, To: 0x210}, + 64: {From: 0x1583, To: 0x10d}, + 65: {From: 0x15a3, To: 0x3caf}, + 66: {From: 0x1630, To: 0x222e}, + 67: {From: 0x166a, To: 0x19b}, + 68: {From: 0x16c8, To: 0x136}, + 69: {From: 0x1700, To: 0x29f8}, + 70: {From: 0x1718, To: 0x194}, + 71: {From: 0x1727, To: 0xf3f}, + 72: {From: 0x177a, To: 0x178}, + 73: {From: 0x1809, To: 0x17b6}, + 74: {From: 0x1816, To: 0x18f3}, + 75: {From: 0x188a, To: 0x436}, + 76: {From: 0x1979, To: 0x1d01}, + 77: {From: 0x1a74, To: 0x2bb0}, + 78: {From: 0x1a8a, To: 0x1f8}, + 79: {From: 0x1b5a, To: 0x1fa}, + 80: {From: 0x1b86, To: 0x1515}, + 81: {From: 0x1d64, To: 0x2c9b}, + 82: {From: 0x2038, To: 0x37b1}, + 83: {From: 0x203d, To: 0x20dd}, + 84: {From: 0x205a, To: 0x30b}, + 85: {From: 0x20e3, To: 0x274}, + 86: {From: 0x20ee, To: 0x263}, + 87: {From: 0x20f2, To: 0x22d}, + 88: {From: 0x20f9, To: 0x256}, + 89: {From: 0x210f, To: 0x21eb}, + 90: {From: 0x2135, To: 0x27d}, + 91: {From: 0x2160, To: 0x913}, + 92: {From: 0x2199, To: 0x121}, + 93: {From: 0x21ce, To: 0x1561}, + 94: {From: 0x21e6, To: 0x504}, + 95: {From: 0x21f4, To: 0x49f}, + 96: {From: 0x21fb, To: 0x269}, + 97: {From: 0x222d, To: 0x121}, + 98: {From: 0x2237, To: 0x121}, + 99: {From: 0x2262, To: 0x92a}, + 100: {From: 0x2316, To: 0x3226}, + 101: {From: 0x236a, To: 0x2835}, + 102: {From: 0x2382, To: 0x3365}, + 103: {From: 0x2472, To: 0x2c7}, + 104: {From: 0x24e4, To: 0x2ff}, + 105: {From: 0x24f0, To: 0x2fa}, + 106: {From: 0x24fa, To: 0x31f}, + 107: {From: 0x2550, To: 0xb5b}, + 108: {From: 0x25a9, To: 0xe2}, + 109: {From: 0x263e, To: 0x2d0}, + 110: {From: 0x26c9, To: 0x26b4}, + 111: {From: 0x26f9, To: 0x3c8}, + 112: {From: 0x2727, To: 0x3caf}, + 113: {From: 0x2755, To: 0x6a4}, + 114: {From: 0x2765, To: 0x26b4}, + 115: {From: 0x2789, To: 0x4358}, + 116: {From: 0x27c9, To: 0x2001}, + 117: {From: 0x28ea, To: 0x27b1}, + 118: {From: 0x28ef, To: 0x2837}, + 119: {From: 0x2914, To: 0x351}, + 120: {From: 0x2986, To: 0x2da7}, + 121: {From: 0x29f0, To: 0x96b}, + 122: {From: 0x2b1a, To: 0x38d}, + 123: {From: 0x2bfc, To: 0x395}, + 124: {From: 0x2c3f, To: 0x3caf}, + 125: {From: 0x2ce1, To: 0x2201}, + 126: {From: 0x2cfc, To: 0x3be}, + 127: {From: 0x2d13, To: 0x597}, + 128: {From: 0x2d47, To: 0x148}, + 129: {From: 0x2d48, To: 0x148}, + 130: {From: 0x2dff, To: 0x2f1}, + 131: {From: 0x2e08, To: 0x19cc}, + 132: {From: 0x2e1a, To: 0x2d95}, + 133: {From: 0x2e21, To: 0x292}, + 134: {From: 0x2e54, To: 0x7d}, + 135: {From: 0x2e65, To: 0x2282}, + 136: {From: 0x2ea0, To: 0x2e9b}, + 137: {From: 0x2eef, To: 0x2ed7}, + 138: {From: 0x3193, To: 0x3c4}, + 139: {From: 0x3366, To: 0x338e}, + 140: {From: 0x342a, To: 0x3dc}, + 141: {From: 0x34ee, To: 0x18d0}, + 142: {From: 0x35c8, To: 0x2c9b}, + 143: {From: 0x35e6, To: 0x412}, + 144: {From: 0x3658, To: 0x246}, + 145: {From: 0x3676, To: 0x3f4}, + 146: {From: 0x36fd, To: 0x445}, + 147: {From: 0x37c0, To: 0x121}, + 148: {From: 0x3816, To: 0x38f2}, + 149: {From: 0x382a, To: 0x2b48}, + 150: {From: 0x382b, To: 0x2c9b}, + 151: {From: 0x382f, To: 0xa9}, + 152: {From: 0x3832, To: 0x3228}, + 153: {From: 0x386c, To: 0x39a6}, + 154: {From: 0x3892, To: 0x3fc0}, + 155: {From: 0x38a5, To: 0x39d7}, + 156: {From: 0x38b4, To: 0x1fa4}, + 157: {From: 0x38b5, To: 0x2e9a}, + 158: {From: 0x395c, To: 0x47e}, + 159: {From: 0x3b4e, To: 0xd91}, + 160: {From: 0x3b78, To: 0x137}, + 161: {From: 0x3c99, To: 0x4bc}, + 162: {From: 0x3fbd, To: 0x100}, + 163: {From: 0x4208, To: 0xa91}, + 164: {From: 0x42be, To: 0x573}, + 165: {From: 0x42f9, To: 0x3f60}, + 166: {From: 0x4378, To: 0x25a}, + 167: {From: 0x43b8, To: 0xe6c}, + 168: {From: 0x43cd, To: 0x10f}, + 169: {From: 0x44af, To: 0x3322}, + 170: {From: 0x44e3, To: 0x512}, + 171: {From: 0x45ca, To: 0x2409}, + 172: {From: 0x45dd, To: 0x26dc}, + 173: {From: 0x4610, To: 0x48ae}, + 174: {From: 0x46ae, To: 0x46a0}, + 175: {From: 0x473e, To: 0x4745}, + 176: {From: 0x4817, To: 0x3503}, + 177: {From: 0x4916, To: 0x31f}, + 178: {From: 0x49a7, To: 0x523}, +} + +// Size: 179 bytes, 179 elements +var AliasTypes = [179]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, + 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, + 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + // Entry 40 - 7F + 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, + 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, + 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + // Entry 80 - BF + 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, + 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, + 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, + 0, 1, 1, +} + +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 147 + _Qaai = 155 + _Qabx = 196 + _Zinh = 252 + _Zyyy = 257 + _Zzzz = 258 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1040 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + + "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + + "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + + "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + + "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + + "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + + "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + + "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + + "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + + "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + + "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + // Entry 140 - 17F + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 480 - 4BF + 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 2014 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x61, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x63, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "biscayan": 0x14, + "biske": 0x5c, + "bohoric": 0x15, + "boont": 0x16, + "bornholm": 0x17, + "cisaup": 0x18, + "colb1945": 0x19, + "cornu": 0x1a, + "creiss": 0x1b, + "dajnko": 0x1c, + "ekavsk": 0x1d, + "emodeng": 0x1e, + "fonipa": 0x64, + "fonkirsh": 0x65, + "fonnapa": 0x66, + "fonupa": 0x67, + "fonxsamp": 0x68, + "gascon": 0x1f, + "grclass": 0x20, + "grital": 0x21, + "grmistr": 0x22, + "hepburn": 0x23, + "heploc": 0x62, + "hognorsk": 0x24, + "hsistemo": 0x25, + "ijekavsk": 0x26, + "itihasa": 0x27, + "ivanchov": 0x28, + "jauer": 0x29, + "jyutping": 0x2a, + "kkcor": 0x2b, + "kociewie": 0x2c, + "kscor": 0x2d, + "laukika": 0x2e, + "lemosin": 0x2f, + "lengadoc": 0x30, + "lipaw": 0x5d, + "luna1918": 0x31, + "metelko": 0x32, + "monoton": 0x33, + "ndyuka": 0x34, + "nedis": 0x35, + "newfound": 0x36, + "nicard": 0x37, + "njiva": 0x5e, + "nulik": 0x38, + "osojs": 0x5f, + "oxendict": 0x39, + "pahawh2": 0x3a, + "pahawh3": 0x3b, + "pahawh4": 0x3c, + "pamaka": 0x3d, + "peano": 0x3e, + "petr1708": 0x3f, + "pinyin": 0x40, + "polyton": 0x41, + "provenc": 0x42, + "puter": 0x43, + "rigik": 0x44, + "rozaj": 0x45, + "rumgr": 0x46, + "scotland": 0x47, + "scouse": 0x48, + "simple": 0x69, + "solba": 0x60, + "sotav": 0x49, + "spanglis": 0x4a, + "surmiran": 0x4b, + "sursilv": 0x4c, + "sutsilv": 0x4d, + "tarask": 0x4e, + "tongyong": 0x4f, + "tunumiit": 0x50, + "uccor": 0x51, + "ucrcor": 0x52, + "ulster": 0x53, + "unifon": 0x54, + "vaidika": 0x55, + "valencia": 0x56, + "vallader": 0x57, + "vecdruka": 0x58, + "vivaraup": 0x59, + "wadegile": 0x5a, + "xsistemo": 0x5b, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 99 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1040 bytes, 260 elements +var likelyScript = [260]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 29: {lang: 0xf1, region: 0x6b}, + 31: {lang: 0x1a0, region: 0x5d}, + 32: {lang: 0x3e2, region: 0x106}, + 34: {lang: 0x1be, region: 0x99}, + 38: {lang: 0x15e, region: 0x78}, + 41: {lang: 0x133, region: 0x6b}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x6f}, + 46: {lang: 0x210, region: 0x7d}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x99}, + 50: {lang: 0x19e, region: 0x130}, + 51: {lang: 0x3e9, region: 0x99}, + 52: {lang: 0x136, region: 0x87}, + 53: {lang: 0x1a4, region: 0x99}, + 54: {lang: 0x39d, region: 0x99}, + 55: {lang: 0x529, region: 0x12e}, + 56: {lang: 0x254, region: 0xab}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe7}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12e}, + 61: {lang: 0x2fd, region: 0x9b}, + 62: {lang: 0x1bc, region: 0x97}, + 63: {lang: 0x200, region: 0xa2}, + 64: {lang: 0x1c5, region: 0x12b}, + 65: {lang: 0x1ca, region: 0xaf}, + 68: {lang: 0x1d5, region: 0x92}, + 70: {lang: 0x142, region: 0x9e}, + 71: {lang: 0x254, region: 0xab}, + 72: {lang: 0x20e, region: 0x95}, + 73: {lang: 0x200, region: 0xa2}, + 75: {lang: 0x135, region: 0xc4}, + 76: {lang: 0x200, region: 0xa2}, + 77: {lang: 0x3bb, region: 0xe8}, + 78: {lang: 0x24a, region: 0xa6}, + 79: {lang: 0x3fa, region: 0x99}, + 82: {lang: 0x251, region: 0x99}, + 83: {lang: 0x254, region: 0xab}, + 85: {lang: 0x88, region: 0x99}, + 86: {lang: 0x370, region: 0x123}, + 87: {lang: 0x2b8, region: 0xaf}, + 92: {lang: 0x29f, region: 0x99}, + 93: {lang: 0x2a8, region: 0x99}, + 94: {lang: 0x28f, region: 0x87}, + 95: {lang: 0x1a0, region: 0x87}, + 96: {lang: 0x2ac, region: 0x53}, + 98: {lang: 0x4f4, region: 0x12b}, + 99: {lang: 0x4f5, region: 0x12b}, + 100: {lang: 0x1be, region: 0x99}, + 102: {lang: 0x337, region: 0x9c}, + 103: {lang: 0x4f7, region: 0x53}, + 104: {lang: 0xa9, region: 0x53}, + 107: {lang: 0x2e8, region: 0x112}, + 108: {lang: 0x4f8, region: 0x10b}, + 109: {lang: 0x4f8, region: 0x10b}, + 110: {lang: 0x304, region: 0x99}, + 111: {lang: 0x31b, region: 0x99}, + 112: {lang: 0x30b, region: 0x53}, + 114: {lang: 0x31e, region: 0x35}, + 115: {lang: 0x30e, region: 0x99}, + 116: {lang: 0x414, region: 0xe8}, + 117: {lang: 0x331, region: 0xc4}, + 119: {lang: 0x4f9, region: 0x108}, + 120: {lang: 0x3b, region: 0xa1}, + 121: {lang: 0x353, region: 0xdb}, + 124: {lang: 0x2d0, region: 0x84}, + 125: {lang: 0x52a, region: 0x53}, + 126: {lang: 0x403, region: 0x96}, + 127: {lang: 0x3ee, region: 0x99}, + 128: {lang: 0x39b, region: 0xc5}, + 129: {lang: 0x395, region: 0x99}, + 130: {lang: 0x399, region: 0x135}, + 131: {lang: 0x429, region: 0x115}, + 133: {lang: 0x3b, region: 0x11c}, + 134: {lang: 0xfd, region: 0xc4}, + 137: {lang: 0x27d, region: 0x106}, + 138: {lang: 0x2c9, region: 0x53}, + 139: {lang: 0x39f, region: 0x9c}, + 140: {lang: 0x39f, region: 0x53}, + 142: {lang: 0x3ad, region: 0xb0}, + 144: {lang: 0x1c6, region: 0x53}, + 145: {lang: 0x4fd, region: 0x9c}, + 198: {lang: 0x3cb, region: 0x95}, + 201: {lang: 0x372, region: 0x10c}, + 202: {lang: 0x420, region: 0x97}, + 204: {lang: 0x4ff, region: 0x15e}, + 205: {lang: 0x3f0, region: 0x99}, + 206: {lang: 0x45, region: 0x135}, + 207: {lang: 0x139, region: 0x7b}, + 208: {lang: 0x3e9, region: 0x99}, + 210: {lang: 0x3e9, region: 0x99}, + 211: {lang: 0x3fa, region: 0x99}, + 212: {lang: 0x40c, region: 0xb3}, + 215: {lang: 0x433, region: 0x99}, + 216: {lang: 0xef, region: 0xc5}, + 217: {lang: 0x43e, region: 0x95}, + 218: {lang: 0x44d, region: 0x35}, + 219: {lang: 0x44e, region: 0x9b}, + 223: {lang: 0x45a, region: 0xe7}, + 224: {lang: 0x11a, region: 0x99}, + 225: {lang: 0x45e, region: 0x53}, + 226: {lang: 0x232, region: 0x53}, + 227: {lang: 0x450, region: 0x99}, + 228: {lang: 0x4a5, region: 0x53}, + 229: {lang: 0x9f, region: 0x13e}, + 230: {lang: 0x461, region: 0x99}, + 232: {lang: 0x528, region: 0xba}, + 233: {lang: 0x153, region: 0xe7}, + 234: {lang: 0x128, region: 0xcd}, + 235: {lang: 0x46b, region: 0x123}, + 236: {lang: 0xa9, region: 0x53}, + 237: {lang: 0x2ce, region: 0x99}, + 240: {lang: 0x4ad, region: 0x11c}, + 241: {lang: 0x4be, region: 0xb4}, + 244: {lang: 0x1ce, region: 0x99}, + 247: {lang: 0x3a9, region: 0x9c}, + 248: {lang: 0x22, region: 0x9b}, + 250: {lang: 0x1ea, region: 0x53}, + 251: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x5a, flags: 0x0}, + 1: {region: 0x6f, script: 0x5a, flags: 0x0}, + 2: {region: 0x165, script: 0x5a, flags: 0x0}, + 3: {region: 0x165, script: 0x5a, flags: 0x0}, + 4: {region: 0x165, script: 0x5a, flags: 0x0}, + 5: {region: 0x7d, script: 0x20, flags: 0x0}, + 6: {region: 0x165, script: 0x5a, flags: 0x0}, + 7: {region: 0x165, script: 0x20, flags: 0x0}, + 8: {region: 0x80, script: 0x5a, flags: 0x0}, + 9: {region: 0x165, script: 0x5a, flags: 0x0}, + 10: {region: 0x165, script: 0x5a, flags: 0x0}, + 11: {region: 0x165, script: 0x5a, flags: 0x0}, + 12: {region: 0x95, script: 0x5a, flags: 0x0}, + 13: {region: 0x131, script: 0x5a, flags: 0x0}, + 14: {region: 0x80, script: 0x5a, flags: 0x0}, + 15: {region: 0x165, script: 0x5a, flags: 0x0}, + 16: {region: 0x165, script: 0x5a, flags: 0x0}, + 17: {region: 0x106, script: 0x20, flags: 0x0}, + 18: {region: 0x165, script: 0x5a, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x5a, flags: 0x0}, + 22: {region: 0x161, script: 0x5a, flags: 0x0}, + 23: {region: 0x165, script: 0x5a, flags: 0x0}, + 24: {region: 0x165, script: 0x5a, flags: 0x0}, + 25: {region: 0x165, script: 0x5a, flags: 0x0}, + 26: {region: 0x165, script: 0x5a, flags: 0x0}, + 27: {region: 0x165, script: 0x5a, flags: 0x0}, + 28: {region: 0x52, script: 0x5a, flags: 0x0}, + 29: {region: 0x165, script: 0x5a, flags: 0x0}, + 30: {region: 0x165, script: 0x5a, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x5a, flags: 0x0}, + 33: {region: 0x80, script: 0x5a, flags: 0x0}, + 34: {region: 0x9b, script: 0xf8, flags: 0x0}, + 35: {region: 0x165, script: 0x5a, flags: 0x0}, + 36: {region: 0x165, script: 0x5a, flags: 0x0}, + 37: {region: 0x14d, script: 0x5a, flags: 0x0}, + 38: {region: 0x106, script: 0x20, flags: 0x0}, + 39: {region: 0x6f, script: 0x2c, flags: 0x0}, + 40: {region: 0x165, script: 0x5a, flags: 0x0}, + 41: {region: 0x165, script: 0x5a, flags: 0x0}, + 42: {region: 0xd6, script: 0x5a, flags: 0x0}, + 43: {region: 0x165, script: 0x5a, flags: 0x0}, + 45: {region: 0x165, script: 0x5a, flags: 0x0}, + 46: {region: 0x165, script: 0x5a, flags: 0x0}, + 47: {region: 0x165, script: 0x5a, flags: 0x0}, + 48: {region: 0x165, script: 0x5a, flags: 0x0}, + 49: {region: 0x165, script: 0x5a, flags: 0x0}, + 50: {region: 0x165, script: 0x5a, flags: 0x0}, + 51: {region: 0x95, script: 0x5a, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x5a, flags: 0x0}, + 55: {region: 0x165, script: 0x5a, flags: 0x0}, + 56: {region: 0x165, script: 0x5a, flags: 0x0}, + 57: {region: 0x165, script: 0x5a, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x5a, flags: 0x0}, + 61: {region: 0x51, script: 0x5a, flags: 0x0}, + 62: {region: 0x3f, script: 0x5a, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x5a, flags: 0x0}, + 69: {region: 0x135, script: 0xce, flags: 0x0}, + 70: {region: 0x165, script: 0x5a, flags: 0x0}, + 71: {region: 0x165, script: 0x5a, flags: 0x0}, + 72: {region: 0x6e, script: 0x5a, flags: 0x0}, + 73: {region: 0x165, script: 0x5a, flags: 0x0}, + 74: {region: 0x165, script: 0x5a, flags: 0x0}, + 75: {region: 0x49, script: 0x5a, flags: 0x0}, + 76: {region: 0x165, script: 0x5a, flags: 0x0}, + 77: {region: 0x106, script: 0x20, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x5a, flags: 0x0}, + 80: {region: 0x165, script: 0x5a, flags: 0x0}, + 81: {region: 0x165, script: 0x5a, flags: 0x0}, + 82: {region: 0x99, script: 0x22, flags: 0x0}, + 83: {region: 0x165, script: 0x5a, flags: 0x0}, + 84: {region: 0x165, script: 0x5a, flags: 0x0}, + 85: {region: 0x165, script: 0x5a, flags: 0x0}, + 86: {region: 0x3f, script: 0x5a, flags: 0x0}, + 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x20, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x5a, flags: 0x0}, + 92: {region: 0xdb, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5a, flags: 0x0}, + 94: {region: 0x52, script: 0x5a, flags: 0x0}, + 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x5a, flags: 0x0}, + 98: {region: 0x165, script: 0x5a, flags: 0x0}, + 99: {region: 0x95, script: 0x5a, flags: 0x0}, + 100: {region: 0x165, script: 0x5a, flags: 0x0}, + 101: {region: 0x52, script: 0x5a, flags: 0x0}, + 102: {region: 0x165, script: 0x5a, flags: 0x0}, + 103: {region: 0x165, script: 0x5a, flags: 0x0}, + 104: {region: 0x165, script: 0x5a, flags: 0x0}, + 105: {region: 0x165, script: 0x5a, flags: 0x0}, + 106: {region: 0x4f, script: 0x5a, flags: 0x0}, + 107: {region: 0x165, script: 0x5a, flags: 0x0}, + 108: {region: 0x165, script: 0x5a, flags: 0x0}, + 109: {region: 0x165, script: 0x5a, flags: 0x0}, + 110: {region: 0x165, script: 0x2c, flags: 0x0}, + 111: {region: 0x165, script: 0x5a, flags: 0x0}, + 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x165, script: 0x5a, flags: 0x0}, + 115: {region: 0x165, script: 0x5a, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x5a, flags: 0x0}, + 118: {region: 0x165, script: 0x5a, flags: 0x0}, + 119: {region: 0x95, script: 0x5a, flags: 0x0}, + 120: {region: 0x165, script: 0x5a, flags: 0x0}, + 121: {region: 0x12f, script: 0x5a, flags: 0x0}, + 122: {region: 0x52, script: 0x5a, flags: 0x0}, + 123: {region: 0x99, script: 0xe3, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x99, script: 0x22, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x34, flags: 0x0}, + 131: {region: 0x99, script: 0x22, flags: 0x0}, + 132: {region: 0x165, script: 0x5a, flags: 0x0}, + 133: {region: 0x99, script: 0x22, flags: 0x0}, + 134: {region: 0xe7, script: 0x5a, flags: 0x0}, + 135: {region: 0x165, script: 0x5a, flags: 0x0}, + 136: {region: 0x99, script: 0x22, flags: 0x0}, + 137: {region: 0x165, script: 0x5a, flags: 0x0}, + 138: {region: 0x13f, script: 0x5a, flags: 0x0}, + 139: {region: 0x165, script: 0x5a, flags: 0x0}, + 140: {region: 0x165, script: 0x5a, flags: 0x0}, + 141: {region: 0xe7, script: 0x5a, flags: 0x0}, + 142: {region: 0x165, script: 0x5a, flags: 0x0}, + 143: {region: 0xd6, script: 0x5a, flags: 0x0}, + 144: {region: 0x165, script: 0x5a, flags: 0x0}, + 145: {region: 0x165, script: 0x5a, flags: 0x0}, + 146: {region: 0x165, script: 0x5a, flags: 0x0}, + 147: {region: 0x165, script: 0x2c, flags: 0x0}, + 148: {region: 0x99, script: 0x22, flags: 0x0}, + 149: {region: 0x95, script: 0x5a, flags: 0x0}, + 150: {region: 0x165, script: 0x5a, flags: 0x0}, + 151: {region: 0x165, script: 0x5a, flags: 0x0}, + 152: {region: 0x114, script: 0x5a, flags: 0x0}, + 153: {region: 0x165, script: 0x5a, flags: 0x0}, + 154: {region: 0x165, script: 0x5a, flags: 0x0}, + 155: {region: 0x52, script: 0x5a, flags: 0x0}, + 156: {region: 0x165, script: 0x5a, flags: 0x0}, + 157: {region: 0xe7, script: 0x5a, flags: 0x0}, + 158: {region: 0x165, script: 0x5a, flags: 0x0}, + 159: {region: 0x13e, script: 0xe5, flags: 0x0}, + 160: {region: 0xc3, script: 0x5a, flags: 0x0}, + 161: {region: 0x165, script: 0x5a, flags: 0x0}, + 162: {region: 0x165, script: 0x5a, flags: 0x0}, + 163: {region: 0xc3, script: 0x5a, flags: 0x0}, + 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x5a, flags: 0x0}, + 167: {region: 0x165, script: 0x5a, flags: 0x0}, + 168: {region: 0x165, script: 0x5a, flags: 0x0}, + 169: {region: 0x53, script: 0xec, flags: 0x0}, + 170: {region: 0x165, script: 0x5a, flags: 0x0}, + 171: {region: 0x165, script: 0x5a, flags: 0x0}, + 172: {region: 0x165, script: 0x5a, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x5a, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x5a, flags: 0x0}, + 177: {region: 0x4f, script: 0x5a, flags: 0x0}, + 178: {region: 0x78, script: 0x5a, flags: 0x0}, + 179: {region: 0x99, script: 0x22, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x22, flags: 0x0}, + 182: {region: 0x165, script: 0x5a, flags: 0x0}, + 183: {region: 0x33, script: 0x5a, flags: 0x0}, + 184: {region: 0x165, script: 0x5a, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5a, flags: 0x0}, + 187: {region: 0x165, script: 0x2c, flags: 0x0}, + 188: {region: 0xe7, script: 0x5a, flags: 0x0}, + 189: {region: 0x165, script: 0x5a, flags: 0x0}, + 190: {region: 0xe8, script: 0x22, flags: 0x0}, + 191: {region: 0x106, script: 0x20, flags: 0x0}, + 192: {region: 0x15f, script: 0x5a, flags: 0x0}, + 193: {region: 0x165, script: 0x5a, flags: 0x0}, + 194: {region: 0x95, script: 0x5a, flags: 0x0}, + 195: {region: 0x165, script: 0x5a, flags: 0x0}, + 196: {region: 0x52, script: 0x5a, flags: 0x0}, + 197: {region: 0x165, script: 0x5a, flags: 0x0}, + 198: {region: 0x165, script: 0x5a, flags: 0x0}, + 199: {region: 0x165, script: 0x5a, flags: 0x0}, + 200: {region: 0x86, script: 0x5a, flags: 0x0}, + 201: {region: 0x165, script: 0x5a, flags: 0x0}, + 202: {region: 0x165, script: 0x5a, flags: 0x0}, + 203: {region: 0x165, script: 0x5a, flags: 0x0}, + 204: {region: 0x165, script: 0x5a, flags: 0x0}, + 205: {region: 0x6d, script: 0x2c, flags: 0x0}, + 206: {region: 0x165, script: 0x5a, flags: 0x0}, + 207: {region: 0x165, script: 0x5a, flags: 0x0}, + 208: {region: 0x52, script: 0x5a, flags: 0x0}, + 209: {region: 0x165, script: 0x5a, flags: 0x0}, + 210: {region: 0x165, script: 0x5a, flags: 0x0}, + 211: {region: 0xc3, script: 0x5a, flags: 0x0}, + 212: {region: 0x165, script: 0x5a, flags: 0x0}, + 213: {region: 0x165, script: 0x5a, flags: 0x0}, + 214: {region: 0x165, script: 0x5a, flags: 0x0}, + 215: {region: 0x6e, script: 0x5a, flags: 0x0}, + 216: {region: 0x165, script: 0x5a, flags: 0x0}, + 217: {region: 0x165, script: 0x5a, flags: 0x0}, + 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x20, flags: 0x0}, + 221: {region: 0xe7, script: 0x5a, flags: 0x0}, + 222: {region: 0x165, script: 0x5a, flags: 0x0}, + 223: {region: 0x131, script: 0x5a, flags: 0x0}, + 224: {region: 0x8a, script: 0x5a, flags: 0x0}, + 225: {region: 0x75, script: 0x5a, flags: 0x0}, + 226: {region: 0x106, script: 0x20, flags: 0x0}, + 227: {region: 0x135, script: 0x5a, flags: 0x0}, + 228: {region: 0x49, script: 0x5a, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x5a, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x5a, flags: 0x0}, + 235: {region: 0x165, script: 0x5a, flags: 0x0}, + 236: {region: 0x165, script: 0x5a, flags: 0x0}, + 237: {region: 0x165, script: 0x5a, flags: 0x0}, + 238: {region: 0x165, script: 0x5a, flags: 0x0}, + 239: {region: 0xc5, script: 0xd8, flags: 0x0}, + 240: {region: 0x78, script: 0x5a, flags: 0x0}, + 241: {region: 0x6b, script: 0x1d, flags: 0x0}, + 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x5a, flags: 0x0}, + 250: {region: 0x5e, script: 0x5a, flags: 0x0}, + 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x20, flags: 0x0}, + 256: {region: 0x7b, script: 0x5a, flags: 0x0}, + 257: {region: 0x63, script: 0x5a, flags: 0x0}, + 258: {region: 0x165, script: 0x5a, flags: 0x0}, + 259: {region: 0x165, script: 0x5a, flags: 0x0}, + 260: {region: 0x165, script: 0x5a, flags: 0x0}, + 261: {region: 0x165, script: 0x5a, flags: 0x0}, + 262: {region: 0x135, script: 0x5a, flags: 0x0}, + 263: {region: 0x106, script: 0x20, flags: 0x0}, + 264: {region: 0xa4, script: 0x5a, flags: 0x0}, + 265: {region: 0x165, script: 0x5a, flags: 0x0}, + 266: {region: 0x165, script: 0x5a, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x5a, flags: 0x0}, + 269: {region: 0x60, script: 0x5a, flags: 0x0}, + 270: {region: 0x165, script: 0x5a, flags: 0x0}, + 271: {region: 0x49, script: 0x5a, flags: 0x0}, + 272: {region: 0x165, script: 0x5a, flags: 0x0}, + 273: {region: 0x165, script: 0x5a, flags: 0x0}, + 274: {region: 0x165, script: 0x5a, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5a, flags: 0x0}, + 277: {region: 0x165, script: 0x5a, flags: 0x0}, + 278: {region: 0x165, script: 0x5a, flags: 0x0}, + 279: {region: 0xd4, script: 0x5a, flags: 0x0}, + 280: {region: 0x4f, script: 0x5a, flags: 0x0}, + 281: {region: 0x165, script: 0x5a, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x5a, flags: 0x0}, + 284: {region: 0x165, script: 0x5a, flags: 0x0}, + 285: {region: 0x165, script: 0x5a, flags: 0x0}, + 286: {region: 0x165, script: 0x2c, flags: 0x0}, + 287: {region: 0x60, script: 0x5a, flags: 0x0}, + 288: {region: 0xc3, script: 0x5a, flags: 0x0}, + 289: {region: 0xd0, script: 0x5a, flags: 0x0}, + 290: {region: 0x165, script: 0x5a, flags: 0x0}, + 291: {region: 0xdb, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5a, flags: 0x0}, + 293: {region: 0x165, script: 0x5a, flags: 0x0}, + 294: {region: 0x165, script: 0x5a, flags: 0x0}, + 295: {region: 0x165, script: 0x5a, flags: 0x0}, + 296: {region: 0xcd, script: 0xea, flags: 0x0}, + 297: {region: 0x165, script: 0x5a, flags: 0x0}, + 298: {region: 0x165, script: 0x5a, flags: 0x0}, + 299: {region: 0x114, script: 0x5a, flags: 0x0}, + 300: {region: 0x37, script: 0x5a, flags: 0x0}, + 301: {region: 0x43, script: 0xec, flags: 0x0}, + 302: {region: 0x165, script: 0x5a, flags: 0x0}, + 303: {region: 0xa4, script: 0x5a, flags: 0x0}, + 304: {region: 0x80, script: 0x5a, flags: 0x0}, + 305: {region: 0xd6, script: 0x5a, flags: 0x0}, + 306: {region: 0x9e, script: 0x5a, flags: 0x0}, + 307: {region: 0x6b, script: 0x29, flags: 0x0}, + 308: {region: 0x165, script: 0x5a, flags: 0x0}, + 309: {region: 0xc4, script: 0x4b, flags: 0x0}, + 310: {region: 0x87, script: 0x34, flags: 0x0}, + 311: {region: 0x165, script: 0x5a, flags: 0x0}, + 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x5a, flags: 0x0}, + 315: {region: 0x165, script: 0x5a, flags: 0x0}, + 316: {region: 0x1, script: 0x5a, flags: 0x0}, + 317: {region: 0x165, script: 0x5a, flags: 0x0}, + 318: {region: 0x6e, script: 0x5a, flags: 0x0}, + 319: {region: 0x135, script: 0x5a, flags: 0x0}, + 320: {region: 0x6a, script: 0x5a, flags: 0x0}, + 321: {region: 0x165, script: 0x5a, flags: 0x0}, + 322: {region: 0x9e, script: 0x46, flags: 0x0}, + 323: {region: 0x165, script: 0x5a, flags: 0x0}, + 324: {region: 0x165, script: 0x5a, flags: 0x0}, + 325: {region: 0x6e, script: 0x5a, flags: 0x0}, + 326: {region: 0x52, script: 0x5a, flags: 0x0}, + 327: {region: 0x6e, script: 0x5a, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x5a, flags: 0x0}, + 330: {region: 0x165, script: 0x5a, flags: 0x0}, + 331: {region: 0x165, script: 0x5a, flags: 0x0}, + 332: {region: 0x165, script: 0x5a, flags: 0x0}, + 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x5a, flags: 0x0}, + 336: {region: 0xc3, script: 0x5a, flags: 0x0}, + 337: {region: 0x72, script: 0x5a, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x5a, flags: 0x0}, + 340: {region: 0x10c, script: 0x5a, flags: 0x0}, + 341: {region: 0x73, script: 0x5a, flags: 0x0}, + 342: {region: 0x165, script: 0x5a, flags: 0x0}, + 343: {region: 0x165, script: 0x5a, flags: 0x0}, + 344: {region: 0x76, script: 0x5a, flags: 0x0}, + 345: {region: 0x165, script: 0x5a, flags: 0x0}, + 346: {region: 0x3b, script: 0x5a, flags: 0x0}, + 347: {region: 0x165, script: 0x5a, flags: 0x0}, + 348: {region: 0x165, script: 0x5a, flags: 0x0}, + 349: {region: 0x165, script: 0x5a, flags: 0x0}, + 350: {region: 0x78, script: 0x5a, flags: 0x0}, + 351: {region: 0x135, script: 0x5a, flags: 0x0}, + 352: {region: 0x78, script: 0x5a, flags: 0x0}, + 353: {region: 0x60, script: 0x5a, flags: 0x0}, + 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x5a, flags: 0x0}, + 357: {region: 0x165, script: 0x5a, flags: 0x0}, + 358: {region: 0x84, script: 0x5a, flags: 0x0}, + 359: {region: 0x165, script: 0x5a, flags: 0x0}, + 360: {region: 0xd4, script: 0x5a, flags: 0x0}, + 361: {region: 0x9e, script: 0x5a, flags: 0x0}, + 362: {region: 0xd6, script: 0x5a, flags: 0x0}, + 363: {region: 0x165, script: 0x5a, flags: 0x0}, + 364: {region: 0x10b, script: 0x5a, flags: 0x0}, + 365: {region: 0xd9, script: 0x5a, flags: 0x0}, + 366: {region: 0x96, script: 0x5a, flags: 0x0}, + 367: {region: 0x80, script: 0x5a, flags: 0x0}, + 368: {region: 0x165, script: 0x5a, flags: 0x0}, + 369: {region: 0xbc, script: 0x5a, flags: 0x0}, + 370: {region: 0x165, script: 0x5a, flags: 0x0}, + 371: {region: 0x165, script: 0x5a, flags: 0x0}, + 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x165, script: 0x5a, flags: 0x0}, + 375: {region: 0x95, script: 0x5a, flags: 0x0}, + 376: {region: 0x165, script: 0x5a, flags: 0x0}, + 377: {region: 0x165, script: 0x5a, flags: 0x0}, + 378: {region: 0x99, script: 0x22, flags: 0x0}, + 379: {region: 0x165, script: 0x5a, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x5a, flags: 0x0}, + 382: {region: 0x7b, script: 0x5a, flags: 0x0}, + 383: {region: 0x165, script: 0x5a, flags: 0x0}, + 384: {region: 0x165, script: 0x5a, flags: 0x0}, + 385: {region: 0x165, script: 0x5a, flags: 0x0}, + 386: {region: 0x165, script: 0x5a, flags: 0x0}, + 387: {region: 0x165, script: 0x5a, flags: 0x0}, + 388: {region: 0x165, script: 0x5a, flags: 0x0}, + 389: {region: 0x6f, script: 0x2c, flags: 0x0}, + 390: {region: 0x165, script: 0x5a, flags: 0x0}, + 391: {region: 0xdb, script: 0x22, flags: 0x0}, + 392: {region: 0x165, script: 0x5a, flags: 0x0}, + 393: {region: 0xa7, script: 0x5a, flags: 0x0}, + 394: {region: 0x165, script: 0x5a, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x5a, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x5a, flags: 0x0}, + 399: {region: 0x165, script: 0x5a, flags: 0x0}, + 400: {region: 0x6e, script: 0x5a, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x5a, flags: 0x0}, + 403: {region: 0x165, script: 0x2c, flags: 0x0}, + 404: {region: 0xf1, script: 0x5a, flags: 0x0}, + 405: {region: 0x165, script: 0x5a, flags: 0x0}, + 406: {region: 0x165, script: 0x5a, flags: 0x0}, + 407: {region: 0x165, script: 0x5a, flags: 0x0}, + 408: {region: 0x165, script: 0x2c, flags: 0x0}, + 409: {region: 0x165, script: 0x5a, flags: 0x0}, + 410: {region: 0x99, script: 0x22, flags: 0x0}, + 411: {region: 0x99, script: 0xe6, flags: 0x0}, + 412: {region: 0x95, script: 0x5a, flags: 0x0}, + 413: {region: 0xd9, script: 0x5a, flags: 0x0}, + 414: {region: 0x130, script: 0x32, flags: 0x0}, + 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x5a, flags: 0x0}, + 419: {region: 0x4e, script: 0x5a, flags: 0x0}, + 420: {region: 0x99, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5a, flags: 0x0}, + 422: {region: 0x54, script: 0x5a, flags: 0x0}, + 423: {region: 0x165, script: 0x5a, flags: 0x0}, + 424: {region: 0x80, script: 0x5a, flags: 0x0}, + 425: {region: 0x165, script: 0x5a, flags: 0x0}, + 426: {region: 0x165, script: 0x5a, flags: 0x0}, + 427: {region: 0xa4, script: 0x5a, flags: 0x0}, + 428: {region: 0x98, script: 0x5a, flags: 0x0}, + 429: {region: 0x165, script: 0x5a, flags: 0x0}, + 430: {region: 0xdb, script: 0x22, flags: 0x0}, + 431: {region: 0x165, script: 0x5a, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5a, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x165, script: 0x5a, flags: 0x0}, + 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x5a, flags: 0x0}, + 443: {region: 0x165, script: 0x2c, flags: 0x0}, + 444: {region: 0x97, script: 0x3e, flags: 0x0}, + 445: {region: 0x165, script: 0x5a, flags: 0x0}, + 446: {region: 0x99, script: 0x22, flags: 0x0}, + 447: {region: 0x165, script: 0x5a, flags: 0x0}, + 448: {region: 0x73, script: 0x5a, flags: 0x0}, + 449: {region: 0x165, script: 0x5a, flags: 0x0}, + 450: {region: 0x165, script: 0x5a, flags: 0x0}, + 451: {region: 0xe7, script: 0x5a, flags: 0x0}, + 452: {region: 0x165, script: 0x5a, flags: 0x0}, + 453: {region: 0x12b, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x90, flags: 0x0}, + 455: {region: 0x165, script: 0x5a, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x22, flags: 0x0}, + 458: {region: 0xaf, script: 0x41, flags: 0x0}, + 459: {region: 0xe7, script: 0x5a, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x5a, flags: 0x0}, + 462: {region: 0x99, script: 0x22, flags: 0x0}, + 463: {region: 0x99, script: 0x22, flags: 0x0}, + 464: {region: 0x165, script: 0x5a, flags: 0x0}, + 465: {region: 0x90, script: 0x5a, flags: 0x0}, + 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x91, script: 0x5a, flags: 0x0}, + 469: {region: 0x92, script: 0x5a, flags: 0x0}, + 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x5a, flags: 0x0}, + 473: {region: 0x78, script: 0x5a, flags: 0x0}, + 474: {region: 0x165, script: 0x5a, flags: 0x0}, + 475: {region: 0x165, script: 0x5a, flags: 0x0}, + 476: {region: 0xd0, script: 0x5a, flags: 0x0}, + 477: {region: 0xd6, script: 0x5a, flags: 0x0}, + 478: {region: 0x165, script: 0x5a, flags: 0x0}, + 479: {region: 0x165, script: 0x5a, flags: 0x0}, + 480: {region: 0x165, script: 0x5a, flags: 0x0}, + 481: {region: 0x95, script: 0x5a, flags: 0x0}, + 482: {region: 0x165, script: 0x5a, flags: 0x0}, + 483: {region: 0x165, script: 0x5a, flags: 0x0}, + 484: {region: 0x165, script: 0x5a, flags: 0x0}, + 486: {region: 0x122, script: 0x5a, flags: 0x0}, + 487: {region: 0xd6, script: 0x5a, flags: 0x0}, + 488: {region: 0x165, script: 0x5a, flags: 0x0}, + 489: {region: 0x165, script: 0x5a, flags: 0x0}, + 490: {region: 0x53, script: 0xfa, flags: 0x0}, + 491: {region: 0x165, script: 0x5a, flags: 0x0}, + 492: {region: 0x135, script: 0x5a, flags: 0x0}, + 493: {region: 0x165, script: 0x5a, flags: 0x0}, + 494: {region: 0x49, script: 0x5a, flags: 0x0}, + 495: {region: 0x165, script: 0x5a, flags: 0x0}, + 496: {region: 0x165, script: 0x5a, flags: 0x0}, + 497: {region: 0xe7, script: 0x5a, flags: 0x0}, + 498: {region: 0x165, script: 0x5a, flags: 0x0}, + 499: {region: 0x95, script: 0x5a, flags: 0x0}, + 500: {region: 0x106, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5a, flags: 0x0}, + 502: {region: 0x165, script: 0x5a, flags: 0x0}, + 503: {region: 0x165, script: 0x5a, flags: 0x0}, + 504: {region: 0x9d, script: 0x5a, flags: 0x0}, + 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3e, flags: 0x0}, + 508: {region: 0x165, script: 0x5a, flags: 0x0}, + 509: {region: 0x165, script: 0x5a, flags: 0x0}, + 510: {region: 0x106, script: 0x5a, flags: 0x0}, + 511: {region: 0x165, script: 0x5a, flags: 0x0}, + 512: {region: 0xa2, script: 0x49, flags: 0x0}, + 513: {region: 0x165, script: 0x5a, flags: 0x0}, + 514: {region: 0xa0, script: 0x5a, flags: 0x0}, + 515: {region: 0x1, script: 0x5a, flags: 0x0}, + 516: {region: 0x165, script: 0x5a, flags: 0x0}, + 517: {region: 0x165, script: 0x5a, flags: 0x0}, + 518: {region: 0x165, script: 0x5a, flags: 0x0}, + 519: {region: 0x52, script: 0x5a, flags: 0x0}, + 520: {region: 0x130, script: 0x3e, flags: 0x0}, + 521: {region: 0x165, script: 0x5a, flags: 0x0}, + 522: {region: 0x12f, script: 0x5a, flags: 0x0}, + 523: {region: 0xdb, script: 0x22, flags: 0x0}, + 524: {region: 0x165, script: 0x5a, flags: 0x0}, + 525: {region: 0x63, script: 0x5a, flags: 0x0}, + 526: {region: 0x95, script: 0x5a, flags: 0x0}, + 527: {region: 0x95, script: 0x5a, flags: 0x0}, + 528: {region: 0x7d, script: 0x2e, flags: 0x0}, + 529: {region: 0x137, script: 0x20, flags: 0x0}, + 530: {region: 0x67, script: 0x5a, flags: 0x0}, + 531: {region: 0xc4, script: 0x5a, flags: 0x0}, + 532: {region: 0x165, script: 0x5a, flags: 0x0}, + 533: {region: 0x165, script: 0x5a, flags: 0x0}, + 534: {region: 0xd6, script: 0x5a, flags: 0x0}, + 535: {region: 0xa4, script: 0x5a, flags: 0x0}, + 536: {region: 0xc3, script: 0x5a, flags: 0x0}, + 537: {region: 0x106, script: 0x20, flags: 0x0}, + 538: {region: 0x165, script: 0x5a, flags: 0x0}, + 539: {region: 0x165, script: 0x5a, flags: 0x0}, + 540: {region: 0x165, script: 0x5a, flags: 0x0}, + 541: {region: 0x165, script: 0x5a, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x5a, flags: 0x0}, + 544: {region: 0x164, script: 0x5a, flags: 0x0}, + 545: {region: 0x165, script: 0x5a, flags: 0x0}, + 546: {region: 0x165, script: 0x5a, flags: 0x0}, + 547: {region: 0x12f, script: 0x5a, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x5a, flags: 0x0}, + 550: {region: 0x123, script: 0xeb, flags: 0x0}, + 551: {region: 0x5a, script: 0x5a, flags: 0x0}, + 552: {region: 0x52, script: 0x5a, flags: 0x0}, + 553: {region: 0x165, script: 0x5a, flags: 0x0}, + 554: {region: 0x4f, script: 0x5a, flags: 0x0}, + 555: {region: 0x99, script: 0x22, flags: 0x0}, + 556: {region: 0x99, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5a, flags: 0x0}, + 558: {region: 0x95, script: 0x5a, flags: 0x0}, + 559: {region: 0x165, script: 0x5a, flags: 0x0}, + 560: {region: 0x41, script: 0x5a, flags: 0x0}, + 561: {region: 0x99, script: 0x5a, flags: 0x0}, + 562: {region: 0x53, script: 0xe2, flags: 0x0}, + 563: {region: 0x99, script: 0x22, flags: 0x0}, + 564: {region: 0xc3, script: 0x5a, flags: 0x0}, + 565: {region: 0x165, script: 0x5a, flags: 0x0}, + 566: {region: 0x99, script: 0x75, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x5a, flags: 0x0}, + 569: {region: 0xa4, script: 0x5a, flags: 0x0}, + 570: {region: 0x165, script: 0x5a, flags: 0x0}, + 571: {region: 0x12b, script: 0x5a, flags: 0x0}, + 572: {region: 0x165, script: 0x5a, flags: 0x0}, + 573: {region: 0xd2, script: 0x5a, flags: 0x0}, + 574: {region: 0x165, script: 0x5a, flags: 0x0}, + 575: {region: 0xaf, script: 0x57, flags: 0x0}, + 576: {region: 0x165, script: 0x5a, flags: 0x0}, + 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x5a, flags: 0x0}, + 580: {region: 0x52, script: 0x5a, flags: 0x0}, + 581: {region: 0x82, script: 0x5a, flags: 0x0}, + 582: {region: 0xa4, script: 0x5a, flags: 0x0}, + 583: {region: 0x165, script: 0x5a, flags: 0x0}, + 584: {region: 0x165, script: 0x5a, flags: 0x0}, + 585: {region: 0x165, script: 0x5a, flags: 0x0}, + 586: {region: 0xa6, script: 0x4e, flags: 0x0}, + 587: {region: 0x2a, script: 0x5a, flags: 0x0}, + 588: {region: 0x165, script: 0x5a, flags: 0x0}, + 589: {region: 0x165, script: 0x5a, flags: 0x0}, + 590: {region: 0x165, script: 0x5a, flags: 0x0}, + 591: {region: 0x165, script: 0x5a, flags: 0x0}, + 592: {region: 0x165, script: 0x5a, flags: 0x0}, + 593: {region: 0x99, script: 0x52, flags: 0x0}, + 594: {region: 0x8b, script: 0x5a, flags: 0x0}, + 595: {region: 0x165, script: 0x5a, flags: 0x0}, + 596: {region: 0xab, script: 0x53, flags: 0x0}, + 597: {region: 0x106, script: 0x20, flags: 0x0}, + 598: {region: 0x99, script: 0x22, flags: 0x0}, + 599: {region: 0x165, script: 0x5a, flags: 0x0}, + 600: {region: 0x75, script: 0x5a, flags: 0x0}, + 601: {region: 0x165, script: 0x5a, flags: 0x0}, + 602: {region: 0xb4, script: 0x5a, flags: 0x0}, + 603: {region: 0x165, script: 0x5a, flags: 0x0}, + 604: {region: 0x165, script: 0x5a, flags: 0x0}, + 605: {region: 0x165, script: 0x5a, flags: 0x0}, + 606: {region: 0x165, script: 0x5a, flags: 0x0}, + 607: {region: 0x165, script: 0x5a, flags: 0x0}, + 608: {region: 0x165, script: 0x5a, flags: 0x0}, + 609: {region: 0x165, script: 0x5a, flags: 0x0}, + 610: {region: 0x165, script: 0x2c, flags: 0x0}, + 611: {region: 0x165, script: 0x5a, flags: 0x0}, + 612: {region: 0x106, script: 0x20, flags: 0x0}, + 613: {region: 0x112, script: 0x5a, flags: 0x0}, + 614: {region: 0xe7, script: 0x5a, flags: 0x0}, + 615: {region: 0x106, script: 0x5a, flags: 0x0}, + 616: {region: 0x165, script: 0x5a, flags: 0x0}, + 617: {region: 0x99, script: 0x22, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x5a, flags: 0x0}, + 620: {region: 0x165, script: 0x5a, flags: 0x0}, + 621: {region: 0x52, script: 0x5a, flags: 0x0}, + 622: {region: 0x60, script: 0x5a, flags: 0x0}, + 623: {region: 0x165, script: 0x5a, flags: 0x0}, + 624: {region: 0x165, script: 0x5a, flags: 0x0}, + 625: {region: 0x165, script: 0x2c, flags: 0x0}, + 626: {region: 0x165, script: 0x5a, flags: 0x0}, + 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x5a, flags: 0x0}, + 630: {region: 0x165, script: 0x5a, flags: 0x0}, + 631: {region: 0x165, script: 0x5a, flags: 0x0}, + 632: {region: 0x165, script: 0x5a, flags: 0x0}, + 633: {region: 0x106, script: 0x20, flags: 0x0}, + 634: {region: 0x165, script: 0x5a, flags: 0x0}, + 635: {region: 0x165, script: 0x5a, flags: 0x0}, + 636: {region: 0x165, script: 0x5a, flags: 0x0}, + 637: {region: 0x106, script: 0x20, flags: 0x0}, + 638: {region: 0x165, script: 0x5a, flags: 0x0}, + 639: {region: 0x95, script: 0x5a, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x5a, flags: 0x0}, + 642: {region: 0x165, script: 0x5a, flags: 0x0}, + 643: {region: 0x165, script: 0x5a, flags: 0x0}, + 644: {region: 0x165, script: 0x5a, flags: 0x0}, + 645: {region: 0x165, script: 0x2c, flags: 0x0}, + 646: {region: 0x123, script: 0xeb, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x5a, flags: 0x0}, + 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x5a, flags: 0x0}, + 652: {region: 0x165, script: 0x5a, flags: 0x0}, + 653: {region: 0x165, script: 0x5a, flags: 0x0}, + 654: {region: 0x138, script: 0x5a, flags: 0x0}, + 655: {region: 0x87, script: 0x5e, flags: 0x0}, + 656: {region: 0x97, script: 0x3e, flags: 0x0}, + 657: {region: 0x12f, script: 0x5a, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x5a, flags: 0x0}, + 660: {region: 0x165, script: 0x5a, flags: 0x0}, + 661: {region: 0xb7, script: 0x5a, flags: 0x0}, + 662: {region: 0x106, script: 0x20, flags: 0x0}, + 663: {region: 0x165, script: 0x5a, flags: 0x0}, + 664: {region: 0x95, script: 0x5a, flags: 0x0}, + 665: {region: 0x165, script: 0x5a, flags: 0x0}, + 666: {region: 0x53, script: 0xeb, flags: 0x0}, + 667: {region: 0x165, script: 0x5a, flags: 0x0}, + 668: {region: 0x165, script: 0x5a, flags: 0x0}, + 669: {region: 0x165, script: 0x5a, flags: 0x0}, + 670: {region: 0x165, script: 0x5a, flags: 0x0}, + 671: {region: 0x99, script: 0x5c, flags: 0x0}, + 672: {region: 0x165, script: 0x5a, flags: 0x0}, + 673: {region: 0x165, script: 0x5a, flags: 0x0}, + 674: {region: 0x106, script: 0x20, flags: 0x0}, + 675: {region: 0x131, script: 0x5a, flags: 0x0}, + 676: {region: 0x165, script: 0x5a, flags: 0x0}, + 677: {region: 0xd9, script: 0x5a, flags: 0x0}, + 678: {region: 0x165, script: 0x5a, flags: 0x0}, + 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x5a, flags: 0x0}, + 682: {region: 0x165, script: 0x5a, flags: 0x0}, + 683: {region: 0x9e, script: 0x5a, flags: 0x0}, + 684: {region: 0x53, script: 0x60, flags: 0x0}, + 685: {region: 0x95, script: 0x5a, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x5a, flags: 0x0}, + 688: {region: 0x165, script: 0x5a, flags: 0x0}, + 689: {region: 0x165, script: 0x5a, flags: 0x0}, + 690: {region: 0x99, script: 0xe6, flags: 0x0}, + 691: {region: 0x9e, script: 0x5a, flags: 0x0}, + 692: {region: 0x165, script: 0x5a, flags: 0x0}, + 693: {region: 0x4b, script: 0x5a, flags: 0x0}, + 694: {region: 0x165, script: 0x5a, flags: 0x0}, + 695: {region: 0x165, script: 0x5a, flags: 0x0}, + 696: {region: 0xaf, script: 0x57, flags: 0x0}, + 697: {region: 0x165, script: 0x5a, flags: 0x0}, + 698: {region: 0x165, script: 0x5a, flags: 0x0}, + 699: {region: 0x4b, script: 0x5a, flags: 0x0}, + 700: {region: 0x165, script: 0x5a, flags: 0x0}, + 701: {region: 0x165, script: 0x5a, flags: 0x0}, + 702: {region: 0x162, script: 0x5a, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x5a, flags: 0x0}, + 705: {region: 0xb8, script: 0x5a, flags: 0x0}, + 706: {region: 0x4b, script: 0x5a, flags: 0x0}, + 707: {region: 0x4b, script: 0x5a, flags: 0x0}, + 708: {region: 0xa4, script: 0x5a, flags: 0x0}, + 709: {region: 0xa4, script: 0x5a, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x5a, flags: 0x0}, + 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12b, script: 0x5a, flags: 0x0}, + 715: {region: 0x95, script: 0x5a, flags: 0x0}, + 716: {region: 0x52, script: 0x5a, flags: 0x0}, + 717: {region: 0x99, script: 0x22, flags: 0x0}, + 718: {region: 0x99, script: 0x22, flags: 0x0}, + 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x5a, flags: 0x0}, + 722: {region: 0x165, script: 0x5a, flags: 0x0}, + 723: {region: 0xcf, script: 0x5a, flags: 0x0}, + 724: {region: 0x165, script: 0x5a, flags: 0x0}, + 725: {region: 0x165, script: 0x5a, flags: 0x0}, + 726: {region: 0x165, script: 0x5a, flags: 0x0}, + 727: {region: 0x165, script: 0x5a, flags: 0x0}, + 728: {region: 0x165, script: 0x5a, flags: 0x0}, + 729: {region: 0x165, script: 0x5a, flags: 0x0}, + 730: {region: 0x165, script: 0x5a, flags: 0x0}, + 731: {region: 0x165, script: 0x5a, flags: 0x0}, + 732: {region: 0x165, script: 0x5a, flags: 0x0}, + 733: {region: 0x165, script: 0x5a, flags: 0x0}, + 734: {region: 0x165, script: 0x5a, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x20, flags: 0x0}, + 737: {region: 0xe7, script: 0x5a, flags: 0x0}, + 738: {region: 0x165, script: 0x5a, flags: 0x0}, + 739: {region: 0x95, script: 0x5a, flags: 0x0}, + 740: {region: 0x165, script: 0x2c, flags: 0x0}, + 741: {region: 0x165, script: 0x5a, flags: 0x0}, + 742: {region: 0x165, script: 0x5a, flags: 0x0}, + 743: {region: 0x165, script: 0x5a, flags: 0x0}, + 744: {region: 0x112, script: 0x5a, flags: 0x0}, + 745: {region: 0xa4, script: 0x5a, flags: 0x0}, + 746: {region: 0x165, script: 0x5a, flags: 0x0}, + 747: {region: 0x165, script: 0x5a, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x5a, flags: 0x0}, + 750: {region: 0x165, script: 0x5a, flags: 0x0}, + 751: {region: 0x165, script: 0x5a, flags: 0x0}, + 752: {region: 0x165, script: 0x5a, flags: 0x0}, + 753: {region: 0xbf, script: 0x5a, flags: 0x0}, + 754: {region: 0xd1, script: 0x5a, flags: 0x0}, + 755: {region: 0x165, script: 0x5a, flags: 0x0}, + 756: {region: 0x52, script: 0x5a, flags: 0x0}, + 757: {region: 0xdb, script: 0x22, flags: 0x0}, + 758: {region: 0x12f, script: 0x5a, flags: 0x0}, + 759: {region: 0xc0, script: 0x5a, flags: 0x0}, + 760: {region: 0x165, script: 0x5a, flags: 0x0}, + 761: {region: 0x165, script: 0x5a, flags: 0x0}, + 762: {region: 0xe0, script: 0x5a, flags: 0x0}, + 763: {region: 0x165, script: 0x5a, flags: 0x0}, + 764: {region: 0x95, script: 0x5a, flags: 0x0}, + 765: {region: 0x9b, script: 0x3d, flags: 0x0}, + 766: {region: 0x165, script: 0x5a, flags: 0x0}, + 767: {region: 0xc2, script: 0x20, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x5a, flags: 0x0}, + 770: {region: 0x165, script: 0x5a, flags: 0x0}, + 771: {region: 0x165, script: 0x5a, flags: 0x0}, + 772: {region: 0x99, script: 0x6e, flags: 0x0}, + 773: {region: 0x165, script: 0x5a, flags: 0x0}, + 774: {region: 0x165, script: 0x5a, flags: 0x0}, + 775: {region: 0x10b, script: 0x5a, flags: 0x0}, + 776: {region: 0x165, script: 0x5a, flags: 0x0}, + 777: {region: 0x165, script: 0x5a, flags: 0x0}, + 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x5a, flags: 0x0}, + 781: {region: 0x165, script: 0x5a, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x75, flags: 0x0}, + 785: {region: 0x165, script: 0x5a, flags: 0x0}, + 786: {region: 0x49, script: 0x5a, flags: 0x0}, + 787: {region: 0x49, script: 0x5a, flags: 0x0}, + 788: {region: 0x37, script: 0x5a, flags: 0x0}, + 789: {region: 0x165, script: 0x5a, flags: 0x0}, + 790: {region: 0x165, script: 0x5a, flags: 0x0}, + 791: {region: 0x165, script: 0x5a, flags: 0x0}, + 792: {region: 0x165, script: 0x5a, flags: 0x0}, + 793: {region: 0x165, script: 0x5a, flags: 0x0}, + 794: {region: 0x165, script: 0x5a, flags: 0x0}, + 795: {region: 0x99, script: 0x22, flags: 0x0}, + 796: {region: 0xdb, script: 0x22, flags: 0x0}, + 797: {region: 0x106, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x72, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x5a, flags: 0x0}, + 801: {region: 0x165, script: 0x5a, flags: 0x0}, + 802: {region: 0x165, script: 0x5a, flags: 0x0}, + 803: {region: 0x165, script: 0x5a, flags: 0x0}, + 804: {region: 0x99, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5a, flags: 0x0}, + 807: {region: 0x165, script: 0x5a, flags: 0x0}, + 808: {region: 0x135, script: 0x5a, flags: 0x0}, + 809: {region: 0x165, script: 0x5a, flags: 0x0}, + 810: {region: 0x165, script: 0x5a, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x5a, flags: 0x0}, + 813: {region: 0x99, script: 0x22, flags: 0x0}, + 814: {region: 0x95, script: 0x5a, flags: 0x0}, + 815: {region: 0x164, script: 0x5a, flags: 0x0}, + 816: {region: 0x165, script: 0x5a, flags: 0x0}, + 817: {region: 0xc4, script: 0x75, flags: 0x0}, + 818: {region: 0x165, script: 0x5a, flags: 0x0}, + 819: {region: 0x165, script: 0x2c, flags: 0x0}, + 820: {region: 0x106, script: 0x20, flags: 0x0}, + 821: {region: 0x165, script: 0x5a, flags: 0x0}, + 822: {region: 0x131, script: 0x5a, flags: 0x0}, + 823: {region: 0x9c, script: 0x66, flags: 0x0}, + 824: {region: 0x165, script: 0x5a, flags: 0x0}, + 825: {region: 0x165, script: 0x5a, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x5a, flags: 0x0}, + 828: {region: 0x165, script: 0x5a, flags: 0x0}, + 829: {region: 0x165, script: 0x5a, flags: 0x0}, + 830: {region: 0xdd, script: 0x5a, flags: 0x0}, + 831: {region: 0x165, script: 0x5a, flags: 0x0}, + 832: {region: 0x165, script: 0x5a, flags: 0x0}, + 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9e, script: 0x5a, flags: 0x0}, + 837: {region: 0xd2, script: 0x5a, flags: 0x0}, + 838: {region: 0x165, script: 0x5a, flags: 0x0}, + 839: {region: 0xda, script: 0x5a, flags: 0x0}, + 840: {region: 0x165, script: 0x5a, flags: 0x0}, + 841: {region: 0x165, script: 0x5a, flags: 0x0}, + 842: {region: 0x165, script: 0x5a, flags: 0x0}, + 843: {region: 0xcf, script: 0x5a, flags: 0x0}, + 844: {region: 0x165, script: 0x5a, flags: 0x0}, + 845: {region: 0x165, script: 0x5a, flags: 0x0}, + 846: {region: 0x164, script: 0x5a, flags: 0x0}, + 847: {region: 0xd1, script: 0x5a, flags: 0x0}, + 848: {region: 0x60, script: 0x5a, flags: 0x0}, + 849: {region: 0xdb, script: 0x22, flags: 0x0}, + 850: {region: 0x165, script: 0x5a, flags: 0x0}, + 851: {region: 0xdb, script: 0x22, flags: 0x0}, + 852: {region: 0x165, script: 0x5a, flags: 0x0}, + 853: {region: 0x165, script: 0x5a, flags: 0x0}, + 854: {region: 0xd2, script: 0x5a, flags: 0x0}, + 855: {region: 0x165, script: 0x5a, flags: 0x0}, + 856: {region: 0x165, script: 0x5a, flags: 0x0}, + 857: {region: 0xd1, script: 0x5a, flags: 0x0}, + 858: {region: 0x165, script: 0x5a, flags: 0x0}, + 859: {region: 0xcf, script: 0x5a, flags: 0x0}, + 860: {region: 0xcf, script: 0x5a, flags: 0x0}, + 861: {region: 0x165, script: 0x5a, flags: 0x0}, + 862: {region: 0x165, script: 0x5a, flags: 0x0}, + 863: {region: 0x95, script: 0x5a, flags: 0x0}, + 864: {region: 0x165, script: 0x5a, flags: 0x0}, + 865: {region: 0xdf, script: 0x5a, flags: 0x0}, + 866: {region: 0x165, script: 0x5a, flags: 0x0}, + 867: {region: 0x165, script: 0x5a, flags: 0x0}, + 868: {region: 0x99, script: 0x5a, flags: 0x0}, + 869: {region: 0x165, script: 0x5a, flags: 0x0}, + 870: {region: 0x165, script: 0x5a, flags: 0x0}, + 871: {region: 0xd9, script: 0x5a, flags: 0x0}, + 872: {region: 0x52, script: 0x5a, flags: 0x0}, + 873: {region: 0x165, script: 0x5a, flags: 0x0}, + 874: {region: 0xda, script: 0x5a, flags: 0x0}, + 875: {region: 0x165, script: 0x5a, flags: 0x0}, + 876: {region: 0x52, script: 0x5a, flags: 0x0}, + 877: {region: 0x165, script: 0x5a, flags: 0x0}, + 878: {region: 0x165, script: 0x5a, flags: 0x0}, + 879: {region: 0xda, script: 0x5a, flags: 0x0}, + 880: {region: 0x123, script: 0x56, flags: 0x0}, + 881: {region: 0x99, script: 0x22, flags: 0x0}, + 882: {region: 0x10c, script: 0xc9, flags: 0x0}, + 883: {region: 0x165, script: 0x5a, flags: 0x0}, + 884: {region: 0x165, script: 0x5a, flags: 0x0}, + 885: {region: 0x84, script: 0x7c, flags: 0x0}, + 886: {region: 0x161, script: 0x5a, flags: 0x0}, + 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x5a, flags: 0x0}, + 890: {region: 0x161, script: 0x5a, flags: 0x0}, + 891: {region: 0x165, script: 0x5a, flags: 0x0}, + 892: {region: 0x165, script: 0x5a, flags: 0x0}, + 893: {region: 0x165, script: 0x5a, flags: 0x0}, + 894: {region: 0x165, script: 0x5a, flags: 0x0}, + 895: {region: 0x165, script: 0x5a, flags: 0x0}, + 896: {region: 0x117, script: 0x5a, flags: 0x0}, + 897: {region: 0x165, script: 0x5a, flags: 0x0}, + 898: {region: 0x165, script: 0x5a, flags: 0x0}, + 899: {region: 0x135, script: 0x5a, flags: 0x0}, + 900: {region: 0x165, script: 0x5a, flags: 0x0}, + 901: {region: 0x53, script: 0x5a, flags: 0x0}, + 902: {region: 0x165, script: 0x5a, flags: 0x0}, + 903: {region: 0xce, script: 0x5a, flags: 0x0}, + 904: {region: 0x12f, script: 0x5a, flags: 0x0}, + 905: {region: 0x131, script: 0x5a, flags: 0x0}, + 906: {region: 0x80, script: 0x5a, flags: 0x0}, + 907: {region: 0x78, script: 0x5a, flags: 0x0}, + 908: {region: 0x165, script: 0x5a, flags: 0x0}, + 910: {region: 0x165, script: 0x5a, flags: 0x0}, + 911: {region: 0x165, script: 0x5a, flags: 0x0}, + 912: {region: 0x6f, script: 0x5a, flags: 0x0}, + 913: {region: 0x165, script: 0x5a, flags: 0x0}, + 914: {region: 0x165, script: 0x5a, flags: 0x0}, + 915: {region: 0x165, script: 0x5a, flags: 0x0}, + 916: {region: 0x165, script: 0x5a, flags: 0x0}, + 917: {region: 0x99, script: 0x81, flags: 0x0}, + 918: {region: 0x165, script: 0x5a, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x20, flags: 0x0}, + 921: {region: 0x135, script: 0x82, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x80, flags: 0x0}, + 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x5a, flags: 0x0}, + 929: {region: 0x30, script: 0x5a, flags: 0x0}, + 930: {region: 0xf0, script: 0x5a, flags: 0x0}, + 931: {region: 0x165, script: 0x5a, flags: 0x0}, + 932: {region: 0x78, script: 0x5a, flags: 0x0}, + 933: {region: 0xd6, script: 0x5a, flags: 0x0}, + 934: {region: 0x135, script: 0x5a, flags: 0x0}, + 935: {region: 0x49, script: 0x5a, flags: 0x0}, + 936: {region: 0x165, script: 0x5a, flags: 0x0}, + 937: {region: 0x9c, script: 0xf7, flags: 0x0}, + 938: {region: 0x165, script: 0x5a, flags: 0x0}, + 939: {region: 0x60, script: 0x5a, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x8e, flags: 0x0}, + 943: {region: 0x165, script: 0x5a, flags: 0x0}, + 944: {region: 0x165, script: 0x5a, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x5a, flags: 0x0}, + 947: {region: 0xe9, script: 0x5a, flags: 0x0}, + 948: {region: 0x165, script: 0x5a, flags: 0x0}, + 949: {region: 0x9e, script: 0x5a, flags: 0x0}, + 950: {region: 0x165, script: 0x5a, flags: 0x0}, + 951: {region: 0x165, script: 0x5a, flags: 0x0}, + 952: {region: 0x87, script: 0x34, flags: 0x0}, + 953: {region: 0x75, script: 0x5a, flags: 0x0}, + 954: {region: 0x165, script: 0x5a, flags: 0x0}, + 955: {region: 0xe8, script: 0x4d, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x5a, flags: 0x0}, + 960: {region: 0x41, script: 0x5a, flags: 0x0}, + 961: {region: 0x165, script: 0x5a, flags: 0x0}, + 962: {region: 0x7a, script: 0x5a, flags: 0x0}, + 963: {region: 0x165, script: 0x5a, flags: 0x0}, + 964: {region: 0xe4, script: 0x5a, flags: 0x0}, + 965: {region: 0x89, script: 0x5a, flags: 0x0}, + 966: {region: 0x69, script: 0x5a, flags: 0x0}, + 967: {region: 0x165, script: 0x5a, flags: 0x0}, + 968: {region: 0x99, script: 0x22, flags: 0x0}, + 969: {region: 0x165, script: 0x5a, flags: 0x0}, + 970: {region: 0x102, script: 0x5a, flags: 0x0}, + 971: {region: 0x95, script: 0x5a, flags: 0x0}, + 972: {region: 0x165, script: 0x5a, flags: 0x0}, + 973: {region: 0x165, script: 0x5a, flags: 0x0}, + 974: {region: 0x9e, script: 0x5a, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5a, flags: 0x0}, + 981: {region: 0x72, script: 0x5a, flags: 0x0}, + 982: {region: 0x4e, script: 0x5a, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x5a, flags: 0x0}, + 985: {region: 0x3a, script: 0x5a, flags: 0x0}, + 986: {region: 0x165, script: 0x5a, flags: 0x0}, + 987: {region: 0xd1, script: 0x5a, flags: 0x0}, + 988: {region: 0x104, script: 0x5a, flags: 0x0}, + 989: {region: 0x95, script: 0x5a, flags: 0x0}, + 990: {region: 0x12f, script: 0x5a, flags: 0x0}, + 991: {region: 0x165, script: 0x5a, flags: 0x0}, + 992: {region: 0x165, script: 0x5a, flags: 0x0}, + 993: {region: 0x73, script: 0x5a, flags: 0x0}, + 994: {region: 0x106, script: 0x20, flags: 0x0}, + 995: {region: 0x130, script: 0x20, flags: 0x0}, + 996: {region: 0x109, script: 0x5a, flags: 0x0}, + 997: {region: 0x107, script: 0x5a, flags: 0x0}, + 998: {region: 0x12f, script: 0x5a, flags: 0x0}, + 999: {region: 0x165, script: 0x5a, flags: 0x0}, + 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, + 1001: {region: 0x99, script: 0x22, flags: 0x0}, + 1002: {region: 0x80, script: 0x5a, flags: 0x0}, + 1003: {region: 0x106, script: 0x20, flags: 0x0}, + 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, + 1005: {region: 0x95, script: 0x5a, flags: 0x0}, + 1006: {region: 0x99, script: 0x5a, flags: 0x0}, + 1007: {region: 0x114, script: 0x5a, flags: 0x0}, + 1008: {region: 0x99, script: 0xcd, flags: 0x0}, + 1009: {region: 0x165, script: 0x5a, flags: 0x0}, + 1010: {region: 0x165, script: 0x5a, flags: 0x0}, + 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1013: {region: 0x99, script: 0x22, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, + 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x5a, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, + 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, + 1027: {region: 0x96, script: 0x7e, flags: 0x0}, + 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, + 1029: {region: 0x165, script: 0x2c, flags: 0x0}, + 1030: {region: 0x165, script: 0x5a, flags: 0x0}, + 1032: {region: 0xba, script: 0xe8, flags: 0x0}, + 1033: {region: 0x165, script: 0x5a, flags: 0x0}, + 1034: {region: 0xc4, script: 0x75, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, + 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, + 1038: {region: 0x165, script: 0x5a, flags: 0x0}, + 1039: {region: 0x165, script: 0x5a, flags: 0x0}, + 1040: {region: 0x165, script: 0x5a, flags: 0x0}, + 1041: {region: 0x165, script: 0x5a, flags: 0x0}, + 1042: {region: 0x111, script: 0x5a, flags: 0x0}, + 1043: {region: 0x165, script: 0x5a, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x5a, flags: 0x0}, + 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, + 1047: {region: 0x165, script: 0x5a, flags: 0x0}, + 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1049: {region: 0x165, script: 0x5a, flags: 0x0}, + 1050: {region: 0x95, script: 0x5a, flags: 0x0}, + 1051: {region: 0x142, script: 0x5a, flags: 0x0}, + 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1055: {region: 0x72, script: 0x5a, flags: 0x0}, + 1056: {region: 0x97, script: 0xca, flags: 0x0}, + 1057: {region: 0x165, script: 0x5a, flags: 0x0}, + 1058: {region: 0x72, script: 0x5a, flags: 0x0}, + 1059: {region: 0x164, script: 0x5a, flags: 0x0}, + 1060: {region: 0x165, script: 0x5a, flags: 0x0}, + 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1062: {region: 0x165, script: 0x5a, flags: 0x0}, + 1063: {region: 0x165, script: 0x5a, flags: 0x0}, + 1064: {region: 0x165, script: 0x5a, flags: 0x0}, + 1065: {region: 0x115, script: 0x5a, flags: 0x0}, + 1066: {region: 0x165, script: 0x5a, flags: 0x0}, + 1067: {region: 0x165, script: 0x5a, flags: 0x0}, + 1068: {region: 0x123, script: 0xeb, flags: 0x0}, + 1069: {region: 0x165, script: 0x5a, flags: 0x0}, + 1070: {region: 0x165, script: 0x5a, flags: 0x0}, + 1071: {region: 0x165, script: 0x5a, flags: 0x0}, + 1072: {region: 0x165, script: 0x5a, flags: 0x0}, + 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xd7, flags: 0x0}, + 1076: {region: 0x116, script: 0x5a, flags: 0x0}, + 1077: {region: 0x114, script: 0x5a, flags: 0x0}, + 1078: {region: 0x99, script: 0x22, flags: 0x0}, + 1079: {region: 0x161, script: 0x5a, flags: 0x0}, + 1080: {region: 0x165, script: 0x5a, flags: 0x0}, + 1081: {region: 0x165, script: 0x5a, flags: 0x0}, + 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, + 1083: {region: 0x161, script: 0x5a, flags: 0x0}, + 1084: {region: 0x165, script: 0x5a, flags: 0x0}, + 1085: {region: 0x60, script: 0x5a, flags: 0x0}, + 1086: {region: 0x95, script: 0x5a, flags: 0x0}, + 1087: {region: 0x165, script: 0x5a, flags: 0x0}, + 1088: {region: 0x165, script: 0x5a, flags: 0x0}, + 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1090: {region: 0x165, script: 0x5a, flags: 0x0}, + 1091: {region: 0x84, script: 0x5a, flags: 0x0}, + 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, + 1096: {region: 0x60, script: 0x5a, flags: 0x0}, + 1097: {region: 0x165, script: 0x5a, flags: 0x0}, + 1098: {region: 0x99, script: 0x22, flags: 0x0}, + 1099: {region: 0x95, script: 0x5a, flags: 0x0}, + 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, + 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1104: {region: 0x99, script: 0xe3, flags: 0x0}, + 1105: {region: 0xdb, script: 0x22, flags: 0x0}, + 1106: {region: 0x165, script: 0x5a, flags: 0x0}, + 1107: {region: 0x165, script: 0x5a, flags: 0x0}, + 1108: {region: 0x165, script: 0x5a, flags: 0x0}, + 1109: {region: 0x165, script: 0x5a, flags: 0x0}, + 1110: {region: 0x165, script: 0x5a, flags: 0x0}, + 1111: {region: 0x165, script: 0x5a, flags: 0x0}, + 1112: {region: 0x165, script: 0x5a, flags: 0x0}, + 1113: {region: 0x165, script: 0x5a, flags: 0x0}, + 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1115: {region: 0x165, script: 0x5a, flags: 0x0}, + 1116: {region: 0x165, script: 0x5a, flags: 0x0}, + 1117: {region: 0x99, script: 0x52, flags: 0x0}, + 1118: {region: 0x53, script: 0xe1, flags: 0x0}, + 1119: {region: 0xdb, script: 0x22, flags: 0x0}, + 1120: {region: 0xdb, script: 0x22, flags: 0x0}, + 1121: {region: 0x99, script: 0xe6, flags: 0x0}, + 1122: {region: 0x165, script: 0x5a, flags: 0x0}, + 1123: {region: 0x112, script: 0x5a, flags: 0x0}, + 1124: {region: 0x131, script: 0x5a, flags: 0x0}, + 1125: {region: 0x126, script: 0x5a, flags: 0x0}, + 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x5a, flags: 0x0}, + 1129: {region: 0x165, script: 0x5a, flags: 0x0}, + 1130: {region: 0x165, script: 0x5a, flags: 0x0}, + 1131: {region: 0x123, script: 0xeb, flags: 0x0}, + 1132: {region: 0xdb, script: 0x22, flags: 0x0}, + 1133: {region: 0xdb, script: 0x22, flags: 0x0}, + 1134: {region: 0xdb, script: 0x22, flags: 0x0}, + 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1136: {region: 0x165, script: 0x5a, flags: 0x0}, + 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, + 1138: {region: 0x165, script: 0x5a, flags: 0x0}, + 1139: {region: 0x165, script: 0x5a, flags: 0x0}, + 1140: {region: 0x165, script: 0x5a, flags: 0x0}, + 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1142: {region: 0x127, script: 0x5a, flags: 0x0}, + 1143: {region: 0x125, script: 0x5a, flags: 0x0}, + 1144: {region: 0x32, script: 0x5a, flags: 0x0}, + 1145: {region: 0xdb, script: 0x22, flags: 0x0}, + 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1147: {region: 0x165, script: 0x5a, flags: 0x0}, + 1148: {region: 0x165, script: 0x5a, flags: 0x0}, + 1149: {region: 0x32, script: 0x5a, flags: 0x0}, + 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1151: {region: 0x165, script: 0x5a, flags: 0x0}, + 1152: {region: 0x161, script: 0x5a, flags: 0x0}, + 1153: {region: 0x165, script: 0x5a, flags: 0x0}, + 1154: {region: 0x129, script: 0x5a, flags: 0x0}, + 1155: {region: 0x165, script: 0x5a, flags: 0x0}, + 1156: {region: 0xce, script: 0x5a, flags: 0x0}, + 1157: {region: 0x165, script: 0x5a, flags: 0x0}, + 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, + 1159: {region: 0x165, script: 0x5a, flags: 0x0}, + 1160: {region: 0x165, script: 0x5a, flags: 0x0}, + 1161: {region: 0x165, script: 0x5a, flags: 0x0}, + 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x5a, flags: 0x0}, + 1167: {region: 0x87, script: 0x34, flags: 0x0}, + 1168: {region: 0xdb, script: 0x22, flags: 0x0}, + 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1170: {region: 0x43, script: 0xec, flags: 0x0}, + 1171: {region: 0x165, script: 0x5a, flags: 0x0}, + 1172: {region: 0x106, script: 0x20, flags: 0x0}, + 1173: {region: 0x165, script: 0x5a, flags: 0x0}, + 1174: {region: 0x165, script: 0x5a, flags: 0x0}, + 1175: {region: 0x131, script: 0x5a, flags: 0x0}, + 1176: {region: 0x165, script: 0x5a, flags: 0x0}, + 1177: {region: 0x123, script: 0xeb, flags: 0x0}, + 1178: {region: 0x32, script: 0x5a, flags: 0x0}, + 1179: {region: 0x165, script: 0x5a, flags: 0x0}, + 1180: {region: 0x165, script: 0x5a, flags: 0x0}, + 1181: {region: 0xce, script: 0x5a, flags: 0x0}, + 1182: {region: 0x165, script: 0x5a, flags: 0x0}, + 1183: {region: 0x165, script: 0x5a, flags: 0x0}, + 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, + 1185: {region: 0x165, script: 0x5a, flags: 0x0}, + 1187: {region: 0x165, script: 0x5a, flags: 0x0}, + 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1189: {region: 0x53, script: 0xe4, flags: 0x0}, + 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, + 1191: {region: 0x165, script: 0x5a, flags: 0x0}, + 1192: {region: 0x106, script: 0x20, flags: 0x0}, + 1193: {region: 0xba, script: 0x5a, flags: 0x0}, + 1194: {region: 0x165, script: 0x5a, flags: 0x0}, + 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, + 1198: {region: 0x130, script: 0x20, flags: 0x0}, + 1199: {region: 0x75, script: 0x5a, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x5a, flags: 0x0}, + 1206: {region: 0x165, script: 0x5a, flags: 0x0}, + 1207: {region: 0x165, script: 0x5a, flags: 0x0}, + 1208: {region: 0x165, script: 0x5a, flags: 0x0}, + 1209: {region: 0x165, script: 0x5a, flags: 0x0}, + 1210: {region: 0x165, script: 0x5a, flags: 0x0}, + 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x5a, flags: 0x0}, + 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, + 1215: {region: 0x165, script: 0x5a, flags: 0x0}, + 1216: {region: 0x161, script: 0x5a, flags: 0x0}, + 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1218: {region: 0x106, script: 0x5a, flags: 0x0}, + 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, + 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, + 1221: {region: 0x165, script: 0x5a, flags: 0x0}, + 1222: {region: 0x36, script: 0x5a, flags: 0x0}, + 1223: {region: 0x60, script: 0x5a, flags: 0x0}, + 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1225: {region: 0x1, script: 0x5a, flags: 0x0}, + 1226: {region: 0x106, script: 0x5a, flags: 0x0}, + 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, + 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1229: {region: 0x165, script: 0x5a, flags: 0x0}, + 1230: {region: 0x36, script: 0x5a, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, + 1232: {region: 0x165, script: 0x5a, flags: 0x0}, + 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1234: {region: 0x165, script: 0x5a, flags: 0x0}, + 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, + 1237: {region: 0x99, script: 0xe6, flags: 0x0}, + 1238: {region: 0x99, script: 0x22, flags: 0x0}, + 1239: {region: 0x165, script: 0x5a, flags: 0x0}, + 1240: {region: 0x165, script: 0x5a, flags: 0x0}, + 1241: {region: 0x165, script: 0x5a, flags: 0x0}, + 1242: {region: 0x165, script: 0x5a, flags: 0x0}, + 1243: {region: 0x165, script: 0x5a, flags: 0x0}, + 1244: {region: 0x165, script: 0x5a, flags: 0x0}, + 1245: {region: 0x165, script: 0x5a, flags: 0x0}, + 1246: {region: 0x165, script: 0x5a, flags: 0x0}, + 1247: {region: 0x165, script: 0x5a, flags: 0x0}, + 1248: {region: 0x140, script: 0x5a, flags: 0x0}, + 1249: {region: 0x165, script: 0x5a, flags: 0x0}, + 1250: {region: 0x165, script: 0x5a, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x5a, flags: 0x0}, + 1253: {region: 0x114, script: 0x5a, flags: 0x0}, + 1254: {region: 0x165, script: 0x5a, flags: 0x0}, + 1255: {region: 0x165, script: 0x5a, flags: 0x0}, + 1256: {region: 0x165, script: 0x5a, flags: 0x0}, + 1257: {region: 0x165, script: 0x5a, flags: 0x0}, + 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x165, script: 0x5a, flags: 0x0}, + 1261: {region: 0x165, script: 0x5a, flags: 0x0}, + 1262: {region: 0x41, script: 0x5a, flags: 0x0}, + 1263: {region: 0x165, script: 0x5a, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x5a, flags: 0x0}, + 1266: {region: 0x161, script: 0x5a, flags: 0x0}, + 1267: {region: 0x165, script: 0x5a, flags: 0x0}, + 1268: {region: 0x12b, script: 0x62, flags: 0x0}, + 1269: {region: 0x12b, script: 0x63, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x67, flags: 0x0}, + 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, + 1273: {region: 0x108, script: 0x77, flags: 0x0}, + 1274: {region: 0x99, script: 0x22, flags: 0x0}, + 1275: {region: 0x131, script: 0x5a, flags: 0x0}, + 1276: {region: 0x165, script: 0x5a, flags: 0x0}, + 1277: {region: 0x9c, script: 0x91, flags: 0x0}, + 1278: {region: 0x165, script: 0x5a, flags: 0x0}, + 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, + 1280: {region: 0x165, script: 0x5a, flags: 0x0}, + 1281: {region: 0x165, script: 0x5a, flags: 0x0}, + 1282: {region: 0xdb, script: 0x22, flags: 0x0}, + 1283: {region: 0x165, script: 0x5a, flags: 0x0}, + 1284: {region: 0x165, script: 0x5a, flags: 0x0}, + 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1286: {region: 0x75, script: 0x5a, flags: 0x0}, + 1287: {region: 0x165, script: 0x5a, flags: 0x0}, + 1288: {region: 0x165, script: 0x5a, flags: 0x0}, + 1289: {region: 0x52, script: 0x5a, flags: 0x0}, + 1290: {region: 0x165, script: 0x5a, flags: 0x0}, + 1291: {region: 0x165, script: 0x5a, flags: 0x0}, + 1292: {region: 0x165, script: 0x5a, flags: 0x0}, + 1293: {region: 0x52, script: 0x5a, flags: 0x0}, + 1294: {region: 0x165, script: 0x5a, flags: 0x0}, + 1295: {region: 0x165, script: 0x5a, flags: 0x0}, + 1296: {region: 0x165, script: 0x5a, flags: 0x0}, + 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x165, script: 0x5a, flags: 0x0}, + 1300: {region: 0x165, script: 0x5a, flags: 0x0}, + 1301: {region: 0x165, script: 0x5a, flags: 0x0}, + 1302: {region: 0x165, script: 0x5a, flags: 0x0}, + 1303: {region: 0x165, script: 0x5a, flags: 0x0}, + 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1305: {region: 0x165, script: 0x5a, flags: 0x0}, + 1306: {region: 0x165, script: 0x5a, flags: 0x0}, + 1307: {region: 0x165, script: 0x5a, flags: 0x0}, + 1308: {region: 0x41, script: 0x5a, flags: 0x0}, + 1309: {region: 0x165, script: 0x5a, flags: 0x0}, + 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x5a, flags: 0x0}, + 1313: {region: 0x165, script: 0x5a, flags: 0x0}, + 1314: {region: 0x165, script: 0x5a, flags: 0x0}, + 1315: {region: 0x53, script: 0x5a, flags: 0x0}, + 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, + 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7d, flags: 0x0}, + 1323: {region: 0x165, script: 0x5a, flags: 0x0}, + 1324: {region: 0x122, script: 0x5a, flags: 0x0}, + 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, + 1326: {region: 0x165, script: 0x5a, flags: 0x0}, + 1327: {region: 0x161, script: 0x5a, flags: 0x0}, + 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x78, flags: 0x2}, + 2: {region: 0x11c, script: 0x85, flags: 0x2}, + 3: {region: 0x32, script: 0x5a, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x20, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x135, script: 0x5a, flags: 0x0}, + 11: {region: 0x7b, script: 0xcf, flags: 0x2}, + 12: {region: 0x114, script: 0x5a, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1f, flags: 0x0}, + 15: {region: 0x87, script: 0x5f, flags: 0x2}, + 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x5a, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x5a, flags: 0x2}, + 33: {region: 0xdb, script: 0x22, flags: 0x0}, + 34: {region: 0x99, script: 0x5d, flags: 0x2}, + 35: {region: 0x83, script: 0x5a, flags: 0x0}, + 36: {region: 0x84, script: 0x7c, flags: 0x4}, + 37: {region: 0x84, script: 0x7c, flags: 0x2}, + 38: {region: 0xc5, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x70, flags: 0x4}, + 40: {region: 0x53, script: 0x70, flags: 0x2}, + 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x36, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x8b, flags: 0x0}, + 48: {region: 0x53, script: 0x8c, flags: 0x2}, + 49: {region: 0xba, script: 0xe8, flags: 0x0}, + 50: {region: 0xd9, script: 0x5a, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x22, flags: 0x2}, + 53: {region: 0x99, script: 0x4f, flags: 0x2}, + 54: {region: 0x99, script: 0xd3, flags: 0x2}, + 55: {region: 0x105, script: 0x20, flags: 0x0}, + 56: {region: 0xbd, script: 0x5a, flags: 0x4}, + 57: {region: 0x104, script: 0x5a, flags: 0x4}, + 58: {region: 0x106, script: 0x5a, flags: 0x4}, + 59: {region: 0x12b, script: 0x5a, flags: 0x4}, + 60: {region: 0x124, script: 0x20, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x20, flags: 0x4}, + 65: {region: 0xc5, script: 0x20, flags: 0x4}, + 66: {region: 0xae, script: 0x20, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x22, flags: 0x4}, + 69: {region: 0xdb, script: 0x22, flags: 0x2}, + 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7b, script: 0x3c, flags: 0x4}, + 81: {region: 0x7e, script: 0x3c, flags: 0x4}, + 82: {region: 0x8d, script: 0x3c, flags: 0x4}, + 83: {region: 0x95, script: 0x3c, flags: 0x4}, + 84: {region: 0xc6, script: 0x3c, flags: 0x4}, + 85: {region: 0xd0, script: 0x3c, flags: 0x4}, + 86: {region: 0xe2, script: 0x3c, flags: 0x4}, + 87: {region: 0xe5, script: 0x3c, flags: 0x4}, + 88: {region: 0xe7, script: 0x3c, flags: 0x4}, + 89: {region: 0x116, script: 0x3c, flags: 0x4}, + 90: {region: 0x123, script: 0x3c, flags: 0x4}, + 91: {region: 0x12e, script: 0x3c, flags: 0x4}, + 92: {region: 0x135, script: 0x3c, flags: 0x4}, + 93: {region: 0x13e, script: 0x3c, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x37, flags: 0x2}, + 96: {region: 0x12e, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2148 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 43: {lang: 0x0, script: 0x5a, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 48: {lang: 0x367, script: 0x5a, flags: 0x0}, + 49: {lang: 0x444, script: 0x5a, flags: 0x0}, + 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5a, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5a, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 85: {lang: 0x0, script: 0x5a, flags: 0x0}, + 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, + 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 98: {lang: 0x1, script: 0x5a, flags: 0x0}, + 99: {lang: 0x101, script: 0x5a, flags: 0x0}, + 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 106: {lang: 0x140, script: 0x5a, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 114: {lang: 0x151, script: 0x5a, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 118: {lang: 0x158, script: 0x5a, flags: 0x0}, + 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 128: {lang: 0x21, script: 0x5a, flags: 0x0}, + 130: {lang: 0x245, script: 0x5a, flags: 0x0}, + 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x5a, flags: 0x0}, + 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 141: {lang: 0x529, script: 0x3c, flags: 0x0}, + 142: {lang: 0x0, script: 0x5a, flags: 0x0}, + 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, + 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x49, flags: 0x0}, + 164: {lang: 0x445, script: 0x5a, flags: 0x0}, + 165: {lang: 0x28a, script: 0x20, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x53, flags: 0x0}, + 171: {lang: 0x254, script: 0x53, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, + 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, + 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x5a, flags: 0x0}, + 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x5a, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xea, flags: 0x0}, + 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 210: {lang: 0x16, script: 0x5a, flags: 0x0}, + 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 217: {lang: 0x367, script: 0x5a, flags: 0x0}, + 218: {lang: 0x347, script: 0x5a, flags: 0x0}, + 219: {lang: 0x351, script: 0x22, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 230: {lang: 0x486, script: 0x5a, flags: 0x0}, + 231: {lang: 0x153, script: 0x5a, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, + 241: {lang: 0x194, script: 0x5a, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x20, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x5a, flags: 0x0}, + 272: {lang: 0x347, script: 0x5a, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 277: {lang: 0x429, script: 0x5a, flags: 0x0}, + 278: {lang: 0x367, script: 0x5a, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x5a, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 295: {lang: 0x476, script: 0x5a, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x5a, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x5a, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x5a, flags: 0x0}, + 309: {lang: 0x512, script: 0x3e, flags: 0x2}, + 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, + 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, + 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x5a, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5a, flags: 0x0}, + 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5a, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5a, flags: 0x0}, + 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5a, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, + 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5a, flags: 0x0}, + 47: {lang: 0x331, script: 0x75, flags: 0x0}, + 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5a, flags: 0x0}, + 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x5a}, + 2: {lang: 0x139, region: 0x135, script: 0x5a}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, + 4: {lang: 0x139, region: 0x2f, script: 0x5a}, + 5: {lang: 0x139, region: 0xd6, script: 0x5a}, + 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, + 7: {lang: 0x445, region: 0x12f, script: 0x5a}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5a}, + 10: {lang: 0x139, region: 0x161, script: 0x5a}, + 11: {lang: 0x139, region: 0x135, script: 0x5a}, + 12: {lang: 0x139, region: 0x135, script: 0x5a}, + 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x99, script: 0x22}, + 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, + 18: {lang: 0x139, region: 0x2f, script: 0x5a}, + 19: {lang: 0x139, region: 0xe6, script: 0x5a}, + 20: {lang: 0x139, region: 0x8a, script: 0x5a}, + 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x20}, + 26: {lang: 0x3e2, region: 0x106, script: 0x20}, + 27: {lang: 0x139, region: 0x7b, script: 0x5a}, + 28: {lang: 0x10d, region: 0x60, script: 0x5a}, + 29: {lang: 0x139, region: 0xd6, script: 0x5a}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, + 31: {lang: 0x139, region: 0x9a, script: 0x5a}, + 32: {lang: 0x139, region: 0x7b, script: 0x5a}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 30244 bytes (29KiB); checksum: B6B15F30 diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 000000000..e7afd3188 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 000000000..1cc004a6d --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See https://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 000000000..b5d348891 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 000000000..a24fd1a4d --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 000000000..212b77c90 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 000000000..289b3a36d --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 000000000..ee45f4947 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script or + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 000000000..4d57222e7 --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), err +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 000000000..34a732b69 --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 147 + _Qaai = 155 + _Qabx = 196 + _Zinh = 252 + _Zyyy = 257 + _Zzzz = 258 +) + +var regionToGroups = []uint8{ // 358 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, + 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + // Entry C0 - FF + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, + 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 382 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7b}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xee}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1472 bytes (1KiB); checksum: F86C669 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 000000000..42ea79266 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go index e4c081101..9d2ae547b 100644 --- a/vendor/golang.org/x/text/unicode/bidi/core.go +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -193,14 +193,14 @@ func (p *paragraph) run() { // // At the end of this function: // -// - The member variable matchingPDI is set to point to the index of the -// matching PDI character for each isolate initiator character. If there is -// no matching PDI, it is set to the length of the input text. For other -// characters, it is set to -1. -// - The member variable matchingIsolateInitiator is set to point to the -// index of the matching isolate initiator character for each PDI character. -// If there is no matching isolate initiator, or the character is not a PDI, -// it is set to -1. +// - The member variable matchingPDI is set to point to the index of the +// matching PDI character for each isolate initiator character. If there is +// no matching PDI, it is set to the length of the input text. For other +// characters, it is set to -1. +// - The member variable matchingIsolateInitiator is set to point to the +// index of the matching isolate initiator character for each PDI character. +// If there is no matching isolate initiator, or the character is not a PDI, +// it is set to -1. func (p *paragraph) determineMatchingIsolates() { p.matchingPDI = make([]int, p.Len()) p.matchingIsolateInitiator = make([]int, p.Len()) @@ -435,7 +435,7 @@ func maxLevel(a, b level) level { } // Rule X10, second bullet: Determine the start-of-sequence (sos) and end-of-sequence (eos) types, -// either L or R, for each isolating run sequence. +// either L or R, for each isolating run sequence. func (p *paragraph) isolatingRunSequence(indexes []int) *isolatingRunSequence { length := len(indexes) types := make([]Class, length) @@ -495,9 +495,9 @@ func (s *isolatingRunSequence) resolveWeakTypes() { if t == NSM { s.types[i] = precedingCharacterType } else { - if t.in(LRI, RLI, FSI, PDI) { - precedingCharacterType = ON - } + // if t.in(LRI, RLI, FSI, PDI) { + // precedingCharacterType = ON + // } precedingCharacterType = t } } @@ -905,7 +905,7 @@ func (p *paragraph) getLevels(linebreaks []int) []level { // Lines are concatenated from left to right. So for example, the fifth // character from the left on the third line is // -// getReordering(linebreaks)[linebreaks[1] + 4] +// getReordering(linebreaks)[linebreaks[1] + 4] // // (linebreaks[1] is the position after the last character of the second // line, which is also the index of the first character on the third line, diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index 526c7033a..d69ccb4f9 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -110,10 +110,11 @@ func (p Properties) BoundaryAfter() bool { } // We pack quick check data in 4 bits: -// 5: Combines forward (0 == false, 1 == true) -// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) -// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. -// 1..0: Number of trailing non-starters. +// +// 5: Combines forward (0 == false, 1 == true) +// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) +// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. +// 1..0: Number of trailing non-starters. // // When all 4 bits are zero, the character is inert, meaning it is never // influenced by normalization. diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index 95efcf26e..4747ad07a 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -18,16 +18,17 @@ import ( // A Form denotes a canonical representation of Unicode code points. // The Unicode-defined normalization and equivalence forms are: // -// NFC Unicode Normalization Form C -// NFD Unicode Normalization Form D -// NFKC Unicode Normalization Form KC -// NFKD Unicode Normalization Form KD +// NFC Unicode Normalization Form C +// NFD Unicode Normalization Form D +// NFKC Unicode Normalization Form KC +// NFKD Unicode Normalization Form KD // // For a Form f, this documentation uses the notation f(x) to mean // the bytes or string x converted to the given form. // A position n in x is called a boundary if conversion to the form can // proceed independently on both sides: -// f(x) == append(f(x[0:n]), f(x[n:])...) +// +// f(x) == append(f(x[0:n]), f(x[n:])...) // // References: https://unicode.org/reports/tr15/ and // https://unicode.org/notes/tn5/. diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 96a130d30..9115ef257 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -7315,7 +7315,7 @@ const recompMapPacked = "" + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E - "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 @@ -7342,7 +7342,7 @@ const recompMapPacked = "" + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 - "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 diff --git a/vendor/google.golang.org/grpc/balancer/balancer.go b/vendor/google.golang.org/grpc/balancer/balancer.go index 257139080..f4f9408f3 100644 --- a/vendor/google.golang.org/grpc/balancer/balancer.go +++ b/vendor/google.golang.org/grpc/balancer/balancer.go @@ -244,7 +244,7 @@ type DoneInfo struct { // ServerLoad is the load received from server. It's usually sent as part of // trailing metadata. // - // The only supported type now is *orca_v1.LoadReport. + // The only supported type now is *orca_v3.LoadReport. ServerLoad interface{} } diff --git a/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go b/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go index 274eb2f85..f7031ad22 100644 --- a/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go +++ b/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go @@ -22,7 +22,7 @@ package roundrobin import ( - "sync" + "sync/atomic" "google.golang.org/grpc/balancer" "google.golang.org/grpc/balancer/base" @@ -60,7 +60,7 @@ func (*rrPickerBuilder) Build(info base.PickerBuildInfo) balancer.Picker { // Start at a random index, as the same RR balancer rebuilds a new // picker when SubConn states change, and we don't want to apply excess // load to the first server in the list. - next: grpcrand.Intn(len(scs)), + next: uint32(grpcrand.Intn(len(scs))), } } @@ -69,15 +69,13 @@ type rrPicker struct { // created. The slice is immutable. Each Get() will do a round robin // selection from it and return the selected SubConn. subConns []balancer.SubConn - - mu sync.Mutex - next int + next uint32 } func (p *rrPicker) Pick(balancer.PickInfo) (balancer.PickResult, error) { - p.mu.Lock() - sc := p.subConns[p.next] - p.next = (p.next + 1) % len(p.subConns) - p.mu.Unlock() + subConnsLen := uint32(len(p.subConns)) + nextIndex := atomic.AddUint32(&p.next, 1) + + sc := p.subConns[nextIndex%subConnsLen] return balancer.PickResult{SubConn: sc}, nil } diff --git a/vendor/google.golang.org/grpc/dialoptions.go b/vendor/google.golang.org/grpc/dialoptions.go index 60403bc16..9372dc322 100644 --- a/vendor/google.golang.org/grpc/dialoptions.go +++ b/vendor/google.golang.org/grpc/dialoptions.go @@ -29,6 +29,7 @@ import ( "google.golang.org/grpc/credentials/insecure" "google.golang.org/grpc/internal" internalbackoff "google.golang.org/grpc/internal/backoff" + "google.golang.org/grpc/internal/binarylog" "google.golang.org/grpc/internal/transport" "google.golang.org/grpc/keepalive" "google.golang.org/grpc/resolver" @@ -36,12 +37,13 @@ import ( ) func init() { - internal.AddExtraDialOptions = func(opt ...DialOption) { + internal.AddGlobalDialOptions = func(opt ...DialOption) { extraDialOptions = append(extraDialOptions, opt...) } - internal.ClearExtraDialOptions = func() { + internal.ClearGlobalDialOptions = func() { extraDialOptions = nil } + internal.WithBinaryLogger = withBinaryLogger } // dialOptions configure a Dial call. dialOptions are set by the DialOption @@ -61,6 +63,7 @@ type dialOptions struct { timeout time.Duration scChan <-chan ServiceConfig authority string + binaryLogger binarylog.Logger copts transport.ConnectOptions callOptions []CallOption channelzParentID *channelz.Identifier @@ -401,6 +404,14 @@ func WithStatsHandler(h stats.Handler) DialOption { }) } +// withBinaryLogger returns a DialOption that specifies the binary logger for +// this ClientConn. +func withBinaryLogger(bl binarylog.Logger) DialOption { + return newFuncDialOption(func(o *dialOptions) { + o.binaryLogger = bl + }) +} + // FailOnNonTempDialError returns a DialOption that specifies if gRPC fails on // non-temporary dial errors. If f is true, and dialer returns a non-temporary // error, gRPC will fail the connection to the network address and won't try to diff --git a/vendor/google.golang.org/grpc/health/grpc_health_v1/health_grpc.pb.go b/vendor/google.golang.org/grpc/health/grpc_health_v1/health_grpc.pb.go index 69f525d1b..a332dfd7b 100644 --- a/vendor/google.golang.org/grpc/health/grpc_health_v1/health_grpc.pb.go +++ b/vendor/google.golang.org/grpc/health/grpc_health_v1/health_grpc.pb.go @@ -1,3 +1,20 @@ +// Copyright 2015 The gRPC Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// The canonical version of this proto can be found at +// https://github.com/grpc/grpc-proto/blob/master/grpc/health/v1/health.proto + // Code generated by protoc-gen-go-grpc. DO NOT EDIT. // versions: // - protoc-gen-go-grpc v1.2.0 diff --git a/vendor/google.golang.org/grpc/internal/binarylog/binarylog.go b/vendor/google.golang.org/grpc/internal/binarylog/binarylog.go index e3dfe204f..809d73cca 100644 --- a/vendor/google.golang.org/grpc/internal/binarylog/binarylog.go +++ b/vendor/google.golang.org/grpc/internal/binarylog/binarylog.go @@ -37,7 +37,7 @@ type Logger interface { // binLogger is the global binary logger for the binary. One of this should be // built at init time from the configuration (environment variable or flags). // -// It is used to get a methodLogger for each individual method. +// It is used to get a MethodLogger for each individual method. var binLogger Logger var grpclogLogger = grpclog.Component("binarylog") @@ -56,11 +56,11 @@ func GetLogger() Logger { return binLogger } -// GetMethodLogger returns the methodLogger for the given methodName. +// GetMethodLogger returns the MethodLogger for the given methodName. // // methodName should be in the format of "/service/method". // -// Each methodLogger returned by this method is a new instance. This is to +// Each MethodLogger returned by this method is a new instance. This is to // generate sequence id within the call. func GetMethodLogger(methodName string) MethodLogger { if binLogger == nil { @@ -117,7 +117,7 @@ func (l *logger) setDefaultMethodLogger(ml *MethodLoggerConfig) error { // Set method logger for "service/*". // -// New methodLogger with same service overrides the old one. +// New MethodLogger with same service overrides the old one. func (l *logger) setServiceMethodLogger(service string, ml *MethodLoggerConfig) error { if _, ok := l.config.Services[service]; ok { return fmt.Errorf("conflicting service rules for service %v found", service) @@ -131,7 +131,7 @@ func (l *logger) setServiceMethodLogger(service string, ml *MethodLoggerConfig) // Set method logger for "service/method". // -// New methodLogger with same method overrides the old one. +// New MethodLogger with same method overrides the old one. func (l *logger) setMethodMethodLogger(method string, ml *MethodLoggerConfig) error { if _, ok := l.config.Blacklist[method]; ok { return fmt.Errorf("conflicting blacklist rules for method %v found", method) @@ -161,11 +161,11 @@ func (l *logger) setBlacklist(method string) error { return nil } -// getMethodLogger returns the methodLogger for the given methodName. +// getMethodLogger returns the MethodLogger for the given methodName. // // methodName should be in the format of "/service/method". // -// Each methodLogger returned by this method is a new instance. This is to +// Each MethodLogger returned by this method is a new instance. This is to // generate sequence id within the call. func (l *logger) GetMethodLogger(methodName string) MethodLogger { s, m, err := grpcutil.ParseMethod(methodName) @@ -174,16 +174,16 @@ func (l *logger) GetMethodLogger(methodName string) MethodLogger { return nil } if ml, ok := l.config.Methods[s+"/"+m]; ok { - return newMethodLogger(ml.Header, ml.Message) + return NewTruncatingMethodLogger(ml.Header, ml.Message) } if _, ok := l.config.Blacklist[s+"/"+m]; ok { return nil } if ml, ok := l.config.Services[s]; ok { - return newMethodLogger(ml.Header, ml.Message) + return NewTruncatingMethodLogger(ml.Header, ml.Message) } if l.config.All == nil { return nil } - return newMethodLogger(l.config.All.Header, l.config.All.Message) + return NewTruncatingMethodLogger(l.config.All.Header, l.config.All.Message) } diff --git a/vendor/google.golang.org/grpc/internal/binarylog/env_config.go b/vendor/google.golang.org/grpc/internal/binarylog/env_config.go index ab589a76b..c5579e650 100644 --- a/vendor/google.golang.org/grpc/internal/binarylog/env_config.go +++ b/vendor/google.golang.org/grpc/internal/binarylog/env_config.go @@ -57,7 +57,7 @@ func NewLoggerFromConfigString(s string) Logger { return l } -// fillMethodLoggerWithConfigString parses config, creates methodLogger and adds +// fillMethodLoggerWithConfigString parses config, creates TruncatingMethodLogger and adds // it to the right map in the logger. func (l *logger) fillMethodLoggerWithConfigString(config string) error { // "" is invalid. diff --git a/vendor/google.golang.org/grpc/internal/binarylog/method_logger.go b/vendor/google.golang.org/grpc/internal/binarylog/method_logger.go index 24df0a1a0..179f4a26d 100644 --- a/vendor/google.golang.org/grpc/internal/binarylog/method_logger.go +++ b/vendor/google.golang.org/grpc/internal/binarylog/method_logger.go @@ -52,7 +52,9 @@ type MethodLogger interface { Log(LogEntryConfig) } -type methodLogger struct { +// TruncatingMethodLogger is a method logger that truncates headers and messages +// based on configured fields. +type TruncatingMethodLogger struct { headerMaxLen, messageMaxLen uint64 callID uint64 @@ -61,8 +63,9 @@ type methodLogger struct { sink Sink // TODO(blog): make this plugable. } -func newMethodLogger(h, m uint64) *methodLogger { - return &methodLogger{ +// NewTruncatingMethodLogger returns a new truncating method logger. +func NewTruncatingMethodLogger(h, m uint64) *TruncatingMethodLogger { + return &TruncatingMethodLogger{ headerMaxLen: h, messageMaxLen: m, @@ -75,8 +78,8 @@ func newMethodLogger(h, m uint64) *methodLogger { // Build is an internal only method for building the proto message out of the // input event. It's made public to enable other library to reuse as much logic -// in methodLogger as possible. -func (ml *methodLogger) Build(c LogEntryConfig) *pb.GrpcLogEntry { +// in TruncatingMethodLogger as possible. +func (ml *TruncatingMethodLogger) Build(c LogEntryConfig) *pb.GrpcLogEntry { m := c.toProto() timestamp, _ := ptypes.TimestampProto(time.Now()) m.Timestamp = timestamp @@ -95,11 +98,11 @@ func (ml *methodLogger) Build(c LogEntryConfig) *pb.GrpcLogEntry { } // Log creates a proto binary log entry, and logs it to the sink. -func (ml *methodLogger) Log(c LogEntryConfig) { +func (ml *TruncatingMethodLogger) Log(c LogEntryConfig) { ml.sink.Write(ml.Build(c)) } -func (ml *methodLogger) truncateMetadata(mdPb *pb.Metadata) (truncated bool) { +func (ml *TruncatingMethodLogger) truncateMetadata(mdPb *pb.Metadata) (truncated bool) { if ml.headerMaxLen == maxUInt { return false } @@ -129,7 +132,7 @@ func (ml *methodLogger) truncateMetadata(mdPb *pb.Metadata) (truncated bool) { return truncated } -func (ml *methodLogger) truncateMessage(msgPb *pb.Message) (truncated bool) { +func (ml *TruncatingMethodLogger) truncateMessage(msgPb *pb.Message) (truncated bool) { if ml.messageMaxLen == maxUInt { return false } diff --git a/vendor/google.golang.org/grpc/internal/envconfig/observability.go b/vendor/google.golang.org/grpc/internal/envconfig/observability.go new file mode 100644 index 000000000..821dd0a7c --- /dev/null +++ b/vendor/google.golang.org/grpc/internal/envconfig/observability.go @@ -0,0 +1,36 @@ +/* + * + * Copyright 2022 gRPC authors. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + * + */ + +package envconfig + +import "os" + +const ( + envObservabilityConfig = "GRPC_GCP_OBSERVABILITY_CONFIG" + envObservabilityConfigFile = "GRPC_GCP_OBSERVABILITY_CONFIG_FILE" +) + +var ( + // ObservabilityConfig is the json configuration for the gcp/observability + // package specified directly in the envObservabilityConfig env var. + ObservabilityConfig = os.Getenv(envObservabilityConfig) + // ObservabilityConfigFile is the json configuration for the + // gcp/observability specified in a file with the location specified in + // envObservabilityConfigFile env var. + ObservabilityConfigFile = os.Getenv(envObservabilityConfigFile) +) diff --git a/vendor/google.golang.org/grpc/internal/envconfig/xds.go b/vendor/google.golang.org/grpc/internal/envconfig/xds.go index a83b26bb8..af09711a3 100644 --- a/vendor/google.golang.org/grpc/internal/envconfig/xds.go +++ b/vendor/google.golang.org/grpc/internal/envconfig/xds.go @@ -41,6 +41,7 @@ const ( clientSideSecuritySupportEnv = "GRPC_XDS_EXPERIMENTAL_SECURITY_SUPPORT" aggregateAndDNSSupportEnv = "GRPC_XDS_EXPERIMENTAL_ENABLE_AGGREGATE_AND_LOGICAL_DNS_CLUSTER" rbacSupportEnv = "GRPC_XDS_EXPERIMENTAL_RBAC" + outlierDetectionSupportEnv = "GRPC_EXPERIMENTAL_ENABLE_OUTLIER_DETECTION" federationEnv = "GRPC_EXPERIMENTAL_XDS_FEDERATION" rlsInXDSEnv = "GRPC_EXPERIMENTAL_XDS_RLS_LB" @@ -83,9 +84,9 @@ var ( // "GRPC_XDS_EXPERIMENTAL_RBAC" to "false". XDSRBAC = !strings.EqualFold(os.Getenv(rbacSupportEnv), "false") // XDSOutlierDetection indicates whether outlier detection support is - // enabled, which can be enabled by setting the environment variable - // "GRPC_EXPERIMENTAL_ENABLE_OUTLIER_DETECTION" to "true". - XDSOutlierDetection = false + // enabled, which can be disabled by setting the environment variable + // "GRPC_EXPERIMENTAL_ENABLE_OUTLIER_DETECTION" to "false". + XDSOutlierDetection = !strings.EqualFold(os.Getenv(outlierDetectionSupportEnv), "false") // XDSFederation indicates whether federation support is enabled. XDSFederation = strings.EqualFold(os.Getenv(federationEnv), "true") diff --git a/vendor/google.golang.org/grpc/internal/grpcrand/grpcrand.go b/vendor/google.golang.org/grpc/internal/grpcrand/grpcrand.go index 740f83c2b..517ea7064 100644 --- a/vendor/google.golang.org/grpc/internal/grpcrand/grpcrand.go +++ b/vendor/google.golang.org/grpc/internal/grpcrand/grpcrand.go @@ -52,6 +52,13 @@ func Intn(n int) int { return r.Intn(n) } +// Int31n implements rand.Int31n on the grpcrand global source. +func Int31n(n int32) int32 { + mu.Lock() + defer mu.Unlock() + return r.Int31n(n) +} + // Float64 implements rand.Float64 on the grpcrand global source. func Float64() float64 { mu.Lock() diff --git a/vendor/google.golang.org/grpc/internal/internal.go b/vendor/google.golang.org/grpc/internal/internal.go index 83018be7c..fd0ee3dca 100644 --- a/vendor/google.golang.org/grpc/internal/internal.go +++ b/vendor/google.golang.org/grpc/internal/internal.go @@ -63,20 +63,30 @@ var ( // xDS-enabled server invokes this method on a grpc.Server when a particular // listener moves to "not-serving" mode. DrainServerTransports interface{} // func(*grpc.Server, string) - // AddExtraServerOptions adds an array of ServerOption that will be + // AddGlobalServerOptions adds an array of ServerOption that will be // effective globally for newly created servers. The priority will be: 1. // user-provided; 2. this method; 3. default values. - AddExtraServerOptions interface{} // func(opt ...ServerOption) - // ClearExtraServerOptions clears the array of extra ServerOption. This + AddGlobalServerOptions interface{} // func(opt ...ServerOption) + // ClearGlobalServerOptions clears the array of extra ServerOption. This // method is useful in testing and benchmarking. - ClearExtraServerOptions func() - // AddExtraDialOptions adds an array of DialOption that will be effective + ClearGlobalServerOptions func() + // AddGlobalDialOptions adds an array of DialOption that will be effective // globally for newly created client channels. The priority will be: 1. // user-provided; 2. this method; 3. default values. - AddExtraDialOptions interface{} // func(opt ...DialOption) - // ClearExtraDialOptions clears the array of extra DialOption. This + AddGlobalDialOptions interface{} // func(opt ...DialOption) + // ClearGlobalDialOptions clears the array of extra DialOption. This // method is useful in testing and benchmarking. - ClearExtraDialOptions func() + ClearGlobalDialOptions func() + // JoinServerOptions combines the server options passed as arguments into a + // single server option. + JoinServerOptions interface{} // func(...grpc.ServerOption) grpc.ServerOption + + // WithBinaryLogger returns a DialOption that specifies the binary logger + // for a ClientConn. + WithBinaryLogger interface{} // func(binarylog.Logger) grpc.DialOption + // BinaryLogger returns a ServerOption that can set the binary logger for a + // server. + BinaryLogger interface{} // func(binarylog.Logger) grpc.ServerOption // NewXDSResolverWithConfigForTesting creates a new xds resolver builder using // the provided xds bootstrap config instead of the global configuration from @@ -117,22 +127,6 @@ var ( // // TODO: Remove this function once the RBAC env var is removed. UnregisterRBACHTTPFilterForTesting func() - - // RegisterOutlierDetectionBalancerForTesting registers the Outlier - // Detection Balancer for testing purposes, regardless of the Outlier - // Detection environment variable. - // - // TODO: Remove this function once the Outlier Detection env var is removed. - RegisterOutlierDetectionBalancerForTesting func() - - // UnregisterOutlierDetectionBalancerForTesting unregisters the Outlier - // Detection Balancer for testing purposes. This is needed because there is - // no way to unregister the Outlier Detection Balancer after registering it - // solely for testing purposes using - // RegisterOutlierDetectionBalancerForTesting(). - // - // TODO: Remove this function once the Outlier Detection env var is removed. - UnregisterOutlierDetectionBalancerForTesting func() ) // HealthChecker defines the signature of the client-side LB channel health checking function. diff --git a/vendor/google.golang.org/grpc/internal/resolver/unix/unix.go b/vendor/google.golang.org/grpc/internal/resolver/unix/unix.go index 20852e59d..7f1a702ca 100644 --- a/vendor/google.golang.org/grpc/internal/resolver/unix/unix.go +++ b/vendor/google.golang.org/grpc/internal/resolver/unix/unix.go @@ -49,8 +49,9 @@ func (b *builder) Build(target resolver.Target, cc resolver.ClientConn, _ resolv } addr := resolver.Address{Addr: endpoint} if b.scheme == unixAbstractScheme { - // prepend "\x00" to address for unix-abstract - addr.Addr = "\x00" + addr.Addr + // We can not prepend \0 as c++ gRPC does, as in Golang '@' is used to signify we do + // not want trailing \0 in address. + addr.Addr = "@" + addr.Addr } cc.UpdateState(resolver.State{Addresses: []resolver.Address{networktype.Set(addr, "unix")}}) return &nopResolver{}, nil diff --git a/vendor/google.golang.org/grpc/internal/transport/controlbuf.go b/vendor/google.golang.org/grpc/internal/transport/controlbuf.go index 244f4b081..409769f48 100644 --- a/vendor/google.golang.org/grpc/internal/transport/controlbuf.go +++ b/vendor/google.golang.org/grpc/internal/transport/controlbuf.go @@ -886,9 +886,9 @@ func (l *loopyWriter) processData() (bool, error) { dataItem := str.itl.peek().(*dataFrame) // Peek at the first data item this stream. // A data item is represented by a dataFrame, since it later translates into // multiple HTTP2 data frames. - // Every dataFrame has two buffers; h that keeps grpc-message header and d that is acutal data. + // Every dataFrame has two buffers; h that keeps grpc-message header and d that is actual data. // As an optimization to keep wire traffic low, data from d is copied to h to make as big as the - // maximum possilbe HTTP2 frame size. + // maximum possible HTTP2 frame size. if len(dataItem.h) == 0 && len(dataItem.d) == 0 { // Empty data frame // Client sends out empty data frame with endStream = true diff --git a/vendor/google.golang.org/grpc/internal/transport/http2_client.go b/vendor/google.golang.org/grpc/internal/transport/http2_client.go index 28c77af70..5c2f35b24 100644 --- a/vendor/google.golang.org/grpc/internal/transport/http2_client.go +++ b/vendor/google.golang.org/grpc/internal/transport/http2_client.go @@ -326,6 +326,8 @@ func newHTTP2Client(connectCtx, ctx context.Context, addr resolver.Address, opts keepaliveEnabled: keepaliveEnabled, bufferPool: newBufferPool(), } + // Add peer information to the http2client context. + t.ctx = peer.NewContext(t.ctx, t.getPeer()) if md, ok := addr.Metadata.(*metadata.MD); ok { t.md = *md @@ -469,7 +471,7 @@ func (t *http2Client) newStream(ctx context.Context, callHdr *CallHdr) *Stream { func (t *http2Client) getPeer() *peer.Peer { return &peer.Peer{ Addr: t.remoteAddr, - AuthInfo: t.authInfo, + AuthInfo: t.authInfo, // Can be nil } } @@ -1230,18 +1232,29 @@ func (t *http2Client) handleGoAway(f *http2.GoAwayFrame) { if upperLimit == 0 { // This is the first GoAway Frame. upperLimit = math.MaxUint32 // Kill all streams after the GoAway ID. } + + t.prevGoAwayID = id + if len(t.activeStreams) == 0 { + t.mu.Unlock() + t.Close(connectionErrorf(true, nil, "received goaway and there are no active streams")) + return + } + + streamsToClose := make([]*Stream, 0) for streamID, stream := range t.activeStreams { if streamID > id && streamID <= upperLimit { // The stream was unprocessed by the server. - atomic.StoreUint32(&stream.unprocessed, 1) - t.closeStream(stream, errStreamDrain, false, http2.ErrCodeNo, statusGoAway, nil, false) + if streamID > id && streamID <= upperLimit { + atomic.StoreUint32(&stream.unprocessed, 1) + streamsToClose = append(streamsToClose, stream) + } } } - t.prevGoAwayID = id - active := len(t.activeStreams) t.mu.Unlock() - if active == 0 { - t.Close(connectionErrorf(true, nil, "received goaway and there are no active streams")) + // Called outside t.mu because closeStream can take controlBuf's mu, which + // could induce deadlock and is not allowed. + for _, stream := range streamsToClose { + t.closeStream(stream, errStreamDrain, false, http2.ErrCodeNo, statusGoAway, nil, false) } } diff --git a/vendor/google.golang.org/grpc/internal/transport/http2_server.go b/vendor/google.golang.org/grpc/internal/transport/http2_server.go index 28bcba0a3..3dd15647b 100644 --- a/vendor/google.golang.org/grpc/internal/transport/http2_server.go +++ b/vendor/google.golang.org/grpc/internal/transport/http2_server.go @@ -265,6 +265,9 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport, czData: new(channelzData), bufferPool: newBufferPool(), } + // Add peer information to the http2server context. + t.ctx = peer.NewContext(t.ctx, t.getPeer()) + t.controlBuf = newControlBuffer(t.done) if dynamicWindow { t.bdpEst = &bdpEstimator{ @@ -485,14 +488,7 @@ func (t *http2Server) operateHeaders(frame *http2.MetaHeadersFrame, handle func( } else { s.ctx, s.cancel = context.WithCancel(t.ctx) } - pr := &peer.Peer{ - Addr: t.remoteAddr, - } - // Attach Auth info if there is any. - if t.authInfo != nil { - pr.AuthInfo = t.authInfo - } - s.ctx = peer.NewContext(s.ctx, pr) + // Attach the received metadata to the context. if len(mdata) > 0 { s.ctx = metadata.NewIncomingContext(s.ctx, mdata) @@ -1416,6 +1412,13 @@ func (t *http2Server) getOutFlowWindow() int64 { } } +func (t *http2Server) getPeer() *peer.Peer { + return &peer.Peer{ + Addr: t.remoteAddr, + AuthInfo: t.authInfo, // Can be nil + } +} + func getJitter(v time.Duration) time.Duration { if v == infinity { return 0 diff --git a/vendor/google.golang.org/grpc/internal/transport/http_util.go b/vendor/google.golang.org/grpc/internal/transport/http_util.go index 56e95788d..2c601a864 100644 --- a/vendor/google.golang.org/grpc/internal/transport/http_util.go +++ b/vendor/google.golang.org/grpc/internal/transport/http_util.go @@ -20,7 +20,6 @@ package transport import ( "bufio" - "bytes" "encoding/base64" "fmt" "io" @@ -45,7 +44,7 @@ import ( const ( // http2MaxFrameLen specifies the max length of a HTTP2 frame. http2MaxFrameLen = 16384 // 16KB frame - // http://http2.github.io/http2-spec/#SettingValues + // https://httpwg.org/specs/rfc7540.html#SettingValues http2InitHeaderTableSize = 4096 ) @@ -251,13 +250,13 @@ func encodeGrpcMessage(msg string) string { } func encodeGrpcMessageUnchecked(msg string) string { - var buf bytes.Buffer + var sb strings.Builder for len(msg) > 0 { r, size := utf8.DecodeRuneInString(msg) for _, b := range []byte(string(r)) { if size > 1 { // If size > 1, r is not ascii. Always do percent encoding. - buf.WriteString(fmt.Sprintf("%%%02X", b)) + fmt.Fprintf(&sb, "%%%02X", b) continue } @@ -266,14 +265,14 @@ func encodeGrpcMessageUnchecked(msg string) string { // // fmt.Sprintf("%%%02X", utf8.RuneError) gives "%FFFD". if b >= spaceByte && b <= tildeByte && b != percentByte { - buf.WriteByte(b) + sb.WriteByte(b) } else { - buf.WriteString(fmt.Sprintf("%%%02X", b)) + fmt.Fprintf(&sb, "%%%02X", b) } } msg = msg[size:] } - return buf.String() + return sb.String() } // decodeGrpcMessage decodes the msg encoded by encodeGrpcMessage. @@ -291,23 +290,23 @@ func decodeGrpcMessage(msg string) string { } func decodeGrpcMessageUnchecked(msg string) string { - var buf bytes.Buffer + var sb strings.Builder lenMsg := len(msg) for i := 0; i < lenMsg; i++ { c := msg[i] if c == percentByte && i+2 < lenMsg { parsed, err := strconv.ParseUint(msg[i+1:i+3], 16, 8) if err != nil { - buf.WriteByte(c) + sb.WriteByte(c) } else { - buf.WriteByte(byte(parsed)) + sb.WriteByte(byte(parsed)) i += 2 } } else { - buf.WriteByte(c) + sb.WriteByte(c) } } - return buf.String() + return sb.String() } type bufWriter struct { diff --git a/vendor/google.golang.org/grpc/metadata/metadata.go b/vendor/google.golang.org/grpc/metadata/metadata.go index 8e0f6abe8..98d62e067 100644 --- a/vendor/google.golang.org/grpc/metadata/metadata.go +++ b/vendor/google.golang.org/grpc/metadata/metadata.go @@ -50,7 +50,7 @@ type MD map[string][]string // Keys beginning with "grpc-" are reserved for grpc-internal use only and may // result in errors if set in metadata. func New(m map[string]string) MD { - md := MD{} + md := make(MD, len(m)) for k, val := range m { key := strings.ToLower(k) md[key] = append(md[key], val) @@ -74,7 +74,7 @@ func Pairs(kv ...string) MD { if len(kv)%2 == 1 { panic(fmt.Sprintf("metadata: Pairs got the odd number of input pairs for metadata: %d", len(kv))) } - md := MD{} + md := make(MD, len(kv)/2) for i := 0; i < len(kv); i += 2 { key := strings.ToLower(kv[i]) md[key] = append(md[key], kv[i+1]) @@ -182,19 +182,51 @@ func FromIncomingContext(ctx context.Context) (MD, bool) { if !ok { return nil, false } - out := MD{} + out := make(MD, len(md)) for k, v := range md { // We need to manually convert all keys to lower case, because MD is a // map, and there's no guarantee that the MD attached to the context is // created using our helper functions. key := strings.ToLower(k) - s := make([]string, len(v)) - copy(s, v) - out[key] = s + out[key] = copyOf(v) } return out, true } +// ValueFromIncomingContext returns the metadata value corresponding to the metadata +// key from the incoming metadata if it exists. Key must be lower-case. +// +// Experimental +// +// Notice: This API is EXPERIMENTAL and may be changed or removed in a +// later release. +func ValueFromIncomingContext(ctx context.Context, key string) []string { + md, ok := ctx.Value(mdIncomingKey{}).(MD) + if !ok { + return nil + } + + if v, ok := md[key]; ok { + return copyOf(v) + } + for k, v := range md { + // We need to manually convert all keys to lower case, because MD is a + // map, and there's no guarantee that the MD attached to the context is + // created using our helper functions. + if strings.ToLower(k) == key { + return copyOf(v) + } + } + return nil +} + +// the returned slice must not be modified in place +func copyOf(v []string) []string { + vals := make([]string, len(v)) + copy(vals, v) + return vals +} + // FromOutgoingContextRaw returns the un-merged, intermediary contents of rawMD. // // Remember to perform strings.ToLower on the keys, for both the returned MD (MD @@ -222,15 +254,18 @@ func FromOutgoingContext(ctx context.Context) (MD, bool) { return nil, false } - out := MD{} + mdSize := len(raw.md) + for i := range raw.added { + mdSize += len(raw.added[i]) / 2 + } + + out := make(MD, mdSize) for k, v := range raw.md { // We need to manually convert all keys to lower case, because MD is a // map, and there's no guarantee that the MD attached to the context is // created using our helper functions. key := strings.ToLower(k) - s := make([]string, len(v)) - copy(s, v) - out[key] = s + out[key] = copyOf(v) } for _, added := range raw.added { if len(added)%2 == 1 { diff --git a/vendor/google.golang.org/grpc/reflection/grpc_reflection_v1alpha/reflection_grpc.pb.go b/vendor/google.golang.org/grpc/reflection/grpc_reflection_v1alpha/reflection_grpc.pb.go index 4e6a6b1a8..b8e76a87d 100644 --- a/vendor/google.golang.org/grpc/reflection/grpc_reflection_v1alpha/reflection_grpc.pb.go +++ b/vendor/google.golang.org/grpc/reflection/grpc_reflection_v1alpha/reflection_grpc.pb.go @@ -1,3 +1,19 @@ +// Copyright 2016 gRPC authors. +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +// Service exported by server reflection + // Code generated by protoc-gen-go-grpc. DO NOT EDIT. // versions: // - protoc-gen-go-grpc v1.2.0 diff --git a/vendor/google.golang.org/grpc/server.go b/vendor/google.golang.org/grpc/server.go index 2ad9da7bf..f4dde72b4 100644 --- a/vendor/google.golang.org/grpc/server.go +++ b/vendor/google.golang.org/grpc/server.go @@ -73,12 +73,14 @@ func init() { internal.DrainServerTransports = func(srv *Server, addr string) { srv.drainServerTransports(addr) } - internal.AddExtraServerOptions = func(opt ...ServerOption) { - extraServerOptions = opt + internal.AddGlobalServerOptions = func(opt ...ServerOption) { + extraServerOptions = append(extraServerOptions, opt...) } - internal.ClearExtraServerOptions = func() { + internal.ClearGlobalServerOptions = func() { extraServerOptions = nil } + internal.BinaryLogger = binaryLogger + internal.JoinServerOptions = newJoinServerOption } var statusOK = status.New(codes.OK, "") @@ -155,6 +157,7 @@ type serverOptions struct { streamInt StreamServerInterceptor chainUnaryInts []UnaryServerInterceptor chainStreamInts []StreamServerInterceptor + binaryLogger binarylog.Logger inTapHandle tap.ServerInHandle statsHandlers []stats.Handler maxConcurrentStreams uint32 @@ -214,6 +217,22 @@ func newFuncServerOption(f func(*serverOptions)) *funcServerOption { } } +// joinServerOption provides a way to combine arbitrary number of server +// options into one. +type joinServerOption struct { + opts []ServerOption +} + +func (mdo *joinServerOption) apply(do *serverOptions) { + for _, opt := range mdo.opts { + opt.apply(do) + } +} + +func newJoinServerOption(opts ...ServerOption) ServerOption { + return &joinServerOption{opts: opts} +} + // WriteBufferSize determines how much data can be batched before doing a write on the wire. // The corresponding memory allocation for this buffer will be twice the size to keep syscalls low. // The default value for this buffer is 32KB. @@ -452,6 +471,14 @@ func StatsHandler(h stats.Handler) ServerOption { }) } +// binaryLogger returns a ServerOption that can set the binary logger for the +// server. +func binaryLogger(bl binarylog.Logger) ServerOption { + return newFuncServerOption(func(o *serverOptions) { + o.binaryLogger = bl + }) +} + // UnknownServiceHandler returns a ServerOption that allows for adding a custom // unknown service handler. The provided method is a bidi-streaming RPC service // handler that will be invoked instead of returning the "unimplemented" gRPC @@ -1199,9 +1226,16 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. } }() } - - binlog := binarylog.GetMethodLogger(stream.Method()) - if binlog != nil { + var binlogs []binarylog.MethodLogger + if ml := binarylog.GetMethodLogger(stream.Method()); ml != nil { + binlogs = append(binlogs, ml) + } + if s.opts.binaryLogger != nil { + if ml := s.opts.binaryLogger.GetMethodLogger(stream.Method()); ml != nil { + binlogs = append(binlogs, ml) + } + } + if len(binlogs) != 0 { ctx := stream.Context() md, _ := metadata.FromIncomingContext(ctx) logEntry := &binarylog.ClientHeader{ @@ -1221,7 +1255,9 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. if peer, ok := peer.FromContext(ctx); ok { logEntry.PeerAddr = peer.Addr } - binlog.Log(logEntry) + for _, binlog := range binlogs { + binlog.Log(logEntry) + } } // comp and cp are used for compression. decomp and dc are used for @@ -1261,7 +1297,7 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. } var payInfo *payloadInfo - if len(shs) != 0 || binlog != nil { + if len(shs) != 0 || len(binlogs) != 0 { payInfo = &payloadInfo{} } d, err := recvAndDecompress(&parser{r: stream}, stream, dc, s.opts.maxReceiveMessageSize, payInfo, decomp) @@ -1287,10 +1323,13 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. Length: len(d), }) } - if binlog != nil { - binlog.Log(&binarylog.ClientMessage{ + if len(binlogs) != 0 { + cm := &binarylog.ClientMessage{ Message: d, - }) + } + for _, binlog := range binlogs { + binlog.Log(cm) + } } if trInfo != nil { trInfo.tr.LazyLog(&payload{sent: false, msg: v}, true) @@ -1314,18 +1353,24 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. if e := t.WriteStatus(stream, appStatus); e != nil { channelz.Warningf(logger, s.channelzID, "grpc: Server.processUnaryRPC failed to write status: %v", e) } - if binlog != nil { + if len(binlogs) != 0 { if h, _ := stream.Header(); h.Len() > 0 { // Only log serverHeader if there was header. Otherwise it can // be trailer only. - binlog.Log(&binarylog.ServerHeader{ + sh := &binarylog.ServerHeader{ Header: h, - }) + } + for _, binlog := range binlogs { + binlog.Log(sh) + } } - binlog.Log(&binarylog.ServerTrailer{ + st := &binarylog.ServerTrailer{ Trailer: stream.Trailer(), Err: appErr, - }) + } + for _, binlog := range binlogs { + binlog.Log(st) + } } return appErr } @@ -1351,26 +1396,34 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. panic(fmt.Sprintf("grpc: Unexpected error (%T) from sendResponse: %v", st, st)) } } - if binlog != nil { + if len(binlogs) != 0 { h, _ := stream.Header() - binlog.Log(&binarylog.ServerHeader{ + sh := &binarylog.ServerHeader{ Header: h, - }) - binlog.Log(&binarylog.ServerTrailer{ + } + st := &binarylog.ServerTrailer{ Trailer: stream.Trailer(), Err: appErr, - }) + } + for _, binlog := range binlogs { + binlog.Log(sh) + binlog.Log(st) + } } return err } - if binlog != nil { + if len(binlogs) != 0 { h, _ := stream.Header() - binlog.Log(&binarylog.ServerHeader{ + sh := &binarylog.ServerHeader{ Header: h, - }) - binlog.Log(&binarylog.ServerMessage{ + } + sm := &binarylog.ServerMessage{ Message: reply, - }) + } + for _, binlog := range binlogs { + binlog.Log(sh) + binlog.Log(sm) + } } if channelz.IsOn() { t.IncrMsgSent() @@ -1382,11 +1435,14 @@ func (s *Server) processUnaryRPC(t transport.ServerTransport, stream *transport. // Should the logging be in WriteStatus? Should we ignore the WriteStatus // error or allow the stats handler to see it? err = t.WriteStatus(stream, statusOK) - if binlog != nil { - binlog.Log(&binarylog.ServerTrailer{ + if len(binlogs) != 0 { + st := &binarylog.ServerTrailer{ Trailer: stream.Trailer(), Err: appErr, - }) + } + for _, binlog := range binlogs { + binlog.Log(st) + } } return err } @@ -1499,8 +1555,15 @@ func (s *Server) processStreamingRPC(t transport.ServerTransport, stream *transp }() } - ss.binlog = binarylog.GetMethodLogger(stream.Method()) - if ss.binlog != nil { + if ml := binarylog.GetMethodLogger(stream.Method()); ml != nil { + ss.binlogs = append(ss.binlogs, ml) + } + if s.opts.binaryLogger != nil { + if ml := s.opts.binaryLogger.GetMethodLogger(stream.Method()); ml != nil { + ss.binlogs = append(ss.binlogs, ml) + } + } + if len(ss.binlogs) != 0 { md, _ := metadata.FromIncomingContext(ctx) logEntry := &binarylog.ClientHeader{ Header: md, @@ -1519,7 +1582,9 @@ func (s *Server) processStreamingRPC(t transport.ServerTransport, stream *transp if peer, ok := peer.FromContext(ss.Context()); ok { logEntry.PeerAddr = peer.Addr } - ss.binlog.Log(logEntry) + for _, binlog := range ss.binlogs { + binlog.Log(logEntry) + } } // If dc is set and matches the stream's compression, use it. Otherwise, try @@ -1585,11 +1650,14 @@ func (s *Server) processStreamingRPC(t transport.ServerTransport, stream *transp ss.mu.Unlock() } t.WriteStatus(ss.s, appStatus) - if ss.binlog != nil { - ss.binlog.Log(&binarylog.ServerTrailer{ + if len(ss.binlogs) != 0 { + st := &binarylog.ServerTrailer{ Trailer: ss.s.Trailer(), Err: appErr, - }) + } + for _, binlog := range ss.binlogs { + binlog.Log(st) + } } // TODO: Should we log an error from WriteStatus here and below? return appErr @@ -1600,11 +1668,14 @@ func (s *Server) processStreamingRPC(t transport.ServerTransport, stream *transp ss.mu.Unlock() } err = t.WriteStatus(ss.s, statusOK) - if ss.binlog != nil { - ss.binlog.Log(&binarylog.ServerTrailer{ + if len(ss.binlogs) != 0 { + st := &binarylog.ServerTrailer{ Trailer: ss.s.Trailer(), Err: appErr, - }) + } + for _, binlog := range ss.binlogs { + binlog.Log(st) + } } return err } diff --git a/vendor/google.golang.org/grpc/stream.go b/vendor/google.golang.org/grpc/stream.go index 446a91e32..0c16cfb2e 100644 --- a/vendor/google.golang.org/grpc/stream.go +++ b/vendor/google.golang.org/grpc/stream.go @@ -301,7 +301,14 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client if !cc.dopts.disableRetry { cs.retryThrottler = cc.retryThrottler.Load().(*retryThrottler) } - cs.binlog = binarylog.GetMethodLogger(method) + if ml := binarylog.GetMethodLogger(method); ml != nil { + cs.binlogs = append(cs.binlogs, ml) + } + if cc.dopts.binaryLogger != nil { + if ml := cc.dopts.binaryLogger.GetMethodLogger(method); ml != nil { + cs.binlogs = append(cs.binlogs, ml) + } + } // Pick the transport to use and create a new stream on the transport. // Assign cs.attempt upon success. @@ -322,7 +329,7 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client return nil, err } - if cs.binlog != nil { + if len(cs.binlogs) != 0 { md, _ := metadata.FromOutgoingContext(ctx) logEntry := &binarylog.ClientHeader{ OnClientSide: true, @@ -336,7 +343,9 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client logEntry.Timeout = 0 } } - cs.binlog.Log(logEntry) + for _, binlog := range cs.binlogs { + binlog.Log(logEntry) + } } if desc != unaryStreamDesc { @@ -480,7 +489,7 @@ type clientStream struct { retryThrottler *retryThrottler // The throttler active when the RPC began. - binlog binarylog.MethodLogger // Binary logger, can be nil. + binlogs []binarylog.MethodLogger // serverHeaderBinlogged is a boolean for whether server header has been // logged. Server header will be logged when the first time one of those // happens: stream.Header(), stream.Recv(). @@ -744,7 +753,7 @@ func (cs *clientStream) Header() (metadata.MD, error) { cs.finish(err) return nil, err } - if cs.binlog != nil && !cs.serverHeaderBinlogged { + if len(cs.binlogs) != 0 && !cs.serverHeaderBinlogged { // Only log if binary log is on and header has not been logged. logEntry := &binarylog.ServerHeader{ OnClientSide: true, @@ -754,8 +763,10 @@ func (cs *clientStream) Header() (metadata.MD, error) { if peer, ok := peer.FromContext(cs.Context()); ok { logEntry.PeerAddr = peer.Addr } - cs.binlog.Log(logEntry) cs.serverHeaderBinlogged = true + for _, binlog := range cs.binlogs { + binlog.Log(logEntry) + } } return m, nil } @@ -829,38 +840,44 @@ func (cs *clientStream) SendMsg(m interface{}) (err error) { return a.sendMsg(m, hdr, payload, data) } err = cs.withRetry(op, func() { cs.bufferForRetryLocked(len(hdr)+len(payload), op) }) - if cs.binlog != nil && err == nil { - cs.binlog.Log(&binarylog.ClientMessage{ + if len(cs.binlogs) != 0 && err == nil { + cm := &binarylog.ClientMessage{ OnClientSide: true, Message: data, - }) + } + for _, binlog := range cs.binlogs { + binlog.Log(cm) + } } return err } func (cs *clientStream) RecvMsg(m interface{}) error { - if cs.binlog != nil && !cs.serverHeaderBinlogged { + if len(cs.binlogs) != 0 && !cs.serverHeaderBinlogged { // Call Header() to binary log header if it's not already logged. cs.Header() } var recvInfo *payloadInfo - if cs.binlog != nil { + if len(cs.binlogs) != 0 { recvInfo = &payloadInfo{} } err := cs.withRetry(func(a *csAttempt) error { return a.recvMsg(m, recvInfo) }, cs.commitAttemptLocked) - if cs.binlog != nil && err == nil { - cs.binlog.Log(&binarylog.ServerMessage{ + if len(cs.binlogs) != 0 && err == nil { + sm := &binarylog.ServerMessage{ OnClientSide: true, Message: recvInfo.uncompressedBytes, - }) + } + for _, binlog := range cs.binlogs { + binlog.Log(sm) + } } if err != nil || !cs.desc.ServerStreams { // err != nil or non-server-streaming indicates end of stream. cs.finish(err) - if cs.binlog != nil { + if len(cs.binlogs) != 0 { // finish will not log Trailer. Log Trailer here. logEntry := &binarylog.ServerTrailer{ OnClientSide: true, @@ -873,7 +890,9 @@ func (cs *clientStream) RecvMsg(m interface{}) error { if peer, ok := peer.FromContext(cs.Context()); ok { logEntry.PeerAddr = peer.Addr } - cs.binlog.Log(logEntry) + for _, binlog := range cs.binlogs { + binlog.Log(logEntry) + } } } return err @@ -894,10 +913,13 @@ func (cs *clientStream) CloseSend() error { return nil } cs.withRetry(op, func() { cs.bufferForRetryLocked(0, op) }) - if cs.binlog != nil { - cs.binlog.Log(&binarylog.ClientHalfClose{ + if len(cs.binlogs) != 0 { + chc := &binarylog.ClientHalfClose{ OnClientSide: true, - }) + } + for _, binlog := range cs.binlogs { + binlog.Log(chc) + } } // We never returned an error here for reasons. return nil @@ -930,10 +952,13 @@ func (cs *clientStream) finish(err error) { // // Only one of cancel or trailer needs to be logged. In the cases where // users don't call RecvMsg, users must have already canceled the RPC. - if cs.binlog != nil && status.Code(err) == codes.Canceled { - cs.binlog.Log(&binarylog.Cancel{ + if len(cs.binlogs) != 0 && status.Code(err) == codes.Canceled { + c := &binarylog.Cancel{ OnClientSide: true, - }) + } + for _, binlog := range cs.binlogs { + binlog.Log(c) + } } if err == nil { cs.retryThrottler.successfulRPC() @@ -1005,6 +1030,7 @@ func (a *csAttempt) recvMsg(m interface{}, payInfo *payloadInfo) (err error) { } return io.EOF // indicates successful end of stream. } + return toRPCErr(err) } if a.trInfo != nil { @@ -1453,7 +1479,7 @@ type serverStream struct { statsHandler []stats.Handler - binlog binarylog.MethodLogger + binlogs []binarylog.MethodLogger // serverHeaderBinlogged indicates whether server header has been logged. It // will happen when one of the following two happens: stream.SendHeader(), // stream.Send(). @@ -1487,12 +1513,15 @@ func (ss *serverStream) SendHeader(md metadata.MD) error { } err = ss.t.WriteHeader(ss.s, md) - if ss.binlog != nil && !ss.serverHeaderBinlogged { + if len(ss.binlogs) != 0 && !ss.serverHeaderBinlogged { h, _ := ss.s.Header() - ss.binlog.Log(&binarylog.ServerHeader{ + sh := &binarylog.ServerHeader{ Header: h, - }) + } ss.serverHeaderBinlogged = true + for _, binlog := range ss.binlogs { + binlog.Log(sh) + } } return err } @@ -1549,17 +1578,23 @@ func (ss *serverStream) SendMsg(m interface{}) (err error) { if err := ss.t.Write(ss.s, hdr, payload, &transport.Options{Last: false}); err != nil { return toRPCErr(err) } - if ss.binlog != nil { + if len(ss.binlogs) != 0 { if !ss.serverHeaderBinlogged { h, _ := ss.s.Header() - ss.binlog.Log(&binarylog.ServerHeader{ + sh := &binarylog.ServerHeader{ Header: h, - }) + } ss.serverHeaderBinlogged = true + for _, binlog := range ss.binlogs { + binlog.Log(sh) + } } - ss.binlog.Log(&binarylog.ServerMessage{ + sm := &binarylog.ServerMessage{ Message: data, - }) + } + for _, binlog := range ss.binlogs { + binlog.Log(sm) + } } if len(ss.statsHandler) != 0 { for _, sh := range ss.statsHandler { @@ -1598,13 +1633,16 @@ func (ss *serverStream) RecvMsg(m interface{}) (err error) { } }() var payInfo *payloadInfo - if len(ss.statsHandler) != 0 || ss.binlog != nil { + if len(ss.statsHandler) != 0 || len(ss.binlogs) != 0 { payInfo = &payloadInfo{} } if err := recv(ss.p, ss.codec, ss.s, ss.dc, m, ss.maxReceiveMessageSize, payInfo, ss.decomp); err != nil { if err == io.EOF { - if ss.binlog != nil { - ss.binlog.Log(&binarylog.ClientHalfClose{}) + if len(ss.binlogs) != 0 { + chc := &binarylog.ClientHalfClose{} + for _, binlog := range ss.binlogs { + binlog.Log(chc) + } } return err } @@ -1625,10 +1663,13 @@ func (ss *serverStream) RecvMsg(m interface{}) (err error) { }) } } - if ss.binlog != nil { - ss.binlog.Log(&binarylog.ClientMessage{ + if len(ss.binlogs) != 0 { + cm := &binarylog.ClientMessage{ Message: payInfo.uncompressedBytes, - }) + } + for _, binlog := range ss.binlogs { + binlog.Log(cm) + } } return nil } diff --git a/vendor/google.golang.org/grpc/version.go b/vendor/google.golang.org/grpc/version.go index 8934f06bc..d472ca643 100644 --- a/vendor/google.golang.org/grpc/version.go +++ b/vendor/google.golang.org/grpc/version.go @@ -19,4 +19,4 @@ package grpc // Version is the current grpc version. -const Version = "1.49.0" +const Version = "1.50.1" diff --git a/vendor/modules.txt b/vendor/modules.txt index 608968f37..03dcef517 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -53,7 +53,7 @@ github.com/go-openapi/jsonreference/internal # github.com/go-openapi/loads v0.21.2 ## explicit; go 1.13 github.com/go-openapi/loads -# github.com/go-openapi/runtime v0.24.1 +# github.com/go-openapi/runtime v0.24.2 ## explicit; go 1.15 github.com/go-openapi/runtime github.com/go-openapi/runtime/client @@ -85,7 +85,7 @@ github.com/golang/protobuf/ptypes/any github.com/golang/protobuf/ptypes/duration github.com/golang/protobuf/ptypes/empty github.com/golang/protobuf/ptypes/timestamp -# github.com/google/go-cmp v0.5.8 +# github.com/google/go-cmp v0.5.9 ## explicit; go 1.13 github.com/google/go-cmp/cmp github.com/google/go-cmp/cmp/internal/diff @@ -112,13 +112,13 @@ github.com/hashicorp/go-cty/cty/gocty github.com/hashicorp/go-cty/cty/json github.com/hashicorp/go-cty/cty/msgpack github.com/hashicorp/go-cty/cty/set -# github.com/hashicorp/go-hclog v1.2.2 +# github.com/hashicorp/go-hclog v1.3.1 ## explicit; go 1.13 github.com/hashicorp/go-hclog # github.com/hashicorp/go-multierror v1.1.1 ## explicit; go 1.13 github.com/hashicorp/go-multierror -# github.com/hashicorp/go-plugin v1.4.5 +# github.com/hashicorp/go-plugin v1.4.6 ## explicit; go 1.17 github.com/hashicorp/go-plugin github.com/hashicorp/go-plugin/internal/plugin @@ -144,7 +144,7 @@ github.com/hashicorp/hc-install/internal/version github.com/hashicorp/hc-install/product github.com/hashicorp/hc-install/releases github.com/hashicorp/hc-install/src -# github.com/hashicorp/hcl/v2 v2.13.0 +# github.com/hashicorp/hcl/v2 v2.15.0 ## explicit; go 1.18 github.com/hashicorp/hcl/v2 github.com/hashicorp/hcl/v2/ext/customdecode @@ -152,14 +152,14 @@ github.com/hashicorp/hcl/v2/hclsyntax # github.com/hashicorp/logutils v1.0.0 ## explicit github.com/hashicorp/logutils -# github.com/hashicorp/terraform-exec v0.17.2 -## explicit; go 1.17 +# github.com/hashicorp/terraform-exec v0.17.3 +## explicit; go 1.18 github.com/hashicorp/terraform-exec/internal/version github.com/hashicorp/terraform-exec/tfexec # github.com/hashicorp/terraform-json v0.14.0 ## explicit; go 1.13 github.com/hashicorp/terraform-json -# github.com/hashicorp/terraform-plugin-docs v0.10.1 +# github.com/hashicorp/terraform-plugin-docs v0.13.0 ## explicit; go 1.17 github.com/hashicorp/terraform-plugin-docs/cmd/tfplugindocs github.com/hashicorp/terraform-plugin-docs/internal/cmd @@ -167,7 +167,7 @@ github.com/hashicorp/terraform-plugin-docs/internal/mdplain github.com/hashicorp/terraform-plugin-docs/internal/provider github.com/hashicorp/terraform-plugin-docs/internal/tmplfuncs github.com/hashicorp/terraform-plugin-docs/schemamd -# github.com/hashicorp/terraform-plugin-go v0.14.0 +# github.com/hashicorp/terraform-plugin-go v0.14.1 ## explicit; go 1.18 github.com/hashicorp/terraform-plugin-go/internal/logging github.com/hashicorp/terraform-plugin-go/tfprotov5 @@ -192,7 +192,7 @@ github.com/hashicorp/terraform-plugin-log/internal/hclogutils github.com/hashicorp/terraform-plugin-log/internal/logging github.com/hashicorp/terraform-plugin-log/tflog github.com/hashicorp/terraform-plugin-log/tfsdklog -# github.com/hashicorp/terraform-plugin-sdk/v2 v2.21.0 +# github.com/hashicorp/terraform-plugin-sdk/v2 v2.24.1 ## explicit; go 1.18 github.com/hashicorp/terraform-plugin-sdk/v2/diag github.com/hashicorp/terraform-plugin-sdk/v2/helper/acctest @@ -213,7 +213,7 @@ github.com/hashicorp/terraform-plugin-sdk/v2/internal/tfdiags github.com/hashicorp/terraform-plugin-sdk/v2/meta github.com/hashicorp/terraform-plugin-sdk/v2/plugin github.com/hashicorp/terraform-plugin-sdk/v2/terraform -# github.com/hashicorp/terraform-registry-address v0.0.0-20220623143253-7d51757b572c +# github.com/hashicorp/terraform-registry-address v0.1.0 ## explicit; go 1.14 github.com/hashicorp/terraform-registry-address # github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734 @@ -222,7 +222,7 @@ github.com/hashicorp/terraform-svchost # github.com/hashicorp/yamux v0.1.1 ## explicit; go 1.15 github.com/hashicorp/yamux -# github.com/huandu/xstrings v1.3.2 +# github.com/huandu/xstrings v1.3.3 ## explicit; go 1.12 github.com/huandu/xstrings # github.com/imdario/mergo v0.3.13 @@ -242,7 +242,7 @@ github.com/mattn/go-colorable # github.com/mattn/go-isatty v0.0.16 ## explicit; go 1.15 github.com/mattn/go-isatty -# github.com/mitchellh/cli v1.1.4 +# github.com/mitchellh/cli v1.1.5 ## explicit; go 1.11 github.com/mitchellh/cli # github.com/mitchellh/copystructure v1.2.0 @@ -311,7 +311,7 @@ github.com/vmihailenco/msgpack/v4/codes github.com/vmihailenco/tagparser github.com/vmihailenco/tagparser/internal github.com/vmihailenco/tagparser/internal/parser -# github.com/zclconf/go-cty v1.11.0 +# github.com/zclconf/go-cty v1.12.1 ## explicit; go 1.18 github.com/zclconf/go-cty/cty github.com/zclconf/go-cty/cty/convert @@ -320,8 +320,8 @@ github.com/zclconf/go-cty/cty/function/stdlib github.com/zclconf/go-cty/cty/gocty github.com/zclconf/go-cty/cty/json github.com/zclconf/go-cty/cty/set -# go.mongodb.org/mongo-driver v1.10.1 -## explicit; go 1.10 +# go.mongodb.org/mongo-driver v1.11.0 +## explicit; go 1.13 go.mongodb.org/mongo-driver/bson go.mongodb.org/mongo-driver/bson/bsoncodec go.mongodb.org/mongo-driver/bson/bsonoptions @@ -329,7 +329,7 @@ go.mongodb.org/mongo-driver/bson/bsonrw go.mongodb.org/mongo-driver/bson/bsontype go.mongodb.org/mongo-driver/bson/primitive go.mongodb.org/mongo-driver/x/bsonx/bsoncore -# golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d +# golang.org/x/crypto v0.2.0 ## explicit; go 1.17 golang.org/x/crypto/bcrypt golang.org/x/crypto/blowfish @@ -338,8 +338,8 @@ golang.org/x/crypto/chacha20 golang.org/x/crypto/curve25519 golang.org/x/crypto/curve25519/internal/field golang.org/x/crypto/ed25519 +golang.org/x/crypto/internal/alias golang.org/x/crypto/internal/poly1305 -golang.org/x/crypto/internal/subtle golang.org/x/crypto/openpgp golang.org/x/crypto/openpgp/armor golang.org/x/crypto/openpgp/elgamal @@ -350,7 +350,7 @@ golang.org/x/crypto/pbkdf2 golang.org/x/crypto/scrypt golang.org/x/crypto/ssh golang.org/x/crypto/ssh/internal/bcrypt_pbkdf -# golang.org/x/net v0.0.0-20220822230855-b0a4917ee28c +# golang.org/x/net v0.2.0 ## explicit; go 1.17 golang.org/x/net/context golang.org/x/net/http/httpguts @@ -359,13 +359,18 @@ golang.org/x/net/http2/hpack golang.org/x/net/idna golang.org/x/net/internal/timeseries golang.org/x/net/trace -# golang.org/x/sys v0.0.0-20220825204002-c680a09ffe64 +# golang.org/x/sys v0.2.0 ## explicit; go 1.17 golang.org/x/sys/cpu -golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix -# golang.org/x/text v0.3.7 +# golang.org/x/text v0.4.0 ## explicit; go 1.17 +golang.org/x/text/cases +golang.org/x/text/internal +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/tag +golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi @@ -383,10 +388,10 @@ google.golang.org/appengine/internal/datastore google.golang.org/appengine/internal/log google.golang.org/appengine/internal/modules google.golang.org/appengine/internal/remote_api -# google.golang.org/genproto v0.0.0-20220822174746-9e6da59bd2fc +# google.golang.org/genproto v0.0.0-20221114212237-e4508ebdbee1 ## explicit; go 1.19 google.golang.org/genproto/googleapis/rpc/status -# google.golang.org/grpc v1.49.0 +# google.golang.org/grpc v1.50.1 ## explicit; go 1.17 google.golang.org/grpc google.golang.org/grpc/attributes