From 3c4c74c1b3c6c92fb4c3e6d1bdf5436078ed5e94 Mon Sep 17 00:00:00 2001 From: Bharath B Date: Sat, 5 Aug 2023 20:43:38 +0530 Subject: [PATCH] CFE-683 : Update openshift/api package to latest version --- go.mod | 18 +- go.sum | 38 +- ...ersion-operator_01_clusterversion.crd.yaml | 6 + ...ator_01_apiserver-CustomNoUpgrade.crd.yaml | 179 + ...g-operator_01_dns-CustomNoUpgrade.crd.yaml | 114 + ...0_config-operator_01_dns-Default.crd.yaml} | 42 + ...rator_01_dns-TechPreviewNoUpgrade.crd.yaml | 114 + ...01_infrastructure-CustomNoUpgrade.crd.yaml | 999 +++ ...rastructure-CustomNoUpgrade.crd.yaml-patch | 24 + ...perator_01_infrastructure-Default.crd.yaml | 21 + ...frastructure-TechPreviewNoUpgrade.crd.yaml | 94 + .../config/v1/custom.apiserver.testsuite.yaml | 35 + .../api/config/v1/custom.dns.testsuite.yaml | 104 + .../v1/custom.infrastructure.testsuite.yaml | 321 + .../openshift/api/config/v1/feature_gates.go | 119 +- .../api/config/v1/stable.dns.testsuite.yaml | 93 +- .../v1/stable.infrastructure.testsuite.yaml | 489 + .../config/v1/techpreview.dns.testsuite.yaml | 14 + .../techpreview.infrastructure.testsuite.yaml | 306 + .../api/config/v1/types_cluster_version.go | 25 +- .../openshift/api/config/v1/types_dns.go | 37 + .../openshift/api/config/v1/types_feature.go | 16 +- .../api/config/v1/types_infrastructure.go | 133 +- .../api/config/v1/zz_generated.deepcopy.go | 99 +- .../v1/zz_generated.swagger_doc_generated.go | 61 +- ...or_01_backup-TechPreviewNoUpgrade.crd.yaml | 100 + .../openshift/api/config/v1alpha1/register.go | 2 + .../techpreview.backup.testsuite.yaml | 202 + .../api/config/v1alpha1/types_backup.go | 168 + .../config/v1alpha1/zz_generated.deepcopy.go | 169 + .../zz_generated.swagger_doc_generated.go | 69 + .../0000_10_controlplanemachineset.crd.yaml | 36 + ...olplanemachineset.openstack.testsuite.yaml | 601 ++ .../v1/types_controlplanemachineset.go | 67 + .../api/machine/v1/zz_generated.deepcopy.go | 44 + .../v1/zz_generated.swagger_doc_generated.go | 31 +- .../machine/v1beta1/0000_10_machine.crd.yaml | 1 + .../v1beta1/0000_10_machinehealthcheck.yaml | 1 + .../v1beta1/0000_10_machineset.crd.yaml | 1 + .../api/machine/v1beta1/types_awsprovider.go | 5 + .../machine/v1beta1/types_azureprovider.go | 118 +- .../api/machine/v1beta1/types_machine.go | 8 + .../api/machine/v1beta1/types_provider.go | 5 + .../machine/v1beta1/types_vsphereprovider.go | 77 +- .../machine/v1beta1/zz_generated.deepcopy.go | 130 +- .../zz_generated.swagger_doc_generated.go | 73 +- vendor/golang.org/x/net/html/render.go | 28 +- vendor/golang.org/x/net/html/token.go | 9 +- vendor/golang.org/x/net/http2/server.go | 9 +- vendor/golang.org/x/net/http2/transport.go | 79 +- vendor/golang.org/x/net/http2/writesched.go | 3 +- .../x/net/http2/writesched_roundrobin.go | 119 + vendor/golang.org/x/net/idna/idna9.0.0.go | 2 +- vendor/golang.org/x/net/idna/tables13.0.0.go | 2988 ++++--- vendor/golang.org/x/net/idna/tables15.0.0.go | 5145 +++++++++++ vendor/golang.org/x/net/idna/trie.go | 21 - vendor/golang.org/x/net/idna/trie12.0.0.go | 31 + vendor/golang.org/x/net/idna/trie13.0.0.go | 31 + vendor/golang.org/x/sys/unix/mkall.sh | 2 +- vendor/golang.org/x/sys/unix/mkerrors.sh | 10 +- vendor/golang.org/x/sys/unix/mmap_nomremap.go | 14 + vendor/golang.org/x/sys/unix/mremap.go | 53 + vendor/golang.org/x/sys/unix/syscall_aix.go | 15 - vendor/golang.org/x/sys/unix/syscall_bsd.go | 14 - .../golang.org/x/sys/unix/syscall_darwin.go | 50 +- vendor/golang.org/x/sys/unix/syscall_linux.go | 88 +- .../x/sys/unix/syscall_linux_amd64.go | 2 +- .../x/sys/unix/syscall_linux_arm64.go | 2 +- .../x/sys/unix/syscall_linux_loong64.go | 2 +- .../x/sys/unix/syscall_linux_mips64x.go | 2 +- .../x/sys/unix/syscall_linux_riscv64.go | 13 +- .../golang.org/x/sys/unix/syscall_netbsd.go | 13 +- .../golang.org/x/sys/unix/syscall_openbsd.go | 17 +- .../golang.org/x/sys/unix/syscall_solaris.go | 14 - vendor/golang.org/x/sys/unix/syscall_unix.go | 8 + .../x/sys/unix/syscall_zos_s390x.go | 14 - vendor/golang.org/x/sys/unix/zerrors_linux.go | 26 +- .../x/sys/unix/zerrors_linux_386.go | 9 + .../x/sys/unix/zerrors_linux_amd64.go | 9 + .../x/sys/unix/zerrors_linux_arm.go | 9 + .../x/sys/unix/zerrors_linux_arm64.go | 11 + .../x/sys/unix/zerrors_linux_loong64.go | 9 + .../x/sys/unix/zerrors_linux_mips.go | 9 + .../x/sys/unix/zerrors_linux_mips64.go | 9 + .../x/sys/unix/zerrors_linux_mips64le.go | 9 + .../x/sys/unix/zerrors_linux_mipsle.go | 9 + .../x/sys/unix/zerrors_linux_ppc.go | 9 + .../x/sys/unix/zerrors_linux_ppc64.go | 9 + .../x/sys/unix/zerrors_linux_ppc64le.go | 9 + .../x/sys/unix/zerrors_linux_riscv64.go | 9 + .../x/sys/unix/zerrors_linux_s390x.go | 9 + .../x/sys/unix/zerrors_linux_sparc64.go | 57 + .../golang.org/x/sys/unix/zsyscall_linux.go | 27 +- .../x/sys/unix/zsyscall_linux_riscv64.go | 16 + .../x/sys/unix/zsyscall_netbsd_386.go | 11 + .../x/sys/unix/zsyscall_netbsd_amd64.go | 11 + .../x/sys/unix/zsyscall_netbsd_arm.go | 11 + .../x/sys/unix/zsyscall_netbsd_arm64.go | 11 + .../x/sys/unix/zsyscall_openbsd_386.go | 22 + .../x/sys/unix/zsyscall_openbsd_386.s | 10 + .../x/sys/unix/zsyscall_openbsd_amd64.go | 32 +- .../x/sys/unix/zsyscall_openbsd_amd64.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm.go | 22 + .../x/sys/unix/zsyscall_openbsd_arm.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm64.go | 22 + .../x/sys/unix/zsyscall_openbsd_arm64.s | 10 + .../x/sys/unix/zsyscall_openbsd_mips64.go | 22 + .../x/sys/unix/zsyscall_openbsd_mips64.s | 10 + .../x/sys/unix/zsyscall_openbsd_ppc64.go | 22 + .../x/sys/unix/zsyscall_openbsd_ppc64.s | 12 + .../x/sys/unix/zsyscall_openbsd_riscv64.go | 22 + .../x/sys/unix/zsyscall_openbsd_riscv64.s | 10 + .../x/sys/unix/zsysnum_linux_riscv64.go | 2 + .../x/sys/unix/zsysnum_linux_s390x.go | 1 + vendor/golang.org/x/sys/unix/ztypes_linux.go | 86 +- .../golang.org/x/sys/unix/ztypes_linux_386.go | 2 + .../x/sys/unix/ztypes_linux_amd64.go | 2 + .../golang.org/x/sys/unix/ztypes_linux_arm.go | 2 + .../x/sys/unix/ztypes_linux_arm64.go | 2 + .../x/sys/unix/ztypes_linux_loong64.go | 2 + .../x/sys/unix/ztypes_linux_mips.go | 2 + .../x/sys/unix/ztypes_linux_mips64.go | 2 + .../x/sys/unix/ztypes_linux_mips64le.go | 2 + .../x/sys/unix/ztypes_linux_mipsle.go | 2 + .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 2 + .../x/sys/unix/ztypes_linux_ppc64.go | 2 + .../x/sys/unix/ztypes_linux_ppc64le.go | 2 + .../x/sys/unix/ztypes_linux_riscv64.go | 25 + .../x/sys/unix/ztypes_linux_s390x.go | 2 + .../x/sys/unix/ztypes_linux_sparc64.go | 2 + vendor/golang.org/x/sys/windows/service.go | 4 + .../x/sys/windows/syscall_windows.go | 17 +- .../x/sys/windows/zsyscall_windows.go | 8 +- vendor/golang.org/x/term/term_unix.go | 2 +- .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/tables.go | 4686 +++++----- vendor/golang.org/x/text/language/match.go | 2 +- vendor/golang.org/x/text/language/tables.go | 138 +- .../x/text/unicode/bidi/tables13.0.0.go | 4 +- .../x/text/unicode/bidi/tables15.0.0.go | 2043 +++++ .../x/text/unicode/norm/tables13.0.0.go | 4 +- .../x/text/unicode/norm/tables15.0.0.go | 7908 +++++++++++++++++ .../apimachinery/pkg/runtime/converter.go | 4 +- .../k8s.io/apimachinery/pkg/util/wait/loop.go | 19 +- vendor/k8s.io/utils/pointer/pointer.go | 283 +- vendor/k8s.io/utils/ptr/OWNERS | 10 + vendor/k8s.io/utils/ptr/README.md | 3 + vendor/k8s.io/utils/ptr/ptr.go | 73 + vendor/modules.txt | 19 +- .../v4/merge/conflict.go | 2 +- .../structured-merge-diff/v4/merge/update.go | 51 +- .../v4/schema/elements.go | 3 +- .../v4/schema/schemaschema.go | 2 +- .../structured-merge-diff/v4/typed/merge.go | 11 +- .../structured-merge-diff/v4/typed/typed.go | 7 +- .../v4/typed/validate.go | 6 + .../v4/value/mapreflect.go | 2 +- .../v4/value/mapunstructured.go | 8 +- .../v4/value/reflectcache.go | 4 +- 159 files changed, 26016 insertions(+), 4546 deletions(-) create mode 100644 vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_apiserver-CustomNoUpgrade.crd.yaml create mode 100644 vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-CustomNoUpgrade.crd.yaml rename vendor/github.com/openshift/api/config/v1/{0000_10_config-operator_01_dns.crd.yaml => 0000_10_config-operator_01_dns-Default.crd.yaml} (68%) create mode 100644 vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-TechPreviewNoUpgrade.crd.yaml create mode 100644 vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml create mode 100644 vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml-patch create mode 100644 vendor/github.com/openshift/api/config/v1/custom.apiserver.testsuite.yaml create mode 100644 vendor/github.com/openshift/api/config/v1/custom.dns.testsuite.yaml create mode 100644 vendor/github.com/openshift/api/config/v1/custom.infrastructure.testsuite.yaml create mode 100644 vendor/github.com/openshift/api/config/v1/techpreview.dns.testsuite.yaml create mode 100644 vendor/github.com/openshift/api/config/v1alpha1/0000_10_config-operator_01_backup-TechPreviewNoUpgrade.crd.yaml create mode 100644 vendor/github.com/openshift/api/config/v1alpha1/techpreview.backup.testsuite.yaml create mode 100644 vendor/github.com/openshift/api/config/v1alpha1/types_backup.go create mode 100644 vendor/github.com/openshift/api/machine/v1/stable.controlplanemachineset.openstack.testsuite.yaml create mode 100644 vendor/golang.org/x/net/http2/writesched_roundrobin.go create mode 100644 vendor/golang.org/x/net/idna/tables15.0.0.go create mode 100644 vendor/golang.org/x/net/idna/trie12.0.0.go create mode 100644 vendor/golang.org/x/net/idna/trie13.0.0.go create mode 100644 vendor/golang.org/x/sys/unix/mmap_nomremap.go create mode 100644 vendor/golang.org/x/sys/unix/mremap.go create mode 100644 vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go create mode 100644 vendor/golang.org/x/text/unicode/norm/tables15.0.0.go create mode 100644 vendor/k8s.io/utils/ptr/OWNERS create mode 100644 vendor/k8s.io/utils/ptr/README.md create mode 100644 vendor/k8s.io/utils/ptr/ptr.go diff --git a/go.mod b/go.mod index b780e5718..599723d1b 100644 --- a/go.mod +++ b/go.mod @@ -7,15 +7,15 @@ require ( github.com/go-logr/logr v1.2.4 github.com/onsi/ginkgo/v2 v2.9.5 github.com/onsi/gomega v1.27.7 - github.com/openshift/api v0.0.0-20230524230522-75b5a44dbeeb + github.com/openshift/api v0.0.0-20230804173756-26b8597c4de2 github.com/openshift/machine-api-operator v0.2.1-0.20230524144558-2430daf07c93 golang.org/x/oauth2 v0.6.0 google.golang.org/api v0.107.0 - k8s.io/api v0.27.2 - k8s.io/apimachinery v0.27.2 + k8s.io/api v0.27.4 + k8s.io/apimachinery v0.27.4 k8s.io/client-go v0.27.2 k8s.io/klog/v2 v2.100.1 - k8s.io/utils v0.0.0-20230505201702-9f6742963106 + k8s.io/utils v0.0.0-20230726121419-3b25d923346b sigs.k8s.io/controller-runtime v0.15.0 sigs.k8s.io/controller-runtime/tools/setup-envtest v0.0.0-20230523032821-116a1b831fff sigs.k8s.io/controller-tools v0.12.0 @@ -92,10 +92,10 @@ require ( go.uber.org/multierr v1.8.0 // indirect go.uber.org/zap v1.24.0 // indirect golang.org/x/mod v0.10.0 // indirect - golang.org/x/net v0.10.0 // indirect - golang.org/x/sys v0.8.0 // indirect - golang.org/x/term v0.8.0 // indirect - golang.org/x/text v0.9.0 // indirect + golang.org/x/net v0.14.0 // indirect + golang.org/x/sys v0.11.0 // indirect + golang.org/x/term v0.11.0 // indirect + golang.org/x/text v0.12.0 // indirect golang.org/x/time v0.3.0 // indirect golang.org/x/tools v0.9.1 // indirect gomodules.xyz/jsonpatch/v2 v2.3.0 // indirect @@ -114,5 +114,5 @@ require ( sigs.k8s.io/json v0.0.0-20221116044647-bc3834ca7abd // indirect sigs.k8s.io/kustomize/api v0.13.2 // indirect sigs.k8s.io/kustomize/kyaml v0.14.1 // indirect - sigs.k8s.io/structured-merge-diff/v4 v4.2.3 // indirect + sigs.k8s.io/structured-merge-diff/v4 v4.3.0 // indirect ) diff --git a/go.sum b/go.sum index 2e7251053..46ac769e2 100644 --- a/go.sum +++ b/go.sum @@ -265,8 +265,8 @@ github.com/onsi/ginkgo/v2 v2.9.5 h1:+6Hr4uxzP4XIUyAkg61dWBw8lb/gc4/X5luuxN/EC+Q= github.com/onsi/ginkgo/v2 v2.9.5/go.mod h1:tvAoo1QUJwNEU2ITftXTpR7R1RbCzoZUOs3RonqW57k= github.com/onsi/gomega v1.27.7 h1:fVih9JD6ogIiHUN6ePK7HJidyEDpWGVB5mzM7cWNXoU= github.com/onsi/gomega v1.27.7/go.mod h1:1p8OOlwo2iUUDsHnOrjE5UKYJ+e3W8eQ3qSlRahPmr4= -github.com/openshift/api v0.0.0-20230524230522-75b5a44dbeeb h1:HsUNsqiMfpBdSYgtg0HwE8ZxaYcX2/TvcsNCN2vh42E= -github.com/openshift/api v0.0.0-20230524230522-75b5a44dbeeb/go.mod h1:4VWG+W22wrB4HfBL88P40DxLEpSOaiBVxUnfalfJo9k= +github.com/openshift/api v0.0.0-20230804173756-26b8597c4de2 h1:K7rBUJvIEa9Ei7tyAv4wDwDLpOFKa6nP84JnqxrY73o= +github.com/openshift/api v0.0.0-20230804173756-26b8597c4de2/go.mod h1:yimSGmjsI+XF1mr+AKBs2//fSXIOhhetHGbMlBEfXbs= github.com/openshift/client-go v0.0.0-20230503144108-75015d2347cb h1:Nij5OnaECrkmcRQMAE9LMbQXPo95aqFnf+12B7SyFVI= github.com/openshift/client-go v0.0.0-20230503144108-75015d2347cb/go.mod h1:Rhb3moCqeiTuGHAbXBOlwPubUMlOZEkrEWTRjIF3jzs= github.com/openshift/library-go v0.0.0-20230508110756-9b7abe2c9cbf h1:ZpFAN2qprgp7jEhGPrOAwP8mmuYC9BRYzvDefg+k4GM= @@ -292,7 +292,7 @@ github.com/prometheus/procfs v0.9.0 h1:wzCHvIvM5SxWqYvwgVL7yJY8Lz3PKn49KQtpgMYJf github.com/prometheus/procfs v0.9.0/go.mod h1:+pB4zwohETzFnmlpe6yd2lSc+0/46IYZRB/chUwxUZY= github.com/rogpeppe/fastuuid v1.2.0/go.mod h1:jVj6XXZzXRy/MSR5jhDC/2q6DgLz+nrA6LYCDYWNEvQ= github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= -github.com/rogpeppe/go-internal v1.10.0 h1:TMyTOH3F/DB16zRVcYyreMH6GnZZrwQVAoYjRBZyWFQ= +github.com/rogpeppe/go-internal v1.11.0 h1:cWPaGQEPrBb5/AsnsZesgZZ9yb1OQ+GOISoDNXVBh4M= github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf35Ld67mk= github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM= github.com/sergi/go-diff v1.1.0 h1:we8PVUC3FE2uYfodKH/nBHMSetSfHDR6scGdBi+erh0= @@ -425,8 +425,8 @@ golang.org/x/net v0.0.0-20201224014010-6772e930b67b/go.mod h1:m0MpNAwzfU5UDzcl9v golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg= golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96bSt6lcn1PtDYWL6XObtHCRCNQM= golang.org/x/net v0.0.0-20210805182204-aaa1db679c0d/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= -golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= -golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= +golang.org/x/net v0.14.0 h1:BONx9s002vGdD9umnlX1Po8vOZmrgH34qlHcD1MfK14= +golang.org/x/net v0.14.0/go.mod h1:PpSgVXXLK0OxS0F31C1/tv6XNguvCrnXIDrFMspZIUI= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -491,11 +491,11 @@ golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20210616094352-59db8d763f22/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.8.0 h1:EBmGv8NaZBZTWvrbjNoL6HVt+IVy3QDQpJs7VRIw3tU= -golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.11.0 h1:eG7RXZHdqOJ1i+0lgLgCpSXAp6M3LYlAo6osgSi0xOM= +golang.org/x/sys v0.11.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= -golang.org/x/term v0.8.0 h1:n5xxQn2i3PC0yLAbjTpNT85q/Kgzcr2gIoX9OrJUols= -golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= +golang.org/x/term v0.11.0 h1:F9tnn/DA/Im8nCwm+fX+1/eBwi4qFjRT++MhtVC4ZX0= +golang.org/x/term v0.11.0/go.mod h1:zC9APTIj3jG3FdV/Ons+XE1riIZXG4aZ4GTHiPZJPIU= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -504,8 +504,8 @@ golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.4/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.5/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.12.0 h1:k+n5B8goJNdU7hSvEtMUz3d1Q6D/XW4COJSJR6fN0mc= +golang.org/x/text v0.12.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -701,12 +701,12 @@ honnef.co/go/tools v0.0.0-20190523083050-ea95bdfd59fc/go.mod h1:rf3lG4BRIbNafJWh honnef.co/go/tools v0.0.1-2019.2.3/go.mod h1:a3bituU0lyd329TUQxRnasdCoJDkEUEAqEt0JzvZhAg= honnef.co/go/tools v0.0.1-2020.1.3/go.mod h1:X/FiERA/W4tHapMX5mGpAtMSVEeEUOyHaw9vFzvIQ3k= honnef.co/go/tools v0.0.1-2020.1.4/go.mod h1:X/FiERA/W4tHapMX5mGpAtMSVEeEUOyHaw9vFzvIQ3k= -k8s.io/api v0.27.2 h1:+H17AJpUMvl+clT+BPnKf0E3ksMAzoBBg7CntpSuADo= -k8s.io/api v0.27.2/go.mod h1:ENmbocXfBT2ADujUXcBhHV55RIT31IIEvkntP6vZKS4= +k8s.io/api v0.27.4 h1:0pCo/AN9hONazBKlNUdhQymmnfLRbSZjd5H5H3f0bSs= +k8s.io/api v0.27.4/go.mod h1:O3smaaX15NfxjzILfiln1D8Z3+gEYpjEpiNA/1EVK1Y= k8s.io/apiextensions-apiserver v0.27.2 h1:iwhyoeS4xj9Y7v8YExhUwbVuBhMr3Q4bd/laClBV6Bo= k8s.io/apiextensions-apiserver v0.27.2/go.mod h1:Oz9UdvGguL3ULgRdY9QMUzL2RZImotgxvGjdWRq6ZXQ= -k8s.io/apimachinery v0.27.2 h1:vBjGaKKieaIreI+oQwELalVG4d8f3YAMNpWLzDXkxeg= -k8s.io/apimachinery v0.27.2/go.mod h1:XNfZ6xklnMCOGGFNqXG7bUrQCoR04dh/E7FprV6pb+E= +k8s.io/apimachinery v0.27.4 h1:CdxflD4AF61yewuid0fLl6bM4a3q04jWel0IlP+aYjs= +k8s.io/apimachinery v0.27.4/go.mod h1:XNfZ6xklnMCOGGFNqXG7bUrQCoR04dh/E7FprV6pb+E= k8s.io/cli-runtime v0.27.1 h1:MMzp5Q/Xmr5L1Lrowuc+Y/r95XINC6c6/fE3aN7JDRM= k8s.io/cli-runtime v0.27.1/go.mod h1:tEbTB1XP/nTH3wujsi52bw91gWpErtWiS15R6CwYsAI= k8s.io/client-go v0.27.2 h1:vDLSeuYvCHKeoQRhCXjxXO45nHVv2Ip4Fe0MfioMrhE= @@ -719,8 +719,8 @@ k8s.io/kube-openapi v0.0.0-20230501164219-8b0f38b5fd1f h1:2kWPakN3i/k81b0gvD5C5F k8s.io/kube-openapi v0.0.0-20230501164219-8b0f38b5fd1f/go.mod h1:byini6yhqGC14c3ebc/QwanvYwhuMWF6yz2F8uwW8eg= k8s.io/kubectl v0.27.1 h1:9T5c5KdpburYiW8XKQSH0Uly1kMNE90aGSnbYUZNdcA= k8s.io/kubectl v0.27.1/go.mod h1:QsAkSmrRsKTPlAFzF8kODGDl4p35BIwQnc9XFhkcsy8= -k8s.io/utils v0.0.0-20230505201702-9f6742963106 h1:EObNQ3TW2D+WptiYXlApGNLVy0zm/JIBVY9i+M4wpAU= -k8s.io/utils v0.0.0-20230505201702-9f6742963106/go.mod h1:OLgZIPagt7ERELqWJFomSt595RzquPNLL48iOWgYOg0= +k8s.io/utils v0.0.0-20230726121419-3b25d923346b h1:sgn3ZU783SCgtaSJjpcVVlRqd6GSnlTLKgpAAttJvpI= +k8s.io/utils v0.0.0-20230726121419-3b25d923346b/go.mod h1:OLgZIPagt7ERELqWJFomSt595RzquPNLL48iOWgYOg0= rsc.io/binaryregexp v0.2.0/go.mod h1:qTv7/COck+e2FymRvadv62gMdZztPaShugOCi3I+8D8= rsc.io/quote/v3 v3.1.0/go.mod h1:yEA65RcK8LyAZtP9Kv3t0HmxON59tX3rD+tICJqUlj0= rsc.io/sampler v1.3.0/go.mod h1:T1hPZKmBbMNahiBKFy5HrXp6adAjACjK9JXDnKaTXpA= @@ -736,7 +736,7 @@ sigs.k8s.io/kustomize/api v0.13.2 h1:kejWfLeJhUsTGioDoFNJET5LQe/ajzXhJGYoU+pJsiA sigs.k8s.io/kustomize/api v0.13.2/go.mod h1:DUp325VVMFVcQSq+ZxyDisA8wtldwHxLZbr1g94UHsw= sigs.k8s.io/kustomize/kyaml v0.14.1 h1:c8iibius7l24G2wVAGZn/Va2wNys03GXLjYVIcFVxKA= sigs.k8s.io/kustomize/kyaml v0.14.1/go.mod h1:AN1/IpawKilWD7V+YvQwRGUvuUOOWpjsHu6uHwonSF4= -sigs.k8s.io/structured-merge-diff/v4 v4.2.3 h1:PRbqxJClWWYMNV1dhaG4NsibJbArud9kFxnAMREiWFE= -sigs.k8s.io/structured-merge-diff/v4 v4.2.3/go.mod h1:qjx8mGObPmV2aSZepjQjbmb2ihdVs8cGKBraizNC69E= +sigs.k8s.io/structured-merge-diff/v4 v4.3.0 h1:UZbZAZfX0wV2zr7YZorDz6GXROfDFj6LvqCRm4VUVKk= +sigs.k8s.io/structured-merge-diff/v4 v4.3.0/go.mod h1:N8hJocpFajUSSeSJ9bOZ77VzejKZaXsTtZo4/u7Io08= sigs.k8s.io/yaml v1.3.0 h1:a2VclLzOGrwOHDiV8EfBGhvjHvP46CtW5j6POvhYGGo= sigs.k8s.io/yaml v1.3.0/go.mod h1:GeOyir5tyXNByN85N/dRIT9es5UQNerPYEKK56eTBm8= diff --git a/vendor/github.com/openshift/api/config/v1/0000_00_cluster-version-operator_01_clusterversion.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_00_cluster-version-operator_01_clusterversion.crd.yaml index 0028eaa7b..69a2ed280 100644 --- a/vendor/github.com/openshift/api/config/v1/0000_00_cluster-version-operator_01_clusterversion.crd.yaml +++ b/vendor/github.com/openshift/api/config/v1/0000_00_cluster-version-operator_01_clusterversion.crd.yaml @@ -72,6 +72,8 @@ spec: - CSISnapshot - NodeTuning - MachineAPI + - Build + - DeploymentConfig x-kubernetes-list-type: atomic baselineCapabilitySet: description: baselineCapabilitySet selects an initial set of optional capabilities to enable, which can be extended via additionalEnabledCapabilities. If unset, the cluster will choose a default, and the default may change over time. The current default is vCurrent. @@ -195,6 +197,8 @@ spec: - CSISnapshot - NodeTuning - MachineAPI + - Build + - DeploymentConfig x-kubernetes-list-type: atomic knownCapabilities: description: knownCapabilities lists all the capabilities known to the current cluster. @@ -212,6 +216,8 @@ spec: - CSISnapshot - NodeTuning - MachineAPI + - Build + - DeploymentConfig x-kubernetes-list-type: atomic conditionalUpdates: description: conditionalUpdates contains the list of updates that may be recommended for this cluster if it meets specific required conditions. Consumers interested in the set of updates that are actually recommended for this cluster should use availableUpdates. This list may be empty if no updates are recommended, if the update service is unavailable, or if an empty or invalid channel has been specified. diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_apiserver-CustomNoUpgrade.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_apiserver-CustomNoUpgrade.crd.yaml new file mode 100644 index 000000000..1895f9d33 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_apiserver-CustomNoUpgrade.crd.yaml @@ -0,0 +1,179 @@ +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + api-approved.openshift.io: https://github.com/openshift/api/pull/470 + include.release.openshift.io/ibm-cloud-managed: "true" + include.release.openshift.io/self-managed-high-availability: "true" + include.release.openshift.io/single-node-developer: "true" + release.openshift.io/feature-set: CustomNoUpgrade + name: apiservers.config.openshift.io +spec: + group: config.openshift.io + names: + kind: APIServer + listKind: APIServerList + plural: apiservers + singular: apiserver + scope: Cluster + versions: + - name: v1 + schema: + openAPIV3Schema: + description: "APIServer holds configuration (like serving certificates, client CA and CORS domains) shared by all API servers in the system, among them especially kube-apiserver and openshift-apiserver. The canonical name of an instance is 'cluster'. \n Compatibility level 1: Stable within a major release for a minimum of 12 months or 3 minor releases (whichever is longer)." + type: object + required: + - spec + properties: + apiVersion: + description: 'APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources' + type: string + kind: + description: 'Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + description: spec holds user settable values for configuration + type: object + properties: + additionalCORSAllowedOrigins: + description: additionalCORSAllowedOrigins lists additional, user-defined regular expressions describing hosts for which the API server allows access using the CORS headers. This may be needed to access the API and the integrated OAuth server from JavaScript applications. The values are regular expressions that correspond to the Golang regular expression language. + type: array + items: + type: string + audit: + description: audit specifies the settings for audit configuration to be applied to all OpenShift-provided API servers in the cluster. + type: object + default: + profile: Default + properties: + customRules: + description: customRules specify profiles per group. These profile take precedence over the top-level profile field if they apply. They are evaluation from top to bottom and the first one that matches, applies. + type: array + items: + description: AuditCustomRule describes a custom rule for an audit profile that takes precedence over the top-level profile. + type: object + required: + - group + - profile + properties: + group: + description: group is a name of group a request user must be member of in order to this profile to apply. + type: string + minLength: 1 + profile: + description: "profile specifies the name of the desired audit policy configuration to be deployed to all OpenShift-provided API servers in the cluster. \n The following profiles are provided: - Default: the existing default policy. - WriteRequestBodies: like 'Default', but logs request and response HTTP payloads for write requests (create, update, patch). - AllRequestBodies: like 'WriteRequestBodies', but also logs request and response HTTP payloads for read requests (get, list). - None: no requests are logged at all, not even oauthaccesstokens and oauthauthorizetokens. \n If unset, the 'Default' profile is used as the default." + type: string + enum: + - Default + - WriteRequestBodies + - AllRequestBodies + - None + x-kubernetes-list-map-keys: + - group + x-kubernetes-list-type: map + profile: + description: "profile specifies the name of the desired top-level audit profile to be applied to all requests sent to any of the OpenShift-provided API servers in the cluster (kube-apiserver, openshift-apiserver and oauth-apiserver), with the exception of those requests that match one or more of the customRules. \n The following profiles are provided: - Default: default policy which means MetaData level logging with the exception of events (not logged at all), oauthaccesstokens and oauthauthorizetokens (both logged at RequestBody level). - WriteRequestBodies: like 'Default', but logs request and response HTTP payloads for write requests (create, update, patch). - AllRequestBodies: like 'WriteRequestBodies', but also logs request and response HTTP payloads for read requests (get, list). - None: no requests are logged at all, not even oauthaccesstokens and oauthauthorizetokens. \n Warning: It is not recommended to disable audit logging by using the `None` profile unless you are fully aware of the risks of not logging data that can be beneficial when troubleshooting issues. If you disable audit logging and a support situation arises, you might need to enable audit logging and reproduce the issue in order to troubleshoot properly. \n If unset, the 'Default' profile is used as the default." + type: string + default: Default + enum: + - Default + - WriteRequestBodies + - AllRequestBodies + - None + clientCA: + description: 'clientCA references a ConfigMap containing a certificate bundle for the signers that will be recognized for incoming client certificates in addition to the operator managed signers. If this is empty, then only operator managed signers are valid. You usually only have to set this if you have your own PKI you wish to honor client certificates from. The ConfigMap must exist in the openshift-config namespace and contain the following required fields: - ConfigMap.Data["ca-bundle.crt"] - CA bundle.' + type: object + required: + - name + properties: + name: + description: name is the metadata.name of the referenced config map + type: string + encryption: + description: encryption allows the configuration of encryption of resources at the datastore layer. + type: object + properties: + type: + description: "type defines what encryption type should be used to encrypt resources at the datastore layer. When this field is unset (i.e. when it is set to the empty string), identity is implied. The behavior of unset can and will change over time. Even if encryption is enabled by default, the meaning of unset may change to a different encryption type based on changes in best practices. \n When encryption is enabled, all sensitive resources shipped with the platform are encrypted. This list of sensitive resources can and will change over time. The current authoritative list is: \n 1. secrets 2. configmaps 3. routes.route.openshift.io 4. oauthaccesstokens.oauth.openshift.io 5. oauthauthorizetokens.oauth.openshift.io" + type: string + enum: + - "" + - identity + - aescbc + - aesgcm + servingCerts: + description: servingCert is the TLS cert info for serving secure traffic. If not specified, operator managed certificates will be used for serving secure traffic. + type: object + properties: + namedCertificates: + description: namedCertificates references secrets containing the TLS cert info for serving secure traffic to specific hostnames. If no named certificates are provided, or no named certificates match the server name as understood by a client, the defaultServingCertificate will be used. + type: array + items: + description: APIServerNamedServingCert maps a server DNS name, as understood by a client, to a certificate. + type: object + properties: + names: + description: names is a optional list of explicit DNS names (leading wildcards allowed) that should use this certificate to serve secure traffic. If no names are provided, the implicit names will be extracted from the certificates. Exact names trump over wildcard names. Explicit names defined here trump over extracted implicit names. + type: array + items: + type: string + servingCertificate: + description: 'servingCertificate references a kubernetes.io/tls type secret containing the TLS cert info for serving secure traffic. The secret must exist in the openshift-config namespace and contain the following required fields: - Secret.Data["tls.key"] - TLS private key. - Secret.Data["tls.crt"] - TLS certificate.' + type: object + required: + - name + properties: + name: + description: name is the metadata.name of the referenced secret + type: string + tlsSecurityProfile: + description: "tlsSecurityProfile specifies settings for TLS connections for externally exposed servers. \n If unset, a default (which may change between releases) is chosen. Note that only Old, Intermediate and Custom profiles are currently supported, and the maximum available MinTLSVersions is VersionTLS12." + type: object + properties: + custom: + description: "custom is a user-defined TLS security profile. Be extremely careful using a custom profile as invalid configurations can be catastrophic. An example custom profile looks like this: \n ciphers: - ECDHE-ECDSA-CHACHA20-POLY1305 - ECDHE-RSA-CHACHA20-POLY1305 - ECDHE-RSA-AES128-GCM-SHA256 - ECDHE-ECDSA-AES128-GCM-SHA256 minTLSVersion: TLSv1.1" + type: object + properties: + ciphers: + description: "ciphers is used to specify the cipher algorithms that are negotiated during the TLS handshake. Operators may remove entries their operands do not support. For example, to use DES-CBC3-SHA (yaml): \n ciphers: - DES-CBC3-SHA" + type: array + items: + type: string + minTLSVersion: + description: "minTLSVersion is used to specify the minimal version of the TLS protocol that is negotiated during the TLS handshake. For example, to use TLS versions 1.1, 1.2 and 1.3 (yaml): \n minTLSVersion: TLSv1.1 \n NOTE: currently the highest minTLSVersion allowed is VersionTLS12" + type: string + enum: + - VersionTLS10 + - VersionTLS11 + - VersionTLS12 + - VersionTLS13 + nullable: true + intermediate: + description: "intermediate is a TLS security profile based on: \n https://wiki.mozilla.org/Security/Server_Side_TLS#Intermediate_compatibility_.28recommended.29 \n and looks like this (yaml): \n ciphers: - TLS_AES_128_GCM_SHA256 - TLS_AES_256_GCM_SHA384 - TLS_CHACHA20_POLY1305_SHA256 - ECDHE-ECDSA-AES128-GCM-SHA256 - ECDHE-RSA-AES128-GCM-SHA256 - ECDHE-ECDSA-AES256-GCM-SHA384 - ECDHE-RSA-AES256-GCM-SHA384 - ECDHE-ECDSA-CHACHA20-POLY1305 - ECDHE-RSA-CHACHA20-POLY1305 - DHE-RSA-AES128-GCM-SHA256 - DHE-RSA-AES256-GCM-SHA384 minTLSVersion: TLSv1.2" + type: object + nullable: true + modern: + description: "modern is a TLS security profile based on: \n https://wiki.mozilla.org/Security/Server_Side_TLS#Modern_compatibility \n and looks like this (yaml): \n ciphers: - TLS_AES_128_GCM_SHA256 - TLS_AES_256_GCM_SHA384 - TLS_CHACHA20_POLY1305_SHA256 minTLSVersion: TLSv1.3 \n NOTE: Currently unsupported." + type: object + nullable: true + old: + description: "old is a TLS security profile based on: \n https://wiki.mozilla.org/Security/Server_Side_TLS#Old_backward_compatibility \n and looks like this (yaml): \n ciphers: - TLS_AES_128_GCM_SHA256 - TLS_AES_256_GCM_SHA384 - TLS_CHACHA20_POLY1305_SHA256 - ECDHE-ECDSA-AES128-GCM-SHA256 - ECDHE-RSA-AES128-GCM-SHA256 - ECDHE-ECDSA-AES256-GCM-SHA384 - ECDHE-RSA-AES256-GCM-SHA384 - ECDHE-ECDSA-CHACHA20-POLY1305 - ECDHE-RSA-CHACHA20-POLY1305 - DHE-RSA-AES128-GCM-SHA256 - DHE-RSA-AES256-GCM-SHA384 - DHE-RSA-CHACHA20-POLY1305 - ECDHE-ECDSA-AES128-SHA256 - ECDHE-RSA-AES128-SHA256 - ECDHE-ECDSA-AES128-SHA - ECDHE-RSA-AES128-SHA - ECDHE-ECDSA-AES256-SHA384 - ECDHE-RSA-AES256-SHA384 - ECDHE-ECDSA-AES256-SHA - ECDHE-RSA-AES256-SHA - DHE-RSA-AES128-SHA256 - DHE-RSA-AES256-SHA256 - AES128-GCM-SHA256 - AES256-GCM-SHA384 - AES128-SHA256 - AES256-SHA256 - AES128-SHA - AES256-SHA - DES-CBC3-SHA minTLSVersion: TLSv1.0" + type: object + nullable: true + type: + description: "type is one of Old, Intermediate, Modern or Custom. Custom provides the ability to specify individual TLS security profile parameters. Old, Intermediate and Modern are TLS security profiles based on: \n https://wiki.mozilla.org/Security/Server_Side_TLS#Recommended_configurations \n The profiles are intent based, so they may change over time as new ciphers are developed and existing ciphers are found to be insecure. Depending on precisely which ciphers are available to a process, the list may be reduced. \n Note that the Modern profile is currently not supported because it is not yet well adopted by common software libraries." + type: string + enum: + - Old + - Intermediate + - Modern + - Custom + status: + description: status holds observed values from the cluster. They may not be overridden. + type: object + served: true + storage: true + subresources: + status: {} diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-CustomNoUpgrade.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-CustomNoUpgrade.crd.yaml new file mode 100644 index 000000000..9da62cbfe --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-CustomNoUpgrade.crd.yaml @@ -0,0 +1,114 @@ +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + api-approved.openshift.io: https://github.com/openshift/api/pull/470 + include.release.openshift.io/ibm-cloud-managed: "true" + include.release.openshift.io/self-managed-high-availability: "true" + include.release.openshift.io/single-node-developer: "true" + release.openshift.io/feature-set: CustomNoUpgrade + name: dnses.config.openshift.io +spec: + group: config.openshift.io + names: + kind: DNS + listKind: DNSList + plural: dnses + singular: dns + scope: Cluster + versions: + - name: v1 + schema: + openAPIV3Schema: + description: "DNS holds cluster-wide information about DNS. The canonical name is `cluster` \n Compatibility level 1: Stable within a major release for a minimum of 12 months or 3 minor releases (whichever is longer)." + type: object + required: + - spec + properties: + apiVersion: + description: 'APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources' + type: string + kind: + description: 'Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + description: spec holds user settable values for configuration + type: object + properties: + baseDomain: + description: "baseDomain is the base domain of the cluster. All managed DNS records will be sub-domains of this base. \n For example, given the base domain `openshift.example.com`, an API server DNS record may be created for `cluster-api.openshift.example.com`. \n Once set, this field cannot be changed." + type: string + platform: + description: platform holds configuration specific to the underlying infrastructure provider for DNS. When omitted, this means the user has no opinion and the platform is left to choose reasonable defaults. These defaults are subject to change over time. + type: object + required: + - type + properties: + aws: + description: aws contains DNS configuration specific to the Amazon Web Services cloud provider. + type: object + properties: + privateZoneIAMRole: + description: privateZoneIAMRole contains the ARN of an IAM role that should be assumed when performing operations on the cluster's private hosted zone specified in the cluster DNS config. When left empty, no role should be assumed. + type: string + pattern: ^arn:(aws|aws-cn|aws-us-gov):iam::[0-9]{12}:role\/.*$ + type: + description: "type is the underlying infrastructure provider for the cluster. Allowed values: \"\", \"AWS\". \n Individual components may not support all platforms, and must handle unrecognized platforms with best-effort defaults." + type: string + enum: + - "" + - AWS + - Azure + - BareMetal + - GCP + - Libvirt + - OpenStack + - None + - VSphere + - oVirt + - IBMCloud + - KubeVirt + - EquinixMetal + - PowerVS + - AlibabaCloud + - Nutanix + - External + x-kubernetes-validations: + - rule: self in ['','AWS'] + message: allowed values are '' and 'AWS' + x-kubernetes-validations: + - rule: 'has(self.type) && self.type == ''AWS'' ? has(self.aws) : !has(self.aws)' + message: aws configuration is required when platform is AWS, and forbidden otherwise + privateZone: + description: "privateZone is the location where all the DNS records that are only available internally to the cluster exist. \n If this field is nil, no private records should be created. \n Once set, this field cannot be changed." + type: object + properties: + id: + description: "id is the identifier that can be used to find the DNS hosted zone. \n on AWS zone can be fetched using `ID` as id in [1] on Azure zone can be fetched using `ID` as a pre-determined name in [2], on GCP zone can be fetched using `ID` as a pre-determined name in [3]. \n [1]: https://docs.aws.amazon.com/cli/latest/reference/route53/get-hosted-zone.html#options [2]: https://docs.microsoft.com/en-us/cli/azure/network/dns/zone?view=azure-cli-latest#az-network-dns-zone-show [3]: https://cloud.google.com/dns/docs/reference/v1/managedZones/get" + type: string + tags: + description: "tags can be used to query the DNS hosted zone. \n on AWS, resourcegroupstaggingapi [1] can be used to fetch a zone using `Tags` as tag-filters, \n [1]: https://docs.aws.amazon.com/cli/latest/reference/resourcegroupstaggingapi/get-resources.html#options" + type: object + additionalProperties: + type: string + publicZone: + description: "publicZone is the location where all the DNS records that are publicly accessible to the internet exist. \n If this field is nil, no public records should be created. \n Once set, this field cannot be changed." + type: object + properties: + id: + description: "id is the identifier that can be used to find the DNS hosted zone. \n on AWS zone can be fetched using `ID` as id in [1] on Azure zone can be fetched using `ID` as a pre-determined name in [2], on GCP zone can be fetched using `ID` as a pre-determined name in [3]. \n [1]: https://docs.aws.amazon.com/cli/latest/reference/route53/get-hosted-zone.html#options [2]: https://docs.microsoft.com/en-us/cli/azure/network/dns/zone?view=azure-cli-latest#az-network-dns-zone-show [3]: https://cloud.google.com/dns/docs/reference/v1/managedZones/get" + type: string + tags: + description: "tags can be used to query the DNS hosted zone. \n on AWS, resourcegroupstaggingapi [1] can be used to fetch a zone using `Tags` as tag-filters, \n [1]: https://docs.aws.amazon.com/cli/latest/reference/resourcegroupstaggingapi/get-resources.html#options" + type: object + additionalProperties: + type: string + status: + description: status holds observed values from the cluster. They may not be overridden. + type: object + served: true + storage: true + subresources: + status: {} diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-Default.crd.yaml similarity index 68% rename from vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns.crd.yaml rename to vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-Default.crd.yaml index e4fa56eee..62080e10e 100644 --- a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns.crd.yaml +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-Default.crd.yaml @@ -6,6 +6,7 @@ metadata: include.release.openshift.io/ibm-cloud-managed: "true" include.release.openshift.io/self-managed-high-availability: "true" include.release.openshift.io/single-node-developer: "true" + release.openshift.io/feature-set: Default name: dnses.config.openshift.io spec: group: config.openshift.io @@ -39,6 +40,47 @@ spec: baseDomain: description: "baseDomain is the base domain of the cluster. All managed DNS records will be sub-domains of this base. \n For example, given the base domain `openshift.example.com`, an API server DNS record may be created for `cluster-api.openshift.example.com`. \n Once set, this field cannot be changed." type: string + platform: + description: platform holds configuration specific to the underlying infrastructure provider for DNS. When omitted, this means the user has no opinion and the platform is left to choose reasonable defaults. These defaults are subject to change over time. + type: object + required: + - type + properties: + aws: + description: aws contains DNS configuration specific to the Amazon Web Services cloud provider. + type: object + properties: + privateZoneIAMRole: + description: privateZoneIAMRole contains the ARN of an IAM role that should be assumed when performing operations on the cluster's private hosted zone specified in the cluster DNS config. When left empty, no role should be assumed. + type: string + pattern: ^arn:(aws|aws-cn|aws-us-gov):iam::[0-9]{12}:role\/.*$ + type: + description: "type is the underlying infrastructure provider for the cluster. Allowed values: \"\", \"AWS\". \n Individual components may not support all platforms, and must handle unrecognized platforms with best-effort defaults." + type: string + enum: + - "" + - AWS + - Azure + - BareMetal + - GCP + - Libvirt + - OpenStack + - None + - VSphere + - oVirt + - IBMCloud + - KubeVirt + - EquinixMetal + - PowerVS + - AlibabaCloud + - Nutanix + - External + x-kubernetes-validations: + - rule: self in ['','AWS'] + message: allowed values are '' and 'AWS' + x-kubernetes-validations: + - rule: 'has(self.type) && self.type == ''AWS'' ? has(self.aws) : !has(self.aws)' + message: aws configuration is required when platform is AWS, and forbidden otherwise privateZone: description: "privateZone is the location where all the DNS records that are only available internally to the cluster exist. \n If this field is nil, no private records should be created. \n Once set, this field cannot be changed." type: object diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-TechPreviewNoUpgrade.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-TechPreviewNoUpgrade.crd.yaml new file mode 100644 index 000000000..043b6fc60 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_dns-TechPreviewNoUpgrade.crd.yaml @@ -0,0 +1,114 @@ +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + api-approved.openshift.io: https://github.com/openshift/api/pull/470 + include.release.openshift.io/ibm-cloud-managed: "true" + include.release.openshift.io/self-managed-high-availability: "true" + include.release.openshift.io/single-node-developer: "true" + release.openshift.io/feature-set: TechPreviewNoUpgrade + name: dnses.config.openshift.io +spec: + group: config.openshift.io + names: + kind: DNS + listKind: DNSList + plural: dnses + singular: dns + scope: Cluster + versions: + - name: v1 + schema: + openAPIV3Schema: + description: "DNS holds cluster-wide information about DNS. The canonical name is `cluster` \n Compatibility level 1: Stable within a major release for a minimum of 12 months or 3 minor releases (whichever is longer)." + type: object + required: + - spec + properties: + apiVersion: + description: 'APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources' + type: string + kind: + description: 'Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + description: spec holds user settable values for configuration + type: object + properties: + baseDomain: + description: "baseDomain is the base domain of the cluster. All managed DNS records will be sub-domains of this base. \n For example, given the base domain `openshift.example.com`, an API server DNS record may be created for `cluster-api.openshift.example.com`. \n Once set, this field cannot be changed." + type: string + platform: + description: platform holds configuration specific to the underlying infrastructure provider for DNS. When omitted, this means the user has no opinion and the platform is left to choose reasonable defaults. These defaults are subject to change over time. + type: object + required: + - type + properties: + aws: + description: aws contains DNS configuration specific to the Amazon Web Services cloud provider. + type: object + properties: + privateZoneIAMRole: + description: privateZoneIAMRole contains the ARN of an IAM role that should be assumed when performing operations on the cluster's private hosted zone specified in the cluster DNS config. When left empty, no role should be assumed. + type: string + pattern: ^arn:(aws|aws-cn|aws-us-gov):iam::[0-9]{12}:role\/.*$ + type: + description: "type is the underlying infrastructure provider for the cluster. Allowed values: \"\", \"AWS\". \n Individual components may not support all platforms, and must handle unrecognized platforms with best-effort defaults." + type: string + enum: + - "" + - AWS + - Azure + - BareMetal + - GCP + - Libvirt + - OpenStack + - None + - VSphere + - oVirt + - IBMCloud + - KubeVirt + - EquinixMetal + - PowerVS + - AlibabaCloud + - Nutanix + - External + x-kubernetes-validations: + - rule: self in ['','AWS'] + message: allowed values are '' and 'AWS' + x-kubernetes-validations: + - rule: 'has(self.type) && self.type == ''AWS'' ? has(self.aws) : !has(self.aws)' + message: aws configuration is required when platform is AWS, and forbidden otherwise + privateZone: + description: "privateZone is the location where all the DNS records that are only available internally to the cluster exist. \n If this field is nil, no private records should be created. \n Once set, this field cannot be changed." + type: object + properties: + id: + description: "id is the identifier that can be used to find the DNS hosted zone. \n on AWS zone can be fetched using `ID` as id in [1] on Azure zone can be fetched using `ID` as a pre-determined name in [2], on GCP zone can be fetched using `ID` as a pre-determined name in [3]. \n [1]: https://docs.aws.amazon.com/cli/latest/reference/route53/get-hosted-zone.html#options [2]: https://docs.microsoft.com/en-us/cli/azure/network/dns/zone?view=azure-cli-latest#az-network-dns-zone-show [3]: https://cloud.google.com/dns/docs/reference/v1/managedZones/get" + type: string + tags: + description: "tags can be used to query the DNS hosted zone. \n on AWS, resourcegroupstaggingapi [1] can be used to fetch a zone using `Tags` as tag-filters, \n [1]: https://docs.aws.amazon.com/cli/latest/reference/resourcegroupstaggingapi/get-resources.html#options" + type: object + additionalProperties: + type: string + publicZone: + description: "publicZone is the location where all the DNS records that are publicly accessible to the internet exist. \n If this field is nil, no public records should be created. \n Once set, this field cannot be changed." + type: object + properties: + id: + description: "id is the identifier that can be used to find the DNS hosted zone. \n on AWS zone can be fetched using `ID` as id in [1] on Azure zone can be fetched using `ID` as a pre-determined name in [2], on GCP zone can be fetched using `ID` as a pre-determined name in [3]. \n [1]: https://docs.aws.amazon.com/cli/latest/reference/route53/get-hosted-zone.html#options [2]: https://docs.microsoft.com/en-us/cli/azure/network/dns/zone?view=azure-cli-latest#az-network-dns-zone-show [3]: https://cloud.google.com/dns/docs/reference/v1/managedZones/get" + type: string + tags: + description: "tags can be used to query the DNS hosted zone. \n on AWS, resourcegroupstaggingapi [1] can be used to fetch a zone using `Tags` as tag-filters, \n [1]: https://docs.aws.amazon.com/cli/latest/reference/resourcegroupstaggingapi/get-resources.html#options" + type: object + additionalProperties: + type: string + status: + description: status holds observed values from the cluster. They may not be overridden. + type: object + served: true + storage: true + subresources: + status: {} diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml new file mode 100644 index 000000000..4c6d4c074 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml @@ -0,0 +1,999 @@ +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + api-approved.openshift.io: https://github.com/openshift/api/pull/470 + include.release.openshift.io/ibm-cloud-managed: "true" + include.release.openshift.io/self-managed-high-availability: "true" + include.release.openshift.io/single-node-developer: "true" + release.openshift.io/feature-set: CustomNoUpgrade + name: infrastructures.config.openshift.io +spec: + group: config.openshift.io + names: + kind: Infrastructure + listKind: InfrastructureList + plural: infrastructures + singular: infrastructure + scope: Cluster + versions: + - name: v1 + schema: + openAPIV3Schema: + description: "Infrastructure holds cluster-wide information about Infrastructure. The canonical name is `cluster` \n Compatibility level 1: Stable within a major release for a minimum of 12 months or 3 minor releases (whichever is longer)." + properties: + apiVersion: + description: 'APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources' + type: string + kind: + description: 'Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + description: spec holds user settable values for configuration + properties: + cloudConfig: + description: "cloudConfig is a reference to a ConfigMap containing the cloud provider configuration file. This configuration file is used to configure the Kubernetes cloud provider integration when using the built-in cloud provider integration or the external cloud controller manager. The namespace for this config map is openshift-config. \n cloudConfig should only be consumed by the kube_cloud_config controller. The controller is responsible for using the user configuration in the spec for various platforms and combining that with the user provided ConfigMap in this field to create a stitched kube cloud config. The controller generates a ConfigMap `kube-cloud-config` in `openshift-config-managed` namespace with the kube cloud config is stored in `cloud.conf` key. All the clients are expected to use the generated ConfigMap only." + properties: + key: + description: Key allows pointing to a specific key/value inside of the configmap. This is useful for logical file references. + type: string + name: + type: string + type: object + platformSpec: + description: platformSpec holds desired information specific to the underlying infrastructure provider. + properties: + alibabaCloud: + description: AlibabaCloud contains settings specific to the Alibaba Cloud infrastructure provider. + type: object + aws: + description: AWS contains settings specific to the Amazon Web Services infrastructure provider. + properties: + serviceEndpoints: + description: serviceEndpoints list contains custom endpoints which will override default service endpoint of AWS Services. There must be only one ServiceEndpoint for a service. + items: + description: AWSServiceEndpoint store the configuration of a custom url to override existing defaults of AWS Services. + properties: + name: + description: name is the name of the AWS service. The list of all the service names can be found at https://docs.aws.amazon.com/general/latest/gr/aws-service-information.html This must be provided and cannot be empty. + pattern: ^[a-z0-9-]+$ + type: string + url: + description: url is fully qualified URI with scheme https, that overrides the default generated endpoint for a client. This must be provided and cannot be empty. + pattern: ^https:// + type: string + type: object + type: array + type: object + azure: + description: Azure contains settings specific to the Azure infrastructure provider. + type: object + baremetal: + description: BareMetal contains settings specific to the BareMetal platform. + type: object + equinixMetal: + description: EquinixMetal contains settings specific to the Equinix Metal infrastructure provider. + type: object + external: + description: ExternalPlatformType represents generic infrastructure provider. Platform-specific components should be supplemented separately. + properties: + platformName: + default: Unknown + description: PlatformName holds the arbitrary string representing the infrastructure provider name, expected to be set at the installation time. This field is solely for informational and reporting purposes and is not expected to be used for decision-making. + type: string + x-kubernetes-validations: + - message: platform name cannot be changed once set + rule: oldSelf == 'Unknown' || self == oldSelf + type: object + gcp: + description: GCP contains settings specific to the Google Cloud Platform infrastructure provider. + type: object + ibmcloud: + description: IBMCloud contains settings specific to the IBMCloud infrastructure provider. + type: object + kubevirt: + description: Kubevirt contains settings specific to the kubevirt infrastructure provider. + type: object + nutanix: + description: Nutanix contains settings specific to the Nutanix infrastructure provider. + properties: + prismCentral: + description: prismCentral holds the endpoint address and port to access the Nutanix Prism Central. When a cluster-wide proxy is installed, by default, this endpoint will be accessed via the proxy. Should you wish for communication with this endpoint not to be proxied, please add the endpoint to the proxy spec.noProxy list. + properties: + address: + description: address is the endpoint address (DNS name or IP address) of the Nutanix Prism Central or Element (cluster) + maxLength: 256 + type: string + port: + description: port is the port number to access the Nutanix Prism Central or Element (cluster) + format: int32 + maximum: 65535 + minimum: 1 + type: integer + required: + - address + - port + type: object + prismElements: + description: prismElements holds one or more endpoint address and port data to access the Nutanix Prism Elements (clusters) of the Nutanix Prism Central. Currently we only support one Prism Element (cluster) for an OpenShift cluster, where all the Nutanix resources (VMs, subnets, volumes, etc.) used in the OpenShift cluster are located. In the future, we may support Nutanix resources (VMs, etc.) spread over multiple Prism Elements (clusters) of the Prism Central. + items: + description: NutanixPrismElementEndpoint holds the name and endpoint data for a Prism Element (cluster) + properties: + endpoint: + description: endpoint holds the endpoint address and port data of the Prism Element (cluster). When a cluster-wide proxy is installed, by default, this endpoint will be accessed via the proxy. Should you wish for communication with this endpoint not to be proxied, please add the endpoint to the proxy spec.noProxy list. + properties: + address: + description: address is the endpoint address (DNS name or IP address) of the Nutanix Prism Central or Element (cluster) + maxLength: 256 + type: string + port: + description: port is the port number to access the Nutanix Prism Central or Element (cluster) + format: int32 + maximum: 65535 + minimum: 1 + type: integer + required: + - address + - port + type: object + name: + description: name is the name of the Prism Element (cluster). This value will correspond with the cluster field configured on other resources (eg Machines, PVCs, etc). + maxLength: 256 + type: string + required: + - endpoint + - name + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + required: + - prismCentral + - prismElements + type: object + openstack: + description: OpenStack contains settings specific to the OpenStack infrastructure provider. + type: object + ovirt: + description: Ovirt contains settings specific to the oVirt infrastructure provider. + type: object + powervs: + description: PowerVS contains settings specific to the IBM Power Systems Virtual Servers infrastructure provider. + properties: + serviceEndpoints: + description: serviceEndpoints is a list of custom endpoints which will override the default service endpoints of a Power VS service. + items: + description: PowervsServiceEndpoint stores the configuration of a custom url to override existing defaults of PowerVS Services. + properties: + name: + description: name is the name of the Power VS service. Few of the services are IAM - https://cloud.ibm.com/apidocs/iam-identity-token-api ResourceController - https://cloud.ibm.com/apidocs/resource-controller/resource-controller Power Cloud - https://cloud.ibm.com/apidocs/power-cloud + pattern: ^[a-z0-9-]+$ + type: string + url: + description: url is fully qualified URI with scheme https, that overrides the default generated endpoint for a client. This must be provided and cannot be empty. + format: uri + pattern: ^https:// + type: string + required: + - name + - url + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + type: object + type: + description: type is the underlying infrastructure provider for the cluster. This value controls whether infrastructure automation such as service load balancers, dynamic volume provisioning, machine creation and deletion, and other integrations are enabled. If None, no infrastructure automation is enabled. Allowed values are "AWS", "Azure", "BareMetal", "GCP", "Libvirt", "OpenStack", "VSphere", "oVirt", "KubeVirt", "EquinixMetal", "PowerVS", "AlibabaCloud", "Nutanix" and "None". Individual components may not support all platforms, and must handle unrecognized platforms as None if they do not support that platform. + enum: + - "" + - AWS + - Azure + - BareMetal + - GCP + - Libvirt + - OpenStack + - None + - VSphere + - oVirt + - IBMCloud + - KubeVirt + - EquinixMetal + - PowerVS + - AlibabaCloud + - Nutanix + - External + type: string + vsphere: + description: VSphere contains settings specific to the VSphere infrastructure provider. + properties: + failureDomains: + description: failureDomains contains the definition of region, zone and the vCenter topology. If this is omitted failure domains (regions and zones) will not be used. + items: + description: VSpherePlatformFailureDomainSpec holds the region and zone failure domain and the vCenter topology of that failure domain. + properties: + name: + description: name defines the arbitrary but unique name of a failure domain. + maxLength: 256 + minLength: 1 + type: string + region: + description: region defines the name of a region tag that will be attached to a vCenter datacenter. The tag category in vCenter must be named openshift-region. + maxLength: 80 + minLength: 1 + type: string + server: + anyOf: + - format: ipv4 + - format: ipv6 + - format: hostname + description: server is the fully-qualified domain name or the IP address of the vCenter server. --- + maxLength: 255 + minLength: 1 + type: string + topology: + description: Topology describes a given failure domain using vSphere constructs + properties: + computeCluster: + description: computeCluster the absolute path of the vCenter cluster in which virtual machine will be located. The absolute path is of the form //host/. The maximum length of the path is 2048 characters. + maxLength: 2048 + pattern: ^/.*?/host/.*? + type: string + datacenter: + description: datacenter is the name of vCenter datacenter in which virtual machines will be located. The maximum length of the datacenter name is 80 characters. + maxLength: 80 + type: string + datastore: + description: datastore is the absolute path of the datastore in which the virtual machine is located. The absolute path is of the form //datastore/ The maximum length of the path is 2048 characters. + maxLength: 2048 + pattern: ^/.*?/datastore/.*? + type: string + folder: + description: folder is the absolute path of the folder where virtual machines are located. The absolute path is of the form //vm/. The maximum length of the path is 2048 characters. + maxLength: 2048 + pattern: ^/.*?/vm/.*? + type: string + networks: + description: networks is the list of port group network names within this failure domain. Currently, we only support a single interface per RHCOS virtual machine. The available networks (port groups) can be listed using `govc ls 'network/*'` The single interface should be the absolute path of the form //network/. + items: + type: string + maxItems: 1 + minItems: 1 + type: array + resourcePool: + description: resourcePool is the absolute path of the resource pool where virtual machines will be created. The absolute path is of the form //host//Resources/. The maximum length of the path is 2048 characters. + maxLength: 2048 + pattern: ^/.*?/host/.*?/Resources.* + type: string + required: + - computeCluster + - datacenter + - datastore + - networks + type: object + zone: + description: zone defines the name of a zone tag that will be attached to a vCenter cluster. The tag category in vCenter must be named openshift-zone. + maxLength: 80 + minLength: 1 + type: string + required: + - name + - region + - server + - topology + - zone + type: object + type: array + nodeNetworking: + description: nodeNetworking contains the definition of internal and external network constraints for assigning the node's networking. If this field is omitted, networking defaults to the legacy address selection behavior which is to only support a single address and return the first one found. + properties: + external: + description: external represents the network configuration of the node that is externally routable. + properties: + excludeNetworkSubnetCidr: + description: excludeNetworkSubnetCidr IP addresses in subnet ranges will be excluded when selecting the IP address from the VirtualMachine's VM for use in the status.addresses fields. --- + items: + format: cidr + type: string + type: array + network: + description: network VirtualMachine's VM Network names that will be used to when searching for status.addresses fields. Note that if internal.networkSubnetCIDR and external.networkSubnetCIDR are not set, then the vNIC associated to this network must only have a single IP address assigned to it. The available networks (port groups) can be listed using `govc ls 'network/*'` + type: string + networkSubnetCidr: + description: networkSubnetCidr IP address on VirtualMachine's network interfaces included in the fields' CIDRs that will be used in respective status.addresses fields. --- + items: + format: cidr + type: string + type: array + type: object + internal: + description: internal represents the network configuration of the node that is routable only within the cluster. + properties: + excludeNetworkSubnetCidr: + description: excludeNetworkSubnetCidr IP addresses in subnet ranges will be excluded when selecting the IP address from the VirtualMachine's VM for use in the status.addresses fields. --- + items: + format: cidr + type: string + type: array + network: + description: network VirtualMachine's VM Network names that will be used to when searching for status.addresses fields. Note that if internal.networkSubnetCIDR and external.networkSubnetCIDR are not set, then the vNIC associated to this network must only have a single IP address assigned to it. The available networks (port groups) can be listed using `govc ls 'network/*'` + type: string + networkSubnetCidr: + description: networkSubnetCidr IP address on VirtualMachine's network interfaces included in the fields' CIDRs that will be used in respective status.addresses fields. --- + items: + format: cidr + type: string + type: array + type: object + type: object + vcenters: + description: vcenters holds the connection details for services to communicate with vCenter. Currently, only a single vCenter is supported. --- + items: + description: VSpherePlatformVCenterSpec stores the vCenter connection fields. This is used by the vSphere CCM. + properties: + datacenters: + description: The vCenter Datacenters in which the RHCOS vm guests are located. This field will be used by the Cloud Controller Manager. Each datacenter listed here should be used within a topology. + items: + type: string + minItems: 1 + type: array + port: + description: port is the TCP port that will be used to communicate to the vCenter endpoint. When omitted, this means the user has no opinion and it is up to the platform to choose a sensible default, which is subject to change over time. + format: int32 + maximum: 32767 + minimum: 1 + type: integer + server: + anyOf: + - format: ipv4 + - format: ipv6 + - format: hostname + description: server is the fully-qualified domain name or the IP address of the vCenter server. --- + maxLength: 255 + type: string + required: + - datacenters + - server + type: object + maxItems: 1 + minItems: 0 + type: array + type: object + type: object + type: object + status: + description: status holds observed values from the cluster. They may not be overridden. + properties: + apiServerInternalURI: + description: apiServerInternalURL is a valid URI with scheme 'https', address and optionally a port (defaulting to 443). apiServerInternalURL can be used by components like kubelets, to contact the Kubernetes API server using the infrastructure provider rather than Kubernetes networking. + type: string + apiServerURL: + description: apiServerURL is a valid URI with scheme 'https', address and optionally a port (defaulting to 443). apiServerURL can be used by components like the web console to tell users where to find the Kubernetes API. + type: string + controlPlaneTopology: + default: HighlyAvailable + description: controlPlaneTopology expresses the expectations for operands that normally run on control nodes. The default is 'HighlyAvailable', which represents the behavior operators have in a "normal" cluster. The 'SingleReplica' mode will be used in single-node deployments and the operators should not configure the operand for highly-available operation The 'External' mode indicates that the control plane is hosted externally to the cluster and that its components are not visible within the cluster. + enum: + - HighlyAvailable + - SingleReplica + - External + type: string + cpuPartitioning: + default: None + description: cpuPartitioning expresses if CPU partitioning is a currently enabled feature in the cluster. CPU Partitioning means that this cluster can support partitioning workloads to specific CPU Sets. Valid values are "None" and "AllNodes". When omitted, the default value is "None". The default value of "None" indicates that no nodes will be setup with CPU partitioning. The "AllNodes" value indicates that all nodes have been setup with CPU partitioning, and can then be further configured via the PerformanceProfile API. + enum: + - None + - AllNodes + type: string + etcdDiscoveryDomain: + description: 'etcdDiscoveryDomain is the domain used to fetch the SRV records for discovering etcd servers and clients. For more info: https://github.com/etcd-io/etcd/blob/329be66e8b3f9e2e6af83c123ff89297e49ebd15/Documentation/op-guide/clustering.md#dns-discovery deprecated: as of 4.7, this field is no longer set or honored. It will be removed in a future release.' + type: string + infrastructureName: + description: infrastructureName uniquely identifies a cluster with a human friendly name. Once set it should not be changed. Must be of max length 27 and must have only alphanumeric or hyphen characters. + type: string + infrastructureTopology: + default: HighlyAvailable + description: 'infrastructureTopology expresses the expectations for infrastructure services that do not run on control plane nodes, usually indicated by a node selector for a `role` value other than `master`. The default is ''HighlyAvailable'', which represents the behavior operators have in a "normal" cluster. The ''SingleReplica'' mode will be used in single-node deployments and the operators should not configure the operand for highly-available operation NOTE: External topology mode is not applicable for this field.' + enum: + - HighlyAvailable + - SingleReplica + type: string + platform: + description: "platform is the underlying infrastructure provider for the cluster. \n Deprecated: Use platformStatus.type instead." + enum: + - "" + - AWS + - Azure + - BareMetal + - GCP + - Libvirt + - OpenStack + - None + - VSphere + - oVirt + - IBMCloud + - KubeVirt + - EquinixMetal + - PowerVS + - AlibabaCloud + - Nutanix + - External + type: string + platformStatus: + description: platformStatus holds status information specific to the underlying infrastructure provider. + properties: + alibabaCloud: + description: AlibabaCloud contains settings specific to the Alibaba Cloud infrastructure provider. + properties: + region: + description: region specifies the region for Alibaba Cloud resources created for the cluster. + pattern: ^[0-9A-Za-z-]+$ + type: string + resourceGroupID: + description: resourceGroupID is the ID of the resource group for the cluster. + pattern: ^(rg-[0-9A-Za-z]+)?$ + type: string + resourceTags: + description: resourceTags is a list of additional tags to apply to Alibaba Cloud resources created for the cluster. + items: + description: AlibabaCloudResourceTag is the set of tags to add to apply to resources. + properties: + key: + description: key is the key of the tag. + maxLength: 128 + minLength: 1 + type: string + value: + description: value is the value of the tag. + maxLength: 128 + minLength: 1 + type: string + required: + - key + - value + type: object + maxItems: 20 + type: array + x-kubernetes-list-map-keys: + - key + x-kubernetes-list-type: map + required: + - region + type: object + aws: + description: AWS contains settings specific to the Amazon Web Services infrastructure provider. + properties: + region: + description: region holds the default AWS region for new AWS resources created by the cluster. + type: string + resourceTags: + description: resourceTags is a list of additional tags to apply to AWS resources created for the cluster. See https://docs.aws.amazon.com/general/latest/gr/aws_tagging.html for information on tagging AWS resources. AWS supports a maximum of 50 tags per resource. OpenShift reserves 25 tags for its use, leaving 25 tags available for the user. + items: + description: AWSResourceTag is a tag to apply to AWS resources created for the cluster. + properties: + key: + description: key is the key of the tag + maxLength: 128 + minLength: 1 + pattern: ^[0-9A-Za-z_.:/=+-@]+$ + type: string + value: + description: value is the value of the tag. Some AWS service do not support empty values. Since tags are added to resources in many services, the length of the tag value must meet the requirements of all services. + maxLength: 256 + minLength: 1 + pattern: ^[0-9A-Za-z_.:/=+-@]+$ + type: string + required: + - key + - value + type: object + maxItems: 25 + type: array + serviceEndpoints: + description: ServiceEndpoints list contains custom endpoints which will override default service endpoint of AWS Services. There must be only one ServiceEndpoint for a service. + items: + description: AWSServiceEndpoint store the configuration of a custom url to override existing defaults of AWS Services. + properties: + name: + description: name is the name of the AWS service. The list of all the service names can be found at https://docs.aws.amazon.com/general/latest/gr/aws-service-information.html This must be provided and cannot be empty. + pattern: ^[a-z0-9-]+$ + type: string + url: + description: url is fully qualified URI with scheme https, that overrides the default generated endpoint for a client. This must be provided and cannot be empty. + pattern: ^https:// + type: string + type: object + type: array + type: object + azure: + description: Azure contains settings specific to the Azure infrastructure provider. + properties: + armEndpoint: + description: armEndpoint specifies a URL to use for resource management in non-soverign clouds such as Azure Stack. + type: string + cloudName: + description: cloudName is the name of the Azure cloud environment which can be used to configure the Azure SDK with the appropriate Azure API endpoints. If empty, the value is equal to `AzurePublicCloud`. + enum: + - "" + - AzurePublicCloud + - AzureUSGovernmentCloud + - AzureChinaCloud + - AzureGermanCloud + - AzureStackCloud + type: string + networkResourceGroupName: + description: networkResourceGroupName is the Resource Group for network resources like the Virtual Network and Subnets used by the cluster. If empty, the value is same as ResourceGroupName. + type: string + resourceGroupName: + description: resourceGroupName is the Resource Group for new Azure resources created for the cluster. + type: string + resourceTags: + description: resourceTags is a list of additional tags to apply to Azure resources created for the cluster. See https://docs.microsoft.com/en-us/rest/api/resources/tags for information on tagging Azure resources. Due to limitations on Automation, Content Delivery Network, DNS Azure resources, a maximum of 15 tags may be applied. OpenShift reserves 5 tags for internal use, allowing 10 tags for user configuration. + items: + description: AzureResourceTag is a tag to apply to Azure resources created for the cluster. + properties: + key: + description: key is the key part of the tag. A tag key can have a maximum of 128 characters and cannot be empty. Key must begin with a letter, end with a letter, number or underscore, and must contain only alphanumeric characters and the following special characters `_ . -`. + maxLength: 128 + minLength: 1 + pattern: ^[a-zA-Z]([0-9A-Za-z_.-]*[0-9A-Za-z_])?$ + type: string + value: + description: 'value is the value part of the tag. A tag value can have a maximum of 256 characters and cannot be empty. Value must contain only alphanumeric characters and the following special characters `_ + , - . / : ; < = > ? @`.' + maxLength: 256 + minLength: 1 + pattern: ^[0-9A-Za-z_.=+-@]+$ + type: string + required: + - key + - value + type: object + maxItems: 10 + type: array + x-kubernetes-validations: + - message: resourceTags are immutable and may only be configured during installation + rule: self.all(x, x in oldSelf) && oldSelf.all(x, x in self) + type: object + x-kubernetes-validations: + - message: resourceTags may only be configured during installation + rule: '!has(oldSelf.resourceTags) && !has(self.resourceTags) || has(oldSelf.resourceTags) && has(self.resourceTags)' + baremetal: + description: BareMetal contains settings specific to the BareMetal platform. + properties: + apiServerInternalIP: + description: "apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. \n Deprecated: Use APIServerInternalIPs instead." + type: string + apiServerInternalIPs: + description: apiServerInternalIPs are the IP addresses to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. These are the IPs for a self-hosted load balancer in front of the API servers. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + ingressIP: + description: "ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. \n Deprecated: Use IngressIPs instead." + type: string + ingressIPs: + description: ingressIPs are the external IPs which route to the default ingress controller. The IPs are suitable targets of a wildcard DNS record used to resolve default route host names. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + loadBalancer: + default: + type: OpenShiftManagedDefault + description: loadBalancer defines how the load balancer used by the cluster is configured. + properties: + type: + default: OpenShiftManagedDefault + description: type defines the type of load balancer used by the cluster on BareMetal platform which can be a user-managed or openshift-managed load balancer that is to be used for the OpenShift API and Ingress endpoints. When set to OpenShiftManagedDefault the static pods in charge of API and Ingress traffic load-balancing defined in the machine config operator will be deployed. When set to UserManaged these static pods will not be deployed and it is expected that the load balancer is configured out of band by the deployer. When omitted, this means no opinion and the platform is left to choose a reasonable default. The default value is OpenShiftManagedDefault. + enum: + - OpenShiftManagedDefault + - UserManaged + type: string + x-kubernetes-validations: + - message: type is immutable once set + rule: oldSelf == '' || self == oldSelf + type: object + nodeDNSIP: + description: nodeDNSIP is the IP address for the internal DNS used by the nodes. Unlike the one managed by the DNS operator, `NodeDNSIP` provides name resolution for the nodes themselves. There is no DNS-as-a-service for BareMetal deployments. In order to minimize necessary changes to the datacenter DNS, a DNS service is hosted as a static pod to serve those hostnames to the nodes in the cluster. + type: string + type: object + equinixMetal: + description: EquinixMetal contains settings specific to the Equinix Metal infrastructure provider. + properties: + apiServerInternalIP: + description: apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. + type: string + ingressIP: + description: ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. + type: string + type: object + external: + description: External contains settings specific to the generic External infrastructure provider. + properties: + cloudControllerManager: + description: cloudControllerManager contains settings specific to the external Cloud Controller Manager (a.k.a. CCM or CPI). When omitted, new nodes will be not tainted and no extra initialization from the cloud controller manager is expected. + properties: + state: + description: "state determines whether or not an external Cloud Controller Manager is expected to be installed within the cluster. https://kubernetes.io/docs/tasks/administer-cluster/running-cloud-controller/#running-cloud-controller-manager \n Valid values are \"External\", \"None\" and omitted. When set to \"External\", new nodes will be tainted as uninitialized when created, preventing them from running workloads until they are initialized by the cloud controller manager. When omitted or set to \"None\", new nodes will be not tainted and no extra initialization from the cloud controller manager is expected." + enum: + - "" + - External + - None + type: string + x-kubernetes-validations: + - message: state is immutable once set + rule: self == oldSelf + type: object + x-kubernetes-validations: + - message: state may not be added or removed once set + rule: (has(self.state) == has(oldSelf.state)) || (!has(oldSelf.state) && self.state != "External") + type: object + x-kubernetes-validations: + - message: cloudControllerManager may not be added or removed once set + rule: has(self.cloudControllerManager) == has(oldSelf.cloudControllerManager) + gcp: + description: GCP contains settings specific to the Google Cloud Platform infrastructure provider. + properties: + projectID: + description: resourceGroupName is the Project ID for new GCP resources created for the cluster. + type: string + region: + description: region holds the region for new GCP resources created for the cluster. + type: string + resourceLabels: + description: resourceLabels is a list of additional labels to apply to GCP resources created for the cluster. See https://cloud.google.com/compute/docs/labeling-resources for information on labeling GCP resources. GCP supports a maximum of 64 labels per resource. OpenShift reserves 32 labels for internal use, allowing 32 labels for user configuration. + items: + description: GCPResourceLabel is a label to apply to GCP resources created for the cluster. + properties: + key: + description: key is the key part of the label. A label key can have a maximum of 63 characters and cannot be empty. Label key must begin with a lowercase letter, and must contain only lowercase letters, numeric characters, and the following special characters `_-`. Label key must not have the reserved prefixes `kubernetes-io` and `openshift-io`. + maxLength: 63 + minLength: 1 + pattern: ^[a-z][0-9a-z_-]+$ + type: string + x-kubernetes-validations: + - message: label keys must not start with either `openshift-io` or `kubernetes-io` + rule: '!self.startsWith(''openshift-io'') && !self.startsWith(''kubernetes-io'')' + value: + description: value is the value part of the label. A label value can have a maximum of 63 characters and cannot be empty. Value must contain only lowercase letters, numeric characters, and the following special characters `_-`. + maxLength: 63 + minLength: 1 + pattern: ^[0-9a-z_-]+$ + type: string + required: + - key + - value + type: object + maxItems: 32 + type: array + x-kubernetes-list-map-keys: + - key + x-kubernetes-list-type: map + x-kubernetes-validations: + - message: resourceLabels are immutable and may only be configured during installation + rule: self.all(x, x in oldSelf) && oldSelf.all(x, x in self) + resourceTags: + description: resourceTags is a list of additional tags to apply to GCP resources created for the cluster. See https://cloud.google.com/resource-manager/docs/tags/tags-overview for information on tagging GCP resources. GCP supports a maximum of 50 tags per resource. + items: + description: GCPResourceTag is a tag to apply to GCP resources created for the cluster. + properties: + key: + description: key is the key part of the tag. A tag key can have a maximum of 63 characters and cannot be empty. Tag key must begin and end with an alphanumeric character, and must contain only uppercase, lowercase alphanumeric characters, and the following special characters `._-`. + maxLength: 63 + minLength: 1 + pattern: ^[a-zA-Z0-9]([0-9A-Za-z_.-]{0,61}[a-zA-Z0-9])?$ + type: string + parentID: + description: 'parentID is the ID of the hierarchical resource where the tags are defined, e.g. at the Organization or the Project level. To find the Organization or Project ID refer to the following pages: https://cloud.google.com/resource-manager/docs/creating-managing-organization#retrieving_your_organization_id, https://cloud.google.com/resource-manager/docs/creating-managing-projects#identifying_projects. An OrganizationID must consist of decimal numbers, and cannot have leading zeroes. A ProjectID must be 6 to 30 characters in length, can only contain lowercase letters, numbers, and hyphens, and must start with a letter, and cannot end with a hyphen.' + maxLength: 32 + minLength: 1 + pattern: (^[1-9][0-9]{0,31}$)|(^[a-z][a-z0-9-]{4,28}[a-z0-9]$) + type: string + value: + description: value is the value part of the tag. A tag value can have a maximum of 63 characters and cannot be empty. Tag value must begin and end with an alphanumeric character, and must contain only uppercase, lowercase alphanumeric characters, and the following special characters `_-.@%=+:,*#&(){}[]` and spaces. + maxLength: 63 + minLength: 1 + pattern: ^[a-zA-Z0-9]([0-9A-Za-z_.@%=+:,*#&()\[\]{}\-\s]{0,61}[a-zA-Z0-9])?$ + type: string + required: + - key + - parentID + - value + type: object + maxItems: 50 + type: array + x-kubernetes-list-map-keys: + - key + x-kubernetes-list-type: map + x-kubernetes-validations: + - message: resourceTags are immutable and may only be configured during installation + rule: self.all(x, x in oldSelf) && oldSelf.all(x, x in self) + type: object + x-kubernetes-validations: + - message: resourceLabels may only be configured during installation + rule: '!has(oldSelf.resourceLabels) && !has(self.resourceLabels) || has(oldSelf.resourceLabels) && has(self.resourceLabels)' + - message: resourceTags may only be configured during installation + rule: '!has(oldSelf.resourceTags) && !has(self.resourceTags) || has(oldSelf.resourceTags) && has(self.resourceTags)' + ibmcloud: + description: IBMCloud contains settings specific to the IBMCloud infrastructure provider. + properties: + cisInstanceCRN: + description: CISInstanceCRN is the CRN of the Cloud Internet Services instance managing the DNS zone for the cluster's base domain + type: string + dnsInstanceCRN: + description: DNSInstanceCRN is the CRN of the DNS Services instance managing the DNS zone for the cluster's base domain + type: string + location: + description: Location is where the cluster has been deployed + type: string + providerType: + description: ProviderType indicates the type of cluster that was created + type: string + resourceGroupName: + description: ResourceGroupName is the Resource Group for new IBMCloud resources created for the cluster. + type: string + type: object + kubevirt: + description: Kubevirt contains settings specific to the kubevirt infrastructure provider. + properties: + apiServerInternalIP: + description: apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. + type: string + ingressIP: + description: ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. + type: string + type: object + nutanix: + description: Nutanix contains settings specific to the Nutanix infrastructure provider. + properties: + apiServerInternalIP: + description: "apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. \n Deprecated: Use APIServerInternalIPs instead." + type: string + apiServerInternalIPs: + description: apiServerInternalIPs are the IP addresses to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. These are the IPs for a self-hosted load balancer in front of the API servers. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + ingressIP: + description: "ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. \n Deprecated: Use IngressIPs instead." + type: string + ingressIPs: + description: ingressIPs are the external IPs which route to the default ingress controller. The IPs are suitable targets of a wildcard DNS record used to resolve default route host names. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + loadBalancer: + default: + type: OpenShiftManagedDefault + description: loadBalancer defines how the load balancer used by the cluster is configured. + properties: + type: + default: OpenShiftManagedDefault + description: type defines the type of load balancer used by the cluster on Nutanix platform which can be a user-managed or openshift-managed load balancer that is to be used for the OpenShift API and Ingress endpoints. When set to OpenShiftManagedDefault the static pods in charge of API and Ingress traffic load-balancing defined in the machine config operator will be deployed. When set to UserManaged these static pods will not be deployed and it is expected that the load balancer is configured out of band by the deployer. When omitted, this means no opinion and the platform is left to choose a reasonable default. The default value is OpenShiftManagedDefault. + enum: + - OpenShiftManagedDefault + - UserManaged + type: string + x-kubernetes-validations: + - message: type is immutable once set + rule: oldSelf == '' || self == oldSelf + type: object + type: object + openstack: + description: OpenStack contains settings specific to the OpenStack infrastructure provider. + properties: + apiServerInternalIP: + description: "apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. \n Deprecated: Use APIServerInternalIPs instead." + type: string + apiServerInternalIPs: + description: apiServerInternalIPs are the IP addresses to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. These are the IPs for a self-hosted load balancer in front of the API servers. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + cloudName: + description: cloudName is the name of the desired OpenStack cloud in the client configuration file (`clouds.yaml`). + type: string + ingressIP: + description: "ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. \n Deprecated: Use IngressIPs instead." + type: string + ingressIPs: + description: ingressIPs are the external IPs which route to the default ingress controller. The IPs are suitable targets of a wildcard DNS record used to resolve default route host names. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + loadBalancer: + default: + type: OpenShiftManagedDefault + description: loadBalancer defines how the load balancer used by the cluster is configured. + properties: + type: + default: OpenShiftManagedDefault + description: type defines the type of load balancer used by the cluster on OpenStack platform which can be a user-managed or openshift-managed load balancer that is to be used for the OpenShift API and Ingress endpoints. When set to OpenShiftManagedDefault the static pods in charge of API and Ingress traffic load-balancing defined in the machine config operator will be deployed. When set to UserManaged these static pods will not be deployed and it is expected that the load balancer is configured out of band by the deployer. When omitted, this means no opinion and the platform is left to choose a reasonable default. The default value is OpenShiftManagedDefault. + enum: + - OpenShiftManagedDefault + - UserManaged + type: string + x-kubernetes-validations: + - message: type is immutable once set + rule: oldSelf == '' || self == oldSelf + type: object + nodeDNSIP: + description: nodeDNSIP is the IP address for the internal DNS used by the nodes. Unlike the one managed by the DNS operator, `NodeDNSIP` provides name resolution for the nodes themselves. There is no DNS-as-a-service for OpenStack deployments. In order to minimize necessary changes to the datacenter DNS, a DNS service is hosted as a static pod to serve those hostnames to the nodes in the cluster. + type: string + type: object + ovirt: + description: Ovirt contains settings specific to the oVirt infrastructure provider. + properties: + apiServerInternalIP: + description: "apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. \n Deprecated: Use APIServerInternalIPs instead." + type: string + apiServerInternalIPs: + description: apiServerInternalIPs are the IP addresses to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. These are the IPs for a self-hosted load balancer in front of the API servers. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + ingressIP: + description: "ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. \n Deprecated: Use IngressIPs instead." + type: string + ingressIPs: + description: ingressIPs are the external IPs which route to the default ingress controller. The IPs are suitable targets of a wildcard DNS record used to resolve default route host names. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + loadBalancer: + default: + type: OpenShiftManagedDefault + description: loadBalancer defines how the load balancer used by the cluster is configured. + properties: + type: + default: OpenShiftManagedDefault + description: type defines the type of load balancer used by the cluster on Ovirt platform which can be a user-managed or openshift-managed load balancer that is to be used for the OpenShift API and Ingress endpoints. When set to OpenShiftManagedDefault the static pods in charge of API and Ingress traffic load-balancing defined in the machine config operator will be deployed. When set to UserManaged these static pods will not be deployed and it is expected that the load balancer is configured out of band by the deployer. When omitted, this means no opinion and the platform is left to choose a reasonable default. The default value is OpenShiftManagedDefault. + enum: + - OpenShiftManagedDefault + - UserManaged + type: string + x-kubernetes-validations: + - message: type is immutable once set + rule: oldSelf == '' || self == oldSelf + type: object + nodeDNSIP: + description: 'deprecated: as of 4.6, this field is no longer set or honored. It will be removed in a future release.' + type: string + type: object + powervs: + description: PowerVS contains settings specific to the Power Systems Virtual Servers infrastructure provider. + properties: + cisInstanceCRN: + description: CISInstanceCRN is the CRN of the Cloud Internet Services instance managing the DNS zone for the cluster's base domain + type: string + dnsInstanceCRN: + description: DNSInstanceCRN is the CRN of the DNS Services instance managing the DNS zone for the cluster's base domain + type: string + region: + description: region holds the default Power VS region for new Power VS resources created by the cluster. + type: string + resourceGroup: + description: 'resourceGroup is the resource group name for new IBMCloud resources created for a cluster. The resource group specified here will be used by cluster-image-registry-operator to set up a COS Instance in IBMCloud for the cluster registry. More about resource groups can be found here: https://cloud.ibm.com/docs/account?topic=account-rgs. When omitted, the image registry operator won''t be able to configure storage, which results in the image registry cluster operator not being in an available state.' + maxLength: 40 + pattern: ^[a-zA-Z0-9-_ ]+$ + type: string + x-kubernetes-validations: + - message: resourceGroup is immutable once set + rule: oldSelf == '' || self == oldSelf + serviceEndpoints: + description: serviceEndpoints is a list of custom endpoints which will override the default service endpoints of a Power VS service. + items: + description: PowervsServiceEndpoint stores the configuration of a custom url to override existing defaults of PowerVS Services. + properties: + name: + description: name is the name of the Power VS service. Few of the services are IAM - https://cloud.ibm.com/apidocs/iam-identity-token-api ResourceController - https://cloud.ibm.com/apidocs/resource-controller/resource-controller Power Cloud - https://cloud.ibm.com/apidocs/power-cloud + pattern: ^[a-z0-9-]+$ + type: string + url: + description: url is fully qualified URI with scheme https, that overrides the default generated endpoint for a client. This must be provided and cannot be empty. + format: uri + pattern: ^https:// + type: string + required: + - name + - url + type: object + type: array + zone: + description: 'zone holds the default zone for the new Power VS resources created by the cluster. Note: Currently only single-zone OCP clusters are supported' + type: string + type: object + x-kubernetes-validations: + - message: cannot unset resourceGroup once set + rule: '!has(oldSelf.resourceGroup) || has(self.resourceGroup)' + type: + description: "type is the underlying infrastructure provider for the cluster. This value controls whether infrastructure automation such as service load balancers, dynamic volume provisioning, machine creation and deletion, and other integrations are enabled. If None, no infrastructure automation is enabled. Allowed values are \"AWS\", \"Azure\", \"BareMetal\", \"GCP\", \"Libvirt\", \"OpenStack\", \"VSphere\", \"oVirt\", \"EquinixMetal\", \"PowerVS\", \"AlibabaCloud\", \"Nutanix\" and \"None\". Individual components may not support all platforms, and must handle unrecognized platforms as None if they do not support that platform. \n This value will be synced with to the `status.platform` and `status.platformStatus.type`. Currently this value cannot be changed once set." + enum: + - "" + - AWS + - Azure + - BareMetal + - GCP + - Libvirt + - OpenStack + - None + - VSphere + - oVirt + - IBMCloud + - KubeVirt + - EquinixMetal + - PowerVS + - AlibabaCloud + - Nutanix + - External + type: string + vsphere: + description: VSphere contains settings specific to the VSphere infrastructure provider. + properties: + apiServerInternalIP: + description: "apiServerInternalIP is an IP address to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. It is the IP that the Infrastructure.status.apiServerInternalURI points to. It is the IP for a self-hosted load balancer in front of the API servers. \n Deprecated: Use APIServerInternalIPs instead." + type: string + apiServerInternalIPs: + description: apiServerInternalIPs are the IP addresses to contact the Kubernetes API server that can be used by components inside the cluster, like kubelets using the infrastructure rather than Kubernetes networking. These are the IPs for a self-hosted load balancer in front of the API servers. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + ingressIP: + description: "ingressIP is an external IP which routes to the default ingress controller. The IP is a suitable target of a wildcard DNS record used to resolve default route host names. \n Deprecated: Use IngressIPs instead." + type: string + ingressIPs: + description: ingressIPs are the external IPs which route to the default ingress controller. The IPs are suitable targets of a wildcard DNS record used to resolve default route host names. In dual stack clusters this list contains two IPs otherwise only one. + format: ip + items: + type: string + maxItems: 2 + type: array + loadBalancer: + default: + type: OpenShiftManagedDefault + description: loadBalancer defines how the load balancer used by the cluster is configured. + properties: + type: + default: OpenShiftManagedDefault + description: type defines the type of load balancer used by the cluster on VSphere platform which can be a user-managed or openshift-managed load balancer that is to be used for the OpenShift API and Ingress endpoints. When set to OpenShiftManagedDefault the static pods in charge of API and Ingress traffic load-balancing defined in the machine config operator will be deployed. When set to UserManaged these static pods will not be deployed and it is expected that the load balancer is configured out of band by the deployer. When omitted, this means no opinion and the platform is left to choose a reasonable default. The default value is OpenShiftManagedDefault. + enum: + - OpenShiftManagedDefault + - UserManaged + type: string + x-kubernetes-validations: + - message: type is immutable once set + rule: oldSelf == '' || self == oldSelf + type: object + nodeDNSIP: + description: nodeDNSIP is the IP address for the internal DNS used by the nodes. Unlike the one managed by the DNS operator, `NodeDNSIP` provides name resolution for the nodes themselves. There is no DNS-as-a-service for vSphere deployments. In order to minimize necessary changes to the datacenter DNS, a DNS service is hosted as a static pod to serve those hostnames to the nodes in the cluster. + type: string + type: object + type: object + type: object + required: + - spec + type: object + served: true + storage: true + subresources: + status: {} diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml-patch b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml-patch new file mode 100644 index 000000000..d127130ad --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml-patch @@ -0,0 +1,24 @@ +- op: add + path: /spec/versions/name=v1/schema/openAPIV3Schema/properties/spec/properties/platformSpec/properties/vsphere/properties/vcenters/items/properties/server/anyOf + value: + - format: ipv4 + - format: ipv6 + - format: hostname +- op: add + path: /spec/versions/name=v1/schema/openAPIV3Schema/properties/spec/properties/platformSpec/properties/vsphere/properties/failureDomains/items/properties/server/anyOf + value: + - format: ipv4 + - format: ipv6 + - format: hostname +- op: add + path: /spec/versions/name=v1/schema/openAPIV3Schema/properties/spec/properties/platformSpec/properties/vsphere/properties/nodeNetworking/properties/external/properties/excludeNetworkSubnetCidr/items/format + value: cidr +- op: add + path: /spec/versions/name=v1/schema/openAPIV3Schema/properties/spec/properties/platformSpec/properties/vsphere/properties/nodeNetworking/properties/external/properties/networkSubnetCidr/items/format + value: cidr +- op: add + path: /spec/versions/name=v1/schema/openAPIV3Schema/properties/spec/properties/platformSpec/properties/vsphere/properties/nodeNetworking/properties/internal/properties/excludeNetworkSubnetCidr/items/format + value: cidr +- op: add + path: /spec/versions/name=v1/schema/openAPIV3Schema/properties/spec/properties/platformSpec/properties/vsphere/properties/nodeNetworking/properties/internal/properties/networkSubnetCidr/items/format + value: cidr diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-Default.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-Default.crd.yaml index bb8817110..64a54d5c5 100644 --- a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-Default.crd.yaml +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-Default.crd.yaml @@ -592,7 +592,28 @@ spec: type: object external: description: External contains settings specific to the generic External infrastructure provider. + properties: + cloudControllerManager: + description: cloudControllerManager contains settings specific to the external Cloud Controller Manager (a.k.a. CCM or CPI). When omitted, new nodes will be not tainted and no extra initialization from the cloud controller manager is expected. + properties: + state: + description: "state determines whether or not an external Cloud Controller Manager is expected to be installed within the cluster. https://kubernetes.io/docs/tasks/administer-cluster/running-cloud-controller/#running-cloud-controller-manager \n Valid values are \"External\", \"None\" and omitted. When set to \"External\", new nodes will be tainted as uninitialized when created, preventing them from running workloads until they are initialized by the cloud controller manager. When omitted or set to \"None\", new nodes will be not tainted and no extra initialization from the cloud controller manager is expected." + enum: + - "" + - External + - None + type: string + x-kubernetes-validations: + - message: state is immutable once set + rule: self == oldSelf + type: object + x-kubernetes-validations: + - message: state may not be added or removed once set + rule: (has(self.state) == has(oldSelf.state)) || (!has(oldSelf.state) && self.state != "External") type: object + x-kubernetes-validations: + - message: cloudControllerManager may not be added or removed once set + rule: has(self.cloudControllerManager) == has(oldSelf.cloudControllerManager) gcp: description: GCP contains settings specific to the Google Cloud Platform infrastructure provider. properties: diff --git a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-TechPreviewNoUpgrade.crd.yaml b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-TechPreviewNoUpgrade.crd.yaml index 495e4a558..0698bc680 100644 --- a/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-TechPreviewNoUpgrade.crd.yaml +++ b/vendor/github.com/openshift/api/config/v1/0000_10_config-operator_01_infrastructure-TechPreviewNoUpgrade.crd.yaml @@ -615,7 +615,28 @@ spec: type: object external: description: External contains settings specific to the generic External infrastructure provider. + properties: + cloudControllerManager: + description: cloudControllerManager contains settings specific to the external Cloud Controller Manager (a.k.a. CCM or CPI). When omitted, new nodes will be not tainted and no extra initialization from the cloud controller manager is expected. + properties: + state: + description: "state determines whether or not an external Cloud Controller Manager is expected to be installed within the cluster. https://kubernetes.io/docs/tasks/administer-cluster/running-cloud-controller/#running-cloud-controller-manager \n Valid values are \"External\", \"None\" and omitted. When set to \"External\", new nodes will be tainted as uninitialized when created, preventing them from running workloads until they are initialized by the cloud controller manager. When omitted or set to \"None\", new nodes will be not tainted and no extra initialization from the cloud controller manager is expected." + enum: + - "" + - External + - None + type: string + x-kubernetes-validations: + - message: state is immutable once set + rule: self == oldSelf + type: object + x-kubernetes-validations: + - message: state may not be added or removed once set + rule: (has(self.state) == has(oldSelf.state)) || (!has(oldSelf.state) && self.state != "External") type: object + x-kubernetes-validations: + - message: cloudControllerManager may not be added or removed once set + rule: has(self.cloudControllerManager) == has(oldSelf.cloudControllerManager) gcp: description: GCP contains settings specific to the Google Cloud Platform infrastructure provider. properties: @@ -625,7 +646,80 @@ spec: region: description: region holds the region for new GCP resources created for the cluster. type: string + resourceLabels: + description: resourceLabels is a list of additional labels to apply to GCP resources created for the cluster. See https://cloud.google.com/compute/docs/labeling-resources for information on labeling GCP resources. GCP supports a maximum of 64 labels per resource. OpenShift reserves 32 labels for internal use, allowing 32 labels for user configuration. + items: + description: GCPResourceLabel is a label to apply to GCP resources created for the cluster. + properties: + key: + description: key is the key part of the label. A label key can have a maximum of 63 characters and cannot be empty. Label key must begin with a lowercase letter, and must contain only lowercase letters, numeric characters, and the following special characters `_-`. Label key must not have the reserved prefixes `kubernetes-io` and `openshift-io`. + maxLength: 63 + minLength: 1 + pattern: ^[a-z][0-9a-z_-]+$ + type: string + x-kubernetes-validations: + - message: label keys must not start with either `openshift-io` or `kubernetes-io` + rule: '!self.startsWith(''openshift-io'') && !self.startsWith(''kubernetes-io'')' + value: + description: value is the value part of the label. A label value can have a maximum of 63 characters and cannot be empty. Value must contain only lowercase letters, numeric characters, and the following special characters `_-`. + maxLength: 63 + minLength: 1 + pattern: ^[0-9a-z_-]+$ + type: string + required: + - key + - value + type: object + maxItems: 32 + type: array + x-kubernetes-list-map-keys: + - key + x-kubernetes-list-type: map + x-kubernetes-validations: + - message: resourceLabels are immutable and may only be configured during installation + rule: self.all(x, x in oldSelf) && oldSelf.all(x, x in self) + resourceTags: + description: resourceTags is a list of additional tags to apply to GCP resources created for the cluster. See https://cloud.google.com/resource-manager/docs/tags/tags-overview for information on tagging GCP resources. GCP supports a maximum of 50 tags per resource. + items: + description: GCPResourceTag is a tag to apply to GCP resources created for the cluster. + properties: + key: + description: key is the key part of the tag. A tag key can have a maximum of 63 characters and cannot be empty. Tag key must begin and end with an alphanumeric character, and must contain only uppercase, lowercase alphanumeric characters, and the following special characters `._-`. + maxLength: 63 + minLength: 1 + pattern: ^[a-zA-Z0-9]([0-9A-Za-z_.-]{0,61}[a-zA-Z0-9])?$ + type: string + parentID: + description: 'parentID is the ID of the hierarchical resource where the tags are defined, e.g. at the Organization or the Project level. To find the Organization or Project ID refer to the following pages: https://cloud.google.com/resource-manager/docs/creating-managing-organization#retrieving_your_organization_id, https://cloud.google.com/resource-manager/docs/creating-managing-projects#identifying_projects. An OrganizationID must consist of decimal numbers, and cannot have leading zeroes. A ProjectID must be 6 to 30 characters in length, can only contain lowercase letters, numbers, and hyphens, and must start with a letter, and cannot end with a hyphen.' + maxLength: 32 + minLength: 1 + pattern: (^[1-9][0-9]{0,31}$)|(^[a-z][a-z0-9-]{4,28}[a-z0-9]$) + type: string + value: + description: value is the value part of the tag. A tag value can have a maximum of 63 characters and cannot be empty. Tag value must begin and end with an alphanumeric character, and must contain only uppercase, lowercase alphanumeric characters, and the following special characters `_-.@%=+:,*#&(){}[]` and spaces. + maxLength: 63 + minLength: 1 + pattern: ^[a-zA-Z0-9]([0-9A-Za-z_.@%=+:,*#&()\[\]{}\-\s]{0,61}[a-zA-Z0-9])?$ + type: string + required: + - key + - parentID + - value + type: object + maxItems: 50 + type: array + x-kubernetes-list-map-keys: + - key + x-kubernetes-list-type: map + x-kubernetes-validations: + - message: resourceTags are immutable and may only be configured during installation + rule: self.all(x, x in oldSelf) && oldSelf.all(x, x in self) type: object + x-kubernetes-validations: + - message: resourceLabels may only be configured during installation + rule: '!has(oldSelf.resourceLabels) && !has(self.resourceLabels) || has(oldSelf.resourceLabels) && has(self.resourceLabels)' + - message: resourceTags may only be configured during installation + rule: '!has(oldSelf.resourceTags) && !has(self.resourceTags) || has(oldSelf.resourceTags) && has(self.resourceTags)' ibmcloud: description: IBMCloud contains settings specific to the IBMCloud infrastructure provider. properties: diff --git a/vendor/github.com/openshift/api/config/v1/custom.apiserver.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/custom.apiserver.testsuite.yaml new file mode 100644 index 000000000..5e2dea3ea --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/custom.apiserver.testsuite.yaml @@ -0,0 +1,35 @@ +apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this +name: "[CustomNoUpgrade] APIServer" +crd: 0000_10_config-operator_01_apiserver-CustomNoUpgrade.crd.yaml +tests: + onCreate: + - name: Should be able to create encrypt with aescbc + initial: | + apiVersion: config.openshift.io/v1 + kind: APIServer + spec: + encryption: + type: aescbc + expected: | + apiVersion: config.openshift.io/v1 + kind: APIServer + spec: + audit: + profile: Default + encryption: + type: aescbc + - name: Should be able to create encrypt with aesgcm + initial: | + apiVersion: config.openshift.io/v1 + kind: APIServer + spec: + encryption: + type: aesgcm + expected: | + apiVersion: config.openshift.io/v1 + kind: APIServer + spec: + audit: + profile: Default + encryption: + type: aesgcm diff --git a/vendor/github.com/openshift/api/config/v1/custom.dns.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/custom.dns.testsuite.yaml new file mode 100644 index 000000000..ab1a123b6 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/custom.dns.testsuite.yaml @@ -0,0 +1,104 @@ +apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this +name: "[Custom] DNS" +crd: 0000_10_config-operator_01_dns-CustomNoUpgrade.crd.yaml +tests: + onCreate: + - name: Should be able to create a minimal DNS + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: {} # No spec is required for a DNS + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: {} + - name: Should be able to specify an AWS role ARN for a private hosted zone + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + - name: Should not be able to specify unsupported platform + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: Azure + azure: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expectedError: "Invalid value: \"string\": allowed values are '' and 'AWS'" + - name: Should not be able to specify invalid AWS role ARN + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + metadata: + name: cluster + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam:bad:123456789012:role/foo + expectedError: "DNS.config.openshift.io \"cluster\" is invalid: spec.platform.aws.privateZoneIAMRole: Invalid value: \"arn:aws:iam:bad:123456789012:role/foo\": spec.platform.aws.privateZoneIAMRole in body should match '^arn:(aws|aws-cn|aws-us-gov):iam::[0-9]{12}:role\\/.*$'" + - name: Should not be able to specify different type and platform + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expectedError: "Invalid value: \"object\": aws configuration is required when platform is AWS, and forbidden otherwise" + onUpdate: + - name: Can switch from empty (default), to AWS + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + updated: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + - name: Upgrade case is valid + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: {} # No spec is required for a DNS + updated: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" diff --git a/vendor/github.com/openshift/api/config/v1/custom.infrastructure.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/custom.infrastructure.testsuite.yaml new file mode 100644 index 000000000..24433f4f7 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/custom.infrastructure.testsuite.yaml @@ -0,0 +1,321 @@ +apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this +name: "[Custom] Infrastructure" +crd: 0000_10_config-operator_01_infrastructure-CustomNoUpgrade.crd.yaml +tests: + onCreate: + - name: Should be able to create a minimal Infrastructure + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} # No spec is required for a Infrastructure + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + onUpdate: + - name: Should not be able to modify an existing GCP ResourceLabels Label + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "changed"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels: Invalid value: \"array\": resourceLabels are immutable and may only be configured during installation" + - name: Should not be able to add a Label to an existing GCP ResourceLabels + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "new", value: "entry"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels: Invalid value: \"array\": resourceLabels are immutable and may only be configured during installation" + - name: Should not be able to remove a Label from an existing GCP ResourceLabels + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "new", value: "entry"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels: Invalid value: \"array\": resourceLabels are immutable and may only be configured during installation" + - name: Should not be able to add GCP ResourceLabels to an empty platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + gcp: + resourceLabels: + - {key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceLabels may only be configured during installation" + - name: Should not be able to remove GCP ResourceLabels from platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceLabels may only be configured during installation" + - name: Should not have label key start with openshift-io for GCP ResourceLabels in platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "openshift-io-created-cluster", value: "true"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels[1].key: Invalid value: \"string\": label keys must not start with either `openshift-io` or `kubernetes-io`" + - name: Should not have label key start with kubernetes-io for GCP ResourceLabels in platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "kubernetes-io-created-cluster", value: "true"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels[1].key: Invalid value: \"string\": label keys must not start with either `openshift-io` or `kubernetes-io`" + - name: Should not be able to modify an existing GCP ResourceTags Tag + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "changed"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" + - name: Should not be able to add a Tag to an existing GCP ResourceTags + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + - {parentID: "test-project-123", key: "new", value: "tag"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" + - name: Should not be able to remove a Tag from an existing GCP ResourceTags + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key1", value: "value1"} + - {parentID: "test-project-123", key: "key2", value: "value2"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key1", value: "value1"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" + - name: Should not be able to add GCP ResourceTags to an empty platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceTags may only be configured during installation" + - name: Should not be able to remove GCP ResourceTags from platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceTags may only be configured during installation" + - name: Should not be able to modify ParentID of a Tag in the GCP ResourceTags + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "test-project-123", key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" diff --git a/vendor/github.com/openshift/api/config/v1/feature_gates.go b/vendor/github.com/openshift/api/config/v1/feature_gates.go index 8d48cd868..364b1df93 100644 --- a/vendor/github.com/openshift/api/config/v1/feature_gates.go +++ b/vendor/github.com/openshift/api/config/v1/feature_gates.go @@ -83,6 +83,16 @@ var ( OwningProduct: ocpSpecific, } + FeatureGateExternalCloudProviderExternal = FeatureGateName("ExternalCloudProviderExternal") + externalCloudProviderExternal = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateExternalCloudProviderExternal, + }, + OwningJiraComponent: "cloud-provider", + ResponsiblePerson: "elmiko", + OwningProduct: ocpSpecific, + } + FeatureGateCSIDriverSharedResource = FeatureGateName("CSIDriverSharedResource") csiDriverSharedResource = FeatureGateDescription{ FeatureGateAttributes: FeatureGateAttributes{ @@ -133,16 +143,6 @@ var ( OwningProduct: ocpSpecific, } - FeatureGateMatchLabelKeysInPodTopologySpread = FeatureGateName("MatchLabelKeysInPodTopologySpread") - matchLabelKeysInPodTopologySpread = FeatureGateDescription{ - FeatureGateAttributes: FeatureGateAttributes{ - Name: FeatureGateMatchLabelKeysInPodTopologySpread, - }, - OwningJiraComponent: "scheduling", - ResponsiblePerson: "ingvagabund", - OwningProduct: kubernetes, - } - FeatureGatePDBUnhealthyPodEvictionPolicy = FeatureGateName("PDBUnhealthyPodEvictionPolicy") pdbUnhealthyPodEvictionPolicy = FeatureGateDescription{ FeatureGateAttributes: FeatureGateAttributes{ @@ -193,6 +193,16 @@ var ( OwningProduct: kubernetes, } + FeatureGateEventedPLEG = FeatureGateName("EventedPLEG") + eventedPleg = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateEventedPLEG, + }, + OwningJiraComponent: "node", + ResponsiblePerson: "sairameshv", + OwningProduct: kubernetes, + } + FeatureGatePrivateHostedZoneAWS = FeatureGateName("PrivateHostedZoneAWS") privateHostedZoneAWS = FeatureGateDescription{ FeatureGateAttributes: FeatureGateAttributes{ @@ -202,4 +212,93 @@ var ( ResponsiblePerson: "miciah", OwningProduct: ocpSpecific, } + + FeatureGateSigstoreImageVerification = FeatureGateName("SigstoreImageVerification") + sigstoreImageVerification = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateSigstoreImageVerification, + }, + OwningJiraComponent: "node", + ResponsiblePerson: "sgrunert", + OwningProduct: ocpSpecific, + } + + FeatureGateGCPLabelsTags = FeatureGateName("GCPLabelsTags") + gcpLabelsTags = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateGCPLabelsTags, + }, + OwningJiraComponent: "Installer", + ResponsiblePerson: "bhb", + OwningProduct: ocpSpecific, + } + + FeatureGateAlibabaPlatform = FeatureGateName("AlibabaPlatform") + alibabaPlatform = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateAlibabaPlatform, + }, + OwningJiraComponent: "cloud-provider", + ResponsiblePerson: "jspeed", + OwningProduct: ocpSpecific, + } + + FeatureGateCloudDualStackNodeIPs = FeatureGateName("CloudDualStackNodeIPs") + cloudDualStackNodeIPs = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateCloudDualStackNodeIPs, + }, + OwningJiraComponent: "machine-config-operator/platform-baremetal", + ResponsiblePerson: "mkowalsk", + OwningProduct: kubernetes, + } + FeatureGateVSphereStaticIPs = FeatureGateName("VSphereStaticIPs") + vSphereStaticIPs = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateVSphereStaticIPs, + }, + OwningJiraComponent: "splat", + ResponsiblePerson: "rvanderp3", + OwningProduct: ocpSpecific, + } + + FeatureGateRouteExternalCertificate = FeatureGateName("RouteExternalCertificate") + routeExternalCertificate = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateRouteExternalCertificate, + }, + OwningJiraComponent: "router", + ResponsiblePerson: "thejasn", + OwningProduct: ocpSpecific, + } + + FeatureGateAdminNetworkPolicy = FeatureGateName("AdminNetworkPolicy") + adminNetworkPolicy = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateAdminNetworkPolicy, + }, + OwningJiraComponent: "Networking/ovn-kubernetes", + ResponsiblePerson: "tssurya", + OwningProduct: ocpSpecific, + } + + FeatureGateAutomatedEtcdBackup = FeatureGateName("AutomatedEtcdBackup") + automatedEtcdBackup = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateAutomatedEtcdBackup, + }, + OwningJiraComponent: "etcd", + ResponsiblePerson: "hasbro17", + OwningProduct: ocpSpecific, + } + + FeatureGateMachineAPIOperatorDisableMachineHealthCheckController = FeatureGateName("MachineAPIOperatorDisableMachineHealthCheckController") + machineAPIOperatorDisableMachineHealthCheckController = FeatureGateDescription{ + FeatureGateAttributes: FeatureGateAttributes{ + Name: FeatureGateMachineAPIOperatorDisableMachineHealthCheckController, + }, + OwningJiraComponent: "ecoproject", + ResponsiblePerson: "msluiter", + OwningProduct: ocpSpecific, + } ) diff --git a/vendor/github.com/openshift/api/config/v1/stable.dns.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/stable.dns.testsuite.yaml index c69f50050..3054d200e 100644 --- a/vendor/github.com/openshift/api/config/v1/stable.dns.testsuite.yaml +++ b/vendor/github.com/openshift/api/config/v1/stable.dns.testsuite.yaml @@ -1,6 +1,6 @@ apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this name: "[Stable] DNS" -crd: 0000_10_config-operator_01_dns.crd.yaml +crd: 0000_10_config-operator_01_dns-Default.crd.yaml tests: onCreate: - name: Should be able to create a minimal DNS @@ -12,3 +12,94 @@ tests: apiVersion: config.openshift.io/v1 kind: DNS spec: {} + - name: Should be able to specify an AWS role ARN for a private hosted zone + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + - name: Should not be able to specify unsupported platform + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: Azure + azure: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expectedError: "Invalid value: \"string\": allowed values are '' and 'AWS'" + - name: Should not be able to specify invalid AWS role ARN + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + metadata: + name: cluster + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam:bad:123456789012:role/foo + expectedError: "DNS.config.openshift.io \"cluster\" is invalid: spec.platform.aws.privateZoneIAMRole: Invalid value: \"arn:aws:iam:bad:123456789012:role/foo\": spec.platform.aws.privateZoneIAMRole in body should match '^arn:(aws|aws-cn|aws-us-gov):iam::[0-9]{12}:role\\/.*$'" + - name: Should not be able to specify different type and platform + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expectedError: "Invalid value: \"object\": aws configuration is required when platform is AWS, and forbidden otherwise" + onUpdate: + - name: Can switch from empty (default), to AWS + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + updated: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: AWS + aws: + privateZoneIAMRole: arn:aws:iam::123456789012:role/foo + - name: Upgrade case is valid + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: {} # No spec is required for a DNS + updated: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: + platform: + type: "" + diff --git a/vendor/github.com/openshift/api/config/v1/stable.infrastructure.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/stable.infrastructure.testsuite.yaml index 4266122b0..63da9aa41 100644 --- a/vendor/github.com/openshift/api/config/v1/stable.infrastructure.testsuite.yaml +++ b/vendor/github.com/openshift/api/config/v1/stable.infrastructure.testsuite.yaml @@ -474,3 +474,492 @@ tests: type: FooBar type: OpenStack expectedStatusError: "status.platformStatus.openstack.loadBalancer.type: Unsupported value: \"FooBar\": supported values: \"OpenShiftManagedDefault\", \"UserManaged\"" + - name: Should not be able to update cloudControllerManager state to empty string when state is already set to None + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platformStatus: + external: + cloudControllerManager: + state: "" + expectedStatusError: " status.platformStatus.external.cloudControllerManager.state: Invalid value: \"string\": state is immutable once set" + - name: Should not be able to update cloudControllerManager state to External when state is already set to None + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + expectedStatusError: " status.platformStatus.external.cloudControllerManager.state: Invalid value: \"string\": state is immutable once set" + - name: Should be able to update cloudControllerManager state to None when state is already set to None + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: HighlyAvailable + infrastructureTopology: HighlyAvailable + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + - name: Should not be able to unset cloudControllerManager state when state is already set to None + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + expectedStatusError: " status.platformStatus.external.cloudControllerManager: Invalid value: \"object\": state may not be added or removed once set" + - name: Should not be able to update cloudControllerManager state to empty string when state is already set to External + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + expectedStatusError: " status.platformStatus.external.cloudControllerManager.state: Invalid value: \"string\": state is immutable once set" + - name: Should not be able to update cloudControllerManager state to None when state is already set to External + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + expectedStatusError: " status.platformStatus.external.cloudControllerManager.state: Invalid value: \"string\": state is immutable once set" + - name: Should be able to update cloudControllerManager state to External when state is already set to External + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: HighlyAvailable + infrastructureTopology: HighlyAvailable + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + - name: Should not be able to unset cloudControllerManager state when state is already set to External + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + expectedStatusError: " status.platformStatus.external.cloudControllerManager: Invalid value: \"object\": state may not be added or removed once set" + - name: Should not be able to update cloudControllerManager state to None when state is already set to empty string + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + expectedStatusError: " status.platformStatus.external.cloudControllerManager.state: Invalid value: \"string\": state is immutable once set" + - name: Should not be able to update cloudControllerManager state to External when state is already set to empty string + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + expectedStatusError: " status.platformStatus.external.cloudControllerManager.state: Invalid value: \"string\": state is immutable once set" + - name: Should be able to update cloudControllerManager state to empty string when state is already set to empty string + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: HighlyAvailable + infrastructureTopology: HighlyAvailable + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + - name: Should not be able to unset cloudControllerManager state when state is already set to empty string + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + expectedStatusError: " status.platformStatus.external.cloudControllerManager: Invalid value: \"object\": state may not be added or removed once set" + - name: Should be able to update cloudControllerManager state to None when cloudControllerManager state is unset + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: HighlyAvailable + infrastructureTopology: HighlyAvailable + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: None + - name: Should be able to update cloudControllerManager state to empty string when cloudControllerManager state is unset + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: HighlyAvailable + infrastructureTopology: HighlyAvailable + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: "" + - name: Should not be able to update cloudControllerManager state to External when cloudControllerManager state is unset + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + expectedStatusError: " status.platformStatus.external.cloudControllerManager: Invalid value: \"object\": state may not be added or removed once set" + - name: Should be able to unset cloudControllerManager state when cloudControllerManager state is unset + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + expected: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: HighlyAvailable + infrastructureTopology: HighlyAvailable + platform: External + platformStatus: + type: External + external: + cloudControllerManager: {} + - name: Should not be able to add cloudControllerManager when cloudControllerManager is unset + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + expectedStatusError: " status.platformStatus.external: Invalid value: \"object\": cloudControllerManager may not be added or removed once set" + - name: Should not be able to remove cloudControllerManager when cloudControllerManager is set + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: + cloudControllerManager: + state: External + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: External + platformStatus: + type: External + external: {} + expectedStatusError: " status.platformStatus.external: Invalid value: \"object\": cloudControllerManager may not be added or removed once set" diff --git a/vendor/github.com/openshift/api/config/v1/techpreview.dns.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/techpreview.dns.testsuite.yaml new file mode 100644 index 000000000..ec64352e3 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1/techpreview.dns.testsuite.yaml @@ -0,0 +1,14 @@ +apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this +name: "[TechPreview] DNS" +crd: 0000_10_config-operator_01_dns-TechPreviewNoUpgrade.crd.yaml +tests: + onCreate: + - name: Should be able to create a minimal DNS + initial: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: {} # No spec is required for a DNS + expected: | + apiVersion: config.openshift.io/v1 + kind: DNS + spec: {} diff --git a/vendor/github.com/openshift/api/config/v1/techpreview.infrastructure.testsuite.yaml b/vendor/github.com/openshift/api/config/v1/techpreview.infrastructure.testsuite.yaml index f9829b9a3..7834e1f84 100644 --- a/vendor/github.com/openshift/api/config/v1/techpreview.infrastructure.testsuite.yaml +++ b/vendor/github.com/openshift/api/config/v1/techpreview.infrastructure.testsuite.yaml @@ -211,3 +211,309 @@ tests: type: FooBar type: BareMetal expectedStatusError: "status.platformStatus.baremetal.loadBalancer.type: Unsupported value: \"FooBar\": supported values: \"OpenShiftManagedDefault\", \"UserManaged\"" + - name: Should not be able to modify an existing GCP ResourceLabels Label + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "changed"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels: Invalid value: \"array\": resourceLabels are immutable and may only be configured during installation" + - name: Should not be able to add a Label to an existing GCP ResourceLabels + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "new", value: "entry"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels: Invalid value: \"array\": resourceLabels are immutable and may only be configured during installation" + - name: Should not be able to remove a Label from an existing GCP ResourceLabels + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "new", value: "entry"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels: Invalid value: \"array\": resourceLabels are immutable and may only be configured during installation" + - name: Should not be able to add GCP ResourceLabels to an empty platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + gcp: + resourceLabels: + - {key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceLabels may only be configured during installation" + - name: Should not be able to remove GCP ResourceLabels from platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceLabels may only be configured during installation" + - name: Should not have label key start with openshift-io for GCP ResourceLabels in platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "openshift-io-created-cluster", value: "true"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels[1].key: Invalid value: \"string\": label keys must not start with either `openshift-io` or `kubernetes-io`" + - name: Should not have label key start with kubernetes-io for GCP ResourceLabels in platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceLabels: + - {key: "key", value: "value"} + - {key: "kubernetes-io-created-cluster", value: "true"} + expectedStatusError: "status.platformStatus.gcp.resourceLabels[1].key: Invalid value: \"string\": label keys must not start with either `openshift-io` or `kubernetes-io`" + - name: Should not be able to modify an existing GCP ResourceTags Tag + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "changed"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" + - name: Should not be able to add a Tag to an existing GCP ResourceTags + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + - {parentID: "test-project-123", key: "new", value: "tag"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" + - name: Should not be able to remove a Tag from an existing GCP ResourceTags + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key1", value: "value1"} + - {parentID: "test-project-123", key: "key2", value: "value2"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key1", value: "value1"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" + - name: Should not be able to add GCP ResourceTags to an empty platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceTags may only be configured during installation" + - name: Should not be able to remove GCP ResourceTags from platformStatus.gcp + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: {} + expectedStatusError: "status.platformStatus.gcp: Invalid value: \"object\": resourceTags may only be configured during installation" + - name: Should not be able to modify ParentID of a Tag in the GCP ResourceTags + initial: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + controlPlaneTopology: "HighlyAvailable" + infrastructureTopology: "HighlyAvailable" + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "1234567890", key: "key", value: "value"} + updated: | + apiVersion: config.openshift.io/v1 + kind: Infrastructure + spec: {} + status: + platform: GCP + platformStatus: + type: GCP + gcp: + resourceTags: + - {parentID: "test-project-123", key: "key", value: "value"} + expectedStatusError: "status.platformStatus.gcp.resourceTags: Invalid value: \"array\": resourceTags are immutable and may only be configured during installation" diff --git a/vendor/github.com/openshift/api/config/v1/types_cluster_version.go b/vendor/github.com/openshift/api/config/v1/types_cluster_version.go index 234720477..888a9658a 100644 --- a/vendor/github.com/openshift/api/config/v1/types_cluster_version.go +++ b/vendor/github.com/openshift/api/config/v1/types_cluster_version.go @@ -247,7 +247,7 @@ const ( ) // ClusterVersionCapability enumerates optional, core cluster components. -// +kubebuilder:validation:Enum=openshift-samples;baremetal;marketplace;Console;Insights;Storage;CSISnapshot;NodeTuning;MachineAPI +// +kubebuilder:validation:Enum=openshift-samples;baremetal;marketplace;Console;Insights;Storage;CSISnapshot;NodeTuning;MachineAPI;Build;DeploymentConfig type ClusterVersionCapability string const ( @@ -313,6 +313,23 @@ const ( // documentation. This is important part of openshift system // and may cause cluster damage ClusterVersionCapabilityMachineAPI ClusterVersionCapability = "MachineAPI" + + // ClusterVersionCapabilityBuild manages the Build API which is responsible + // for watching the Build API objects and managing their lifecycle. + // The functionality is located under openshift-apiserver and openshift-controller-manager. + // + // The following resources are taken into account: + // - builds + // - buildconfigs + ClusterVersionCapabilityBuild ClusterVersionCapability = "Build" + + // ClusterVersionCapabilityDeploymentConfig manages the DeploymentConfig API + // which is responsible for watching the DeploymentConfig API and managing their lifecycle. + // The functionality is located under openshift-apiserver and openshift-controller-manager. + // + // The following resources are taken into account: + // - deploymentconfigs + ClusterVersionCapabilityDeploymentConfig ClusterVersionCapability = "DeploymentConfig" ) // KnownClusterVersionCapabilities includes all known optional, core cluster components. @@ -326,6 +343,8 @@ var KnownClusterVersionCapabilities = []ClusterVersionCapability{ ClusterVersionCapabilityCSISnapshot, ClusterVersionCapabilityNodeTuning, ClusterVersionCapabilityMachineAPI, + ClusterVersionCapabilityBuild, + ClusterVersionCapabilityDeploymentConfig, } // ClusterVersionCapabilitySet defines sets of cluster version capabilities. @@ -404,6 +423,8 @@ var ClusterVersionCapabilitySets = map[ClusterVersionCapabilitySet][]ClusterVers ClusterVersionCapabilityCSISnapshot, ClusterVersionCapabilityNodeTuning, ClusterVersionCapabilityMachineAPI, + ClusterVersionCapabilityBuild, + ClusterVersionCapabilityDeploymentConfig, }, ClusterVersionCapabilitySetCurrent: { ClusterVersionCapabilityBaremetal, @@ -415,6 +436,8 @@ var ClusterVersionCapabilitySets = map[ClusterVersionCapabilitySet][]ClusterVers ClusterVersionCapabilityCSISnapshot, ClusterVersionCapabilityNodeTuning, ClusterVersionCapabilityMachineAPI, + ClusterVersionCapabilityBuild, + ClusterVersionCapabilityDeploymentConfig, }, } diff --git a/vendor/github.com/openshift/api/config/v1/types_dns.go b/vendor/github.com/openshift/api/config/v1/types_dns.go index 6283a2997..5f8697673 100644 --- a/vendor/github.com/openshift/api/config/v1/types_dns.go +++ b/vendor/github.com/openshift/api/config/v1/types_dns.go @@ -53,6 +53,12 @@ type DNSSpec struct { // // +optional PrivateZone *DNSZone `json:"privateZone,omitempty"` + // platform holds configuration specific to the underlying + // infrastructure provider for DNS. + // When omitted, this means the user has no opinion and the platform is left + // to choose reasonable defaults. These defaults are subject to change over time. + // +optional + Platform DNSPlatformSpec `json:"platform,omitempty"` } // DNSZone is used to define a DNS hosted zone. @@ -96,3 +102,34 @@ type DNSList struct { Items []DNS `json:"items"` } + +// DNSPlatformSpec holds cloud-provider-specific configuration +// for DNS administration. +// +union +// +kubebuilder:validation:XValidation:rule="has(self.type) && self.type == 'AWS' ? has(self.aws) : !has(self.aws)",message="aws configuration is required when platform is AWS, and forbidden otherwise" +type DNSPlatformSpec struct { + // type is the underlying infrastructure provider for the cluster. + // Allowed values: "", "AWS". + // + // Individual components may not support all platforms, + // and must handle unrecognized platforms with best-effort defaults. + // + // +unionDiscriminator + // +kubebuilder:validation:Required + // +kubebuilder:validation:XValidation:rule="self in ['','AWS']",message="allowed values are '' and 'AWS'" + Type PlatformType `json:"type"` + + // aws contains DNS configuration specific to the Amazon Web Services cloud provider. + // +optional + AWS *AWSDNSSpec `json:"aws"` +} + +// AWSDNSSpec contains DNS configuration specific to the Amazon Web Services cloud provider. +type AWSDNSSpec struct { + // privateZoneIAMRole contains the ARN of an IAM role that should be assumed when performing + // operations on the cluster's private hosted zone specified in the cluster DNS config. + // When left empty, no role should be assumed. + // +kubebuilder:validation:Pattern:=`^arn:(aws|aws-cn|aws-us-gov):iam::[0-9]{12}:role\/.*$` + // +optional + PrivateZoneIAMRole string `json:"privateZoneIAMRole"` +} diff --git a/vendor/github.com/openshift/api/config/v1/types_feature.go b/vendor/github.com/openshift/api/config/v1/types_feature.go index 488ed3e12..88835ae53 100644 --- a/vendor/github.com/openshift/api/config/v1/types_feature.go +++ b/vendor/github.com/openshift/api/config/v1/types_feature.go @@ -164,14 +164,12 @@ var FeatureSets = map[FeatureSet]*FeatureGateEnabledDisabled{ }, TechPreviewNoUpgrade: newDefaultFeatures(). with(externalCloudProvider). - with(externalCloudProviderAzure). with(externalCloudProviderGCP). with(csiDriverSharedResource). with(buildCSIVolumes). with(nodeSwap). with(machineAPIProviderOpenStack). with(insightsConfigAPI). - with(matchLabelKeysInPodTopologySpread). with(retroactiveDefaultStorageClass). with(pdbUnhealthyPodEvictionPolicy). with(dynamicResourceAllocation). @@ -179,7 +177,14 @@ var FeatureSets = map[FeatureSet]*FeatureGateEnabledDisabled{ with(azureWorkloadIdentity). with(gateGatewayAPI). with(maxUnavailableStatefulSet). - with(privateHostedZoneAWS). + without(eventedPleg). + with(sigstoreImageVerification). + with(gcpLabelsTags). + with(vSphereStaticIPs). + with(routeExternalCertificate). + with(automatedEtcdBackup). + without(machineAPIOperatorDisableMachineHealthCheckController). + with(adminNetworkPolicy). toFeatures(defaultFeatures), LatencySensitive: newDefaultFeatures(). toFeatures(defaultFeatures), @@ -188,6 +193,11 @@ var FeatureSets = map[FeatureSet]*FeatureGateEnabledDisabled{ var defaultFeatures = &FeatureGateEnabledDisabled{ Enabled: []FeatureGateDescription{ openShiftPodSecurityAdmission, + alibabaPlatform, // This is a bug, it should be TechPreviewNoUpgrade. This must be downgraded before 4.14 is shipped. + cloudDualStackNodeIPs, + externalCloudProviderAzure, + externalCloudProviderExternal, + privateHostedZoneAWS, }, Disabled: []FeatureGateDescription{ retroactiveDefaultStorageClass, diff --git a/vendor/github.com/openshift/api/config/v1/types_infrastructure.go b/vendor/github.com/openshift/api/config/v1/types_infrastructure.go index d47acdb77..6c791ee8c 100644 --- a/vendor/github.com/openshift/api/config/v1/types_infrastructure.go +++ b/vendor/github.com/openshift/api/config/v1/types_infrastructure.go @@ -114,7 +114,7 @@ type InfrastructureStatus struct { // +kubebuilder:default=None // +default="None" // +kubebuilder:validation:Enum=None;AllNodes - // +openshift:enable:FeatureSets=TechPreviewNoUpgrade + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade // +optional CPUPartitioning CPUPartitioningMode `json:"cpuPartitioning,omitempty"` } @@ -315,8 +315,48 @@ type PlatformSpec struct { External *ExternalPlatformSpec `json:"external,omitempty"` } +// CloudControllerManagerState defines whether Cloud Controller Manager presence is expected or not +type CloudControllerManagerState string + +const ( + // Cloud Controller Manager is enabled and expected to be installed. + // This value indicates that new nodes should be tainted as uninitialized when created, + // preventing them from running workloads until they are initialized by the cloud controller manager. + CloudControllerManagerExternal CloudControllerManagerState = "External" + + // Cloud Controller Manager is disabled and not expected to be installed. + // This value indicates that new nodes should not be tainted + // and no extra node initialization is expected from the cloud controller manager. + CloudControllerManagerNone CloudControllerManagerState = "None" +) + +// CloudControllerManagerStatus holds the state of Cloud Controller Manager (a.k.a. CCM or CPI) related settings +// +kubebuilder:validation:XValidation:rule="(has(self.state) == has(oldSelf.state)) || (!has(oldSelf.state) && self.state != \"External\")",message="state may not be added or removed once set" +type CloudControllerManagerStatus struct { + // state determines whether or not an external Cloud Controller Manager is expected to + // be installed within the cluster. + // https://kubernetes.io/docs/tasks/administer-cluster/running-cloud-controller/#running-cloud-controller-manager + // + // Valid values are "External", "None" and omitted. + // When set to "External", new nodes will be tainted as uninitialized when created, + // preventing them from running workloads until they are initialized by the cloud controller manager. + // When omitted or set to "None", new nodes will be not tainted + // and no extra initialization from the cloud controller manager is expected. + // +kubebuilder:validation:Enum="";External;None + // +kubebuilder:validation:XValidation:rule="self == oldSelf",message="state is immutable once set" + // +optional + State CloudControllerManagerState `json:"state"` +} + // ExternalPlatformStatus holds the current status of the generic External infrastructure provider. -type ExternalPlatformStatus struct{} +// +kubebuilder:validation:XValidation:rule="has(self.cloudControllerManager) == has(oldSelf.cloudControllerManager)",message="cloudControllerManager may not be added or removed once set" +type ExternalPlatformStatus struct { + // cloudControllerManager contains settings specific to the external Cloud Controller Manager (a.k.a. CCM or CPI). + // When omitted, new nodes will be not tainted + // and no extra initialization from the cloud controller manager is expected. + // +optional + CloudControllerManager CloudControllerManagerStatus `json:"cloudControllerManager"` +} // PlatformStatus holds the current status specific to the underlying infrastructure provider // of the current cluster. Since these are used at status-level for the underlying cluster, it @@ -540,12 +580,93 @@ const ( type GCPPlatformSpec struct{} // GCPPlatformStatus holds the current status of the Google Cloud Platform infrastructure provider. +// +openshift:validation:FeatureSetAwareXValidation:featureSet=CustomNoUpgrade;TechPreviewNoUpgrade,rule="!has(oldSelf.resourceLabels) && !has(self.resourceLabels) || has(oldSelf.resourceLabels) && has(self.resourceLabels)",message="resourceLabels may only be configured during installation" +// +openshift:validation:FeatureSetAwareXValidation:featureSet=CustomNoUpgrade;TechPreviewNoUpgrade,rule="!has(oldSelf.resourceTags) && !has(self.resourceTags) || has(oldSelf.resourceTags) && has(self.resourceTags)",message="resourceTags may only be configured during installation" type GCPPlatformStatus struct { // resourceGroupName is the Project ID for new GCP resources created for the cluster. ProjectID string `json:"projectID"` // region holds the region for new GCP resources created for the cluster. Region string `json:"region"` + + // resourceLabels is a list of additional labels to apply to GCP resources created for the cluster. + // See https://cloud.google.com/compute/docs/labeling-resources for information on labeling GCP resources. + // GCP supports a maximum of 64 labels per resource. OpenShift reserves 32 labels for internal use, + // allowing 32 labels for user configuration. + // +kubebuilder:validation:MaxItems=32 + // +kubebuilder:validation:XValidation:rule="self.all(x, x in oldSelf) && oldSelf.all(x, x in self)",message="resourceLabels are immutable and may only be configured during installation" + // +listType=map + // +listMapKey=key + // +optional + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade + ResourceLabels []GCPResourceLabel `json:"resourceLabels,omitempty"` + + // resourceTags is a list of additional tags to apply to GCP resources created for the cluster. + // See https://cloud.google.com/resource-manager/docs/tags/tags-overview for information on + // tagging GCP resources. GCP supports a maximum of 50 tags per resource. + // +kubebuilder:validation:MaxItems=50 + // +kubebuilder:validation:XValidation:rule="self.all(x, x in oldSelf) && oldSelf.all(x, x in self)",message="resourceTags are immutable and may only be configured during installation" + // +listType=map + // +listMapKey=key + // +optional + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade + ResourceTags []GCPResourceTag `json:"resourceTags,omitempty"` +} + +// GCPResourceLabel is a label to apply to GCP resources created for the cluster. +type GCPResourceLabel struct { + // key is the key part of the label. A label key can have a maximum of 63 characters and cannot be empty. + // Label key must begin with a lowercase letter, and must contain only lowercase letters, numeric characters, + // and the following special characters `_-`. Label key must not have the reserved prefixes `kubernetes-io` + // and `openshift-io`. + // +kubebuilder:validation:XValidation:rule="!self.startsWith('openshift-io') && !self.startsWith('kubernetes-io')",message="label keys must not start with either `openshift-io` or `kubernetes-io`" + // +kubebuilder:validation:Required + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=63 + // +kubebuilder:validation:Pattern=`^[a-z][0-9a-z_-]+$` + Key string `json:"key"` + + // value is the value part of the label. A label value can have a maximum of 63 characters and cannot be empty. + // Value must contain only lowercase letters, numeric characters, and the following special characters `_-`. + // +kubebuilder:validation:Required + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=63 + // +kubebuilder:validation:Pattern=`^[0-9a-z_-]+$` + Value string `json:"value"` +} + +// GCPResourceTag is a tag to apply to GCP resources created for the cluster. +type GCPResourceTag struct { + // parentID is the ID of the hierarchical resource where the tags are defined, + // e.g. at the Organization or the Project level. To find the Organization or Project ID refer to the following pages: + // https://cloud.google.com/resource-manager/docs/creating-managing-organization#retrieving_your_organization_id, + // https://cloud.google.com/resource-manager/docs/creating-managing-projects#identifying_projects. + // An OrganizationID must consist of decimal numbers, and cannot have leading zeroes. + // A ProjectID must be 6 to 30 characters in length, can only contain lowercase letters, numbers, + // and hyphens, and must start with a letter, and cannot end with a hyphen. + // +kubebuilder:validation:Required + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=32 + // +kubebuilder:validation:Pattern=`(^[1-9][0-9]{0,31}$)|(^[a-z][a-z0-9-]{4,28}[a-z0-9]$)` + ParentID string `json:"parentID"` + + // key is the key part of the tag. A tag key can have a maximum of 63 characters and cannot be empty. + // Tag key must begin and end with an alphanumeric character, and must contain only uppercase, lowercase + // alphanumeric characters, and the following special characters `._-`. + // +kubebuilder:validation:Required + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=63 + // +kubebuilder:validation:Pattern=`^[a-zA-Z0-9]([0-9A-Za-z_.-]{0,61}[a-zA-Z0-9])?$` + Key string `json:"key"` + + // value is the value part of the tag. A tag value can have a maximum of 63 characters and cannot be empty. + // Tag value must begin and end with an alphanumeric character, and must contain only uppercase, lowercase + // alphanumeric characters, and the following special characters `_-.@%=+:,*#&(){}[]` and spaces. + // +kubebuilder:validation:Required + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=63 + // +kubebuilder:validation:Pattern=`^[a-zA-Z0-9]([0-9A-Za-z_.@%=+:,*#&()\[\]{}\-\s]{0,61}[a-zA-Z0-9])?$` + Value string `json:"value"` } // BareMetalPlatformLoadBalancer defines the load balancer used by the cluster on BareMetal platform. @@ -621,7 +742,7 @@ type BareMetalPlatformStatus struct { // loadBalancer defines how the load balancer used by the cluster is configured. // +default={"type": "OpenShiftManagedDefault"} // +kubebuilder:default={"type": "OpenShiftManagedDefault"} - // +openshift:enable:FeatureSets=TechPreviewNoUpgrade + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade // +optional LoadBalancer *BareMetalPlatformLoadBalancer `json:"loadBalancer,omitempty"` } @@ -771,7 +892,7 @@ type OvirtPlatformStatus struct { // loadBalancer defines how the load balancer used by the cluster is configured. // +default={"type": "OpenShiftManagedDefault"} // +kubebuilder:default={"type": "OpenShiftManagedDefault"} - // +openshift:enable:FeatureSets=TechPreviewNoUpgrade + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade // +optional LoadBalancer *OvirtPlatformLoadBalancer `json:"loadBalancer,omitempty"` } @@ -1037,7 +1158,7 @@ type VSpherePlatformStatus struct { // loadBalancer defines how the load balancer used by the cluster is configured. // +default={"type": "OpenShiftManagedDefault"} // +kubebuilder:default={"type": "OpenShiftManagedDefault"} - // +openshift:enable:FeatureSets=TechPreviewNoUpgrade + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade // +optional LoadBalancer *VSpherePlatformLoadBalancer `json:"loadBalancer,omitempty"` } @@ -1320,7 +1441,7 @@ type NutanixPlatformStatus struct { // loadBalancer defines how the load balancer used by the cluster is configured. // +default={"type": "OpenShiftManagedDefault"} // +kubebuilder:default={"type": "OpenShiftManagedDefault"} - // +openshift:enable:FeatureSets=TechPreviewNoUpgrade + // +openshift:enable:FeatureSets=CustomNoUpgrade;TechPreviewNoUpgrade // +optional LoadBalancer *NutanixPlatformLoadBalancer `json:"loadBalancer,omitempty"` } diff --git a/vendor/github.com/openshift/api/config/v1/zz_generated.deepcopy.go b/vendor/github.com/openshift/api/config/v1/zz_generated.deepcopy.go index 4db1b9ad4..44d7428e6 100644 --- a/vendor/github.com/openshift/api/config/v1/zz_generated.deepcopy.go +++ b/vendor/github.com/openshift/api/config/v1/zz_generated.deepcopy.go @@ -179,6 +179,22 @@ func (in *APIServerStatus) DeepCopy() *APIServerStatus { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *AWSDNSSpec) DeepCopyInto(out *AWSDNSSpec) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSDNSSpec. +func (in *AWSDNSSpec) DeepCopy() *AWSDNSSpec { + if in == nil { + return nil + } + out := new(AWSDNSSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *AWSIngressSpec) DeepCopyInto(out *AWSIngressSpec) { *out = *in @@ -859,6 +875,22 @@ func (in *ClientConnectionOverrides) DeepCopy() *ClientConnectionOverrides { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *CloudControllerManagerStatus) DeepCopyInto(out *CloudControllerManagerStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new CloudControllerManagerStatus. +func (in *CloudControllerManagerStatus) DeepCopy() *CloudControllerManagerStatus { + if in == nil { + return nil + } + out := new(CloudControllerManagerStatus) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClusterCondition) DeepCopyInto(out *ClusterCondition) { *out = *in @@ -1580,6 +1612,27 @@ func (in *DNSList) DeepCopyObject() runtime.Object { return nil } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *DNSPlatformSpec) DeepCopyInto(out *DNSPlatformSpec) { + *out = *in + if in.AWS != nil { + in, out := &in.AWS, &out.AWS + *out = new(AWSDNSSpec) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new DNSPlatformSpec. +func (in *DNSPlatformSpec) DeepCopy() *DNSPlatformSpec { + if in == nil { + return nil + } + out := new(DNSPlatformSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *DNSSpec) DeepCopyInto(out *DNSSpec) { *out = *in @@ -1593,6 +1646,7 @@ func (in *DNSSpec) DeepCopyInto(out *DNSSpec) { *out = new(DNSZone) (*in).DeepCopyInto(*out) } + in.Platform.DeepCopyInto(&out.Platform) return } @@ -1836,6 +1890,7 @@ func (in *ExternalPlatformSpec) DeepCopy() *ExternalPlatformSpec { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ExternalPlatformStatus) DeepCopyInto(out *ExternalPlatformStatus) { *out = *in + out.CloudControllerManager = in.CloudControllerManager return } @@ -2082,6 +2137,16 @@ func (in *GCPPlatformSpec) DeepCopy() *GCPPlatformSpec { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *GCPPlatformStatus) DeepCopyInto(out *GCPPlatformStatus) { *out = *in + if in.ResourceLabels != nil { + in, out := &in.ResourceLabels, &out.ResourceLabels + *out = make([]GCPResourceLabel, len(*in)) + copy(*out, *in) + } + if in.ResourceTags != nil { + in, out := &in.ResourceTags, &out.ResourceTags + *out = make([]GCPResourceTag, len(*in)) + copy(*out, *in) + } return } @@ -2095,6 +2160,38 @@ func (in *GCPPlatformStatus) DeepCopy() *GCPPlatformStatus { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *GCPResourceLabel) DeepCopyInto(out *GCPResourceLabel) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new GCPResourceLabel. +func (in *GCPResourceLabel) DeepCopy() *GCPResourceLabel { + if in == nil { + return nil + } + out := new(GCPResourceLabel) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *GCPResourceTag) DeepCopyInto(out *GCPResourceTag) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new GCPResourceTag. +func (in *GCPResourceTag) DeepCopy() *GCPResourceTag { + if in == nil { + return nil + } + out := new(GCPResourceTag) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *GenericAPIServerConfig) DeepCopyInto(out *GenericAPIServerConfig) { *out = *in @@ -4280,7 +4377,7 @@ func (in *PlatformStatus) DeepCopyInto(out *PlatformStatus) { if in.GCP != nil { in, out := &in.GCP, &out.GCP *out = new(GCPPlatformStatus) - **out = **in + (*in).DeepCopyInto(*out) } if in.BareMetal != nil { in, out := &in.BareMetal, &out.BareMetal diff --git a/vendor/github.com/openshift/api/config/v1/zz_generated.swagger_doc_generated.go b/vendor/github.com/openshift/api/config/v1/zz_generated.swagger_doc_generated.go index 179d921e1..33ec92237 100644 --- a/vendor/github.com/openshift/api/config/v1/zz_generated.swagger_doc_generated.go +++ b/vendor/github.com/openshift/api/config/v1/zz_generated.swagger_doc_generated.go @@ -746,6 +746,15 @@ func (ConsoleStatus) SwaggerDoc() map[string]string { return map_ConsoleStatus } +var map_AWSDNSSpec = map[string]string{ + "": "AWSDNSSpec contains DNS configuration specific to the Amazon Web Services cloud provider.", + "privateZoneIAMRole": "privateZoneIAMRole contains the ARN of an IAM role that should be assumed when performing operations on the cluster's private hosted zone specified in the cluster DNS config. When left empty, no role should be assumed.", +} + +func (AWSDNSSpec) SwaggerDoc() map[string]string { + return map_AWSDNSSpec +} + var map_DNS = map[string]string{ "": "DNS holds cluster-wide information about DNS. The canonical name is `cluster`\n\nCompatibility level 1: Stable within a major release for a minimum of 12 months or 3 minor releases (whichever is longer).", "metadata": "metadata is the standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", @@ -766,10 +775,21 @@ func (DNSList) SwaggerDoc() map[string]string { return map_DNSList } +var map_DNSPlatformSpec = map[string]string{ + "": "DNSPlatformSpec holds cloud-provider-specific configuration for DNS administration.", + "type": "type is the underlying infrastructure provider for the cluster. Allowed values: \"\", \"AWS\".\n\nIndividual components may not support all platforms, and must handle unrecognized platforms with best-effort defaults.", + "aws": "aws contains DNS configuration specific to the Amazon Web Services cloud provider.", +} + +func (DNSPlatformSpec) SwaggerDoc() map[string]string { + return map_DNSPlatformSpec +} + var map_DNSSpec = map[string]string{ "baseDomain": "baseDomain is the base domain of the cluster. All managed DNS records will be sub-domains of this base.\n\nFor example, given the base domain `openshift.example.com`, an API server DNS record may be created for `cluster-api.openshift.example.com`.\n\nOnce set, this field cannot be changed.", "publicZone": "publicZone is the location where all the DNS records that are publicly accessible to the internet exist.\n\nIf this field is nil, no public records should be created.\n\nOnce set, this field cannot be changed.", "privateZone": "privateZone is the location where all the DNS records that are only available internally to the cluster exist.\n\nIf this field is nil, no private records should be created.\n\nOnce set, this field cannot be changed.", + "platform": "platform holds configuration specific to the underlying infrastructure provider for DNS. When omitted, this means the user has no opinion and the platform is left to choose reasonable defaults. These defaults are subject to change over time.", } func (DNSSpec) SwaggerDoc() map[string]string { @@ -1163,6 +1183,15 @@ func (BareMetalPlatformStatus) SwaggerDoc() map[string]string { return map_BareMetalPlatformStatus } +var map_CloudControllerManagerStatus = map[string]string{ + "": "CloudControllerManagerStatus holds the state of Cloud Controller Manager (a.k.a. CCM or CPI) related settings", + "state": "state determines whether or not an external Cloud Controller Manager is expected to be installed within the cluster. https://kubernetes.io/docs/tasks/administer-cluster/running-cloud-controller/#running-cloud-controller-manager\n\nValid values are \"External\", \"None\" and omitted. When set to \"External\", new nodes will be tainted as uninitialized when created, preventing them from running workloads until they are initialized by the cloud controller manager. When omitted or set to \"None\", new nodes will be not tainted and no extra initialization from the cloud controller manager is expected.", +} + +func (CloudControllerManagerStatus) SwaggerDoc() map[string]string { + return map_CloudControllerManagerStatus +} + var map_EquinixMetalPlatformSpec = map[string]string{ "": "EquinixMetalPlatformSpec holds the desired state of the Equinix Metal infrastructure provider. This only includes fields that can be modified in the cluster.", } @@ -1191,7 +1220,8 @@ func (ExternalPlatformSpec) SwaggerDoc() map[string]string { } var map_ExternalPlatformStatus = map[string]string{ - "": "ExternalPlatformStatus holds the current status of the generic External infrastructure provider.", + "": "ExternalPlatformStatus holds the current status of the generic External infrastructure provider.", + "cloudControllerManager": "cloudControllerManager contains settings specific to the external Cloud Controller Manager (a.k.a. CCM or CPI). When omitted, new nodes will be not tainted and no extra initialization from the cloud controller manager is expected.", } func (ExternalPlatformStatus) SwaggerDoc() map[string]string { @@ -1207,15 +1237,38 @@ func (GCPPlatformSpec) SwaggerDoc() map[string]string { } var map_GCPPlatformStatus = map[string]string{ - "": "GCPPlatformStatus holds the current status of the Google Cloud Platform infrastructure provider.", - "projectID": "resourceGroupName is the Project ID for new GCP resources created for the cluster.", - "region": "region holds the region for new GCP resources created for the cluster.", + "": "GCPPlatformStatus holds the current status of the Google Cloud Platform infrastructure provider.", + "projectID": "resourceGroupName is the Project ID for new GCP resources created for the cluster.", + "region": "region holds the region for new GCP resources created for the cluster.", + "resourceLabels": "resourceLabels is a list of additional labels to apply to GCP resources created for the cluster. See https://cloud.google.com/compute/docs/labeling-resources for information on labeling GCP resources. GCP supports a maximum of 64 labels per resource. OpenShift reserves 32 labels for internal use, allowing 32 labels for user configuration.", + "resourceTags": "resourceTags is a list of additional tags to apply to GCP resources created for the cluster. See https://cloud.google.com/resource-manager/docs/tags/tags-overview for information on tagging GCP resources. GCP supports a maximum of 50 tags per resource.", } func (GCPPlatformStatus) SwaggerDoc() map[string]string { return map_GCPPlatformStatus } +var map_GCPResourceLabel = map[string]string{ + "": "GCPResourceLabel is a label to apply to GCP resources created for the cluster.", + "key": "key is the key part of the label. A label key can have a maximum of 63 characters and cannot be empty. Label key must begin with a lowercase letter, and must contain only lowercase letters, numeric characters, and the following special characters `_-`. Label key must not have the reserved prefixes `kubernetes-io` and `openshift-io`.", + "value": "value is the value part of the label. A label value can have a maximum of 63 characters and cannot be empty. Value must contain only lowercase letters, numeric characters, and the following special characters `_-`.", +} + +func (GCPResourceLabel) SwaggerDoc() map[string]string { + return map_GCPResourceLabel +} + +var map_GCPResourceTag = map[string]string{ + "": "GCPResourceTag is a tag to apply to GCP resources created for the cluster.", + "parentID": "parentID is the ID of the hierarchical resource where the tags are defined, e.g. at the Organization or the Project level. To find the Organization or Project ID refer to the following pages: https://cloud.google.com/resource-manager/docs/creating-managing-organization#retrieving_your_organization_id, https://cloud.google.com/resource-manager/docs/creating-managing-projects#identifying_projects. An OrganizationID must consist of decimal numbers, and cannot have leading zeroes. A ProjectID must be 6 to 30 characters in length, can only contain lowercase letters, numbers, and hyphens, and must start with a letter, and cannot end with a hyphen.", + "key": "key is the key part of the tag. A tag key can have a maximum of 63 characters and cannot be empty. Tag key must begin and end with an alphanumeric character, and must contain only uppercase, lowercase alphanumeric characters, and the following special characters `._-`.", + "value": "value is the value part of the tag. A tag value can have a maximum of 63 characters and cannot be empty. Tag value must begin and end with an alphanumeric character, and must contain only uppercase, lowercase alphanumeric characters, and the following special characters `_-.@%=+:,*#&(){}[]` and spaces.", +} + +func (GCPResourceTag) SwaggerDoc() map[string]string { + return map_GCPResourceTag +} + var map_IBMCloudPlatformSpec = map[string]string{ "": "IBMCloudPlatformSpec holds the desired state of the IBMCloud infrastructure provider. This only includes fields that can be modified in the cluster.", } diff --git a/vendor/github.com/openshift/api/config/v1alpha1/0000_10_config-operator_01_backup-TechPreviewNoUpgrade.crd.yaml b/vendor/github.com/openshift/api/config/v1alpha1/0000_10_config-operator_01_backup-TechPreviewNoUpgrade.crd.yaml new file mode 100644 index 000000000..0ee3bdea4 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1alpha1/0000_10_config-operator_01_backup-TechPreviewNoUpgrade.crd.yaml @@ -0,0 +1,100 @@ +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + api-approved.openshift.io: https://github.com/openshift/api/pull/1482 + include.release.openshift.io/ibm-cloud-managed: "true" + include.release.openshift.io/self-managed-high-availability: "true" + include.release.openshift.io/single-node-developer: "true" + release.openshift.io/feature-set: TechPreviewNoUpgrade + name: backups.config.openshift.io +spec: + group: config.openshift.io + names: + kind: Backup + listKind: BackupList + plural: backups + singular: backup + scope: Cluster + versions: + - name: v1alpha1 + served: true + storage: true + subresources: + status: {} + schema: + openAPIV3Schema: + description: "Backup provides configuration for performing backups of the openshift cluster. \n Compatibility level 4: No compatibility is provided, the API can change at any point for any reason. These capabilities should not be used by applications needing long term support." + type: object + required: + - spec + properties: + apiVersion: + description: 'APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources' + type: string + kind: + description: 'Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + description: spec holds user settable values for configuration + type: object + required: + - etcd + properties: + etcd: + description: etcd specifies the configuration for periodic backups of the etcd cluster + type: object + properties: + pvcName: + description: PVCName specifies the name of the PersistentVolumeClaim (PVC) which binds a PersistentVolume where the etcd backup files would be saved The PVC itself must always be created in the "openshift-etcd" namespace If the PVC is left unspecified "" then the platform will choose a reasonable default location to save the backup. In the future this would be backups saved across the control-plane master nodes. + type: string + retentionPolicy: + description: RetentionPolicy defines the retention policy for retaining and deleting existing backups. + type: object + required: + - retentionType + properties: + retentionNumber: + description: RetentionNumber configures the retention policy based on the number of backups + type: object + required: + - maxNumberOfBackups + properties: + maxNumberOfBackups: + description: MaxNumberOfBackups defines the maximum number of backups to retain. If the existing number of backups saved is equal to MaxNumberOfBackups then the oldest backup will be removed before a new backup is initiated. + type: integer + minimum: 1 + retentionSize: + description: RetentionSize configures the retention policy based on the size of backups + type: object + required: + - maxSizeOfBackupsGb + properties: + maxSizeOfBackupsGb: + description: MaxSizeOfBackupsGb defines the total size in GB of backups to retain. If the current total size backups exceeds MaxSizeOfBackupsGb then the oldest backup will be removed before a new backup is initiated. + type: integer + minimum: 1 + retentionType: + description: RetentionType sets the type of retention policy. Currently, the only valid policies are retention by number of backups (RetentionNumber), by the size of backups (RetentionSize). More policies or types may be added in the future. Empty string means no opinion and the platform is left to choose a reasonable default which is subject to change without notice. The current default is RetentionNumber with 15 backups kept. + type: string + allOf: + - enum: + - RetentionNumber + - RetentionSize + - enum: + - "" + - RetentionNumber + - RetentionSize + schedule: + description: 'Schedule defines the recurring backup schedule in Cron format every 2 hours: 0 */2 * * * every day at 3am: 0 3 * * * Empty string means no opinion and the platform is left to choose a reasonable default which is subject to change without notice. The current default is "no backups", but will change in the future.' + type: string + pattern: ^(@(annually|yearly|monthly|weekly|daily|hourly))|(\*|(?:\*|(?:[0-9]|(?:[1-5][0-9])))\/(?:[0-9]|(?:[1-5][0-9]))|(?:[0-9]|(?:[1-5][0-9]))(?:(?:\-[0-9]|\-(?:[1-5][0-9]))?|(?:\,(?:[0-9]|(?:[1-5][0-9])))*)) (\*|(?:\*|(?:\*|(?:[0-9]|1[0-9]|2[0-3])))\/(?:[0-9]|1[0-9]|2[0-3])|(?:[0-9]|1[0-9]|2[0-3])(?:(?:\-(?:[0-9]|1[0-9]|2[0-3]))?|(?:\,(?:[0-9]|1[0-9]|2[0-3]))*)) (\*|(?:[1-9]|(?:[12][0-9])|3[01])(?:(?:\-(?:[1-9]|(?:[12][0-9])|3[01]))?|(?:\,(?:[1-9]|(?:[12][0-9])|3[01]))*)) (\*|(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC)(?:(?:\-(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC))?|(?:\,(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC))*)) (\*|(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT)(?:(?:\-(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT))?|(?:\,(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT))*))$ + timeZone: + description: The time zone name for the given schedule, see https://en.wikipedia.org/wiki/List_of_tz_database_time_zones. If not specified, this will default to the time zone of the kube-controller-manager process. See https://kubernetes.io/docs/concepts/workloads/controllers/cron-jobs/#time-zones + type: string + pattern: ^([A-Za-z_]+([+-]*0)*|[A-Za-z_]+(\/[A-Za-z_]+){1,2})(\/GMT[+-]\d{1,2})?$ + status: + description: status holds observed values from the cluster. They may not be overridden. + type: object diff --git a/vendor/github.com/openshift/api/config/v1alpha1/register.go b/vendor/github.com/openshift/api/config/v1alpha1/register.go index 73ddb749f..7ec30d7aa 100644 --- a/vendor/github.com/openshift/api/config/v1alpha1/register.go +++ b/vendor/github.com/openshift/api/config/v1alpha1/register.go @@ -32,6 +32,8 @@ func addKnownTypes(scheme *runtime.Scheme) error { scheme.AddKnownTypes(GroupVersion, &InsightsDataGather{}, &InsightsDataGatherList{}, + &Backup{}, + &BackupList{}, ) metav1.AddToGroupVersion(scheme, GroupVersion) return nil diff --git a/vendor/github.com/openshift/api/config/v1alpha1/techpreview.backup.testsuite.yaml b/vendor/github.com/openshift/api/config/v1alpha1/techpreview.backup.testsuite.yaml new file mode 100644 index 000000000..91836dd93 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1alpha1/techpreview.backup.testsuite.yaml @@ -0,0 +1,202 @@ +apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this +name: "[TechPreview] Backup" +crd: 0000_10_config-operator_01_backup-TechPreviewNoUpgrade.crd.yaml +tests: + onCreate: + - name: Should be able to create a Backup with a valid spec + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* 2 * * *" + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* 2 * * *" + pvcName: etcdbackup-pvc + - name: Should be able to create an EtcdBackup without the pvcName specified + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* 2 * * *" + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* 2 * * *" + - name: Should be able to create a Backup with a valid schedule - At 22:00 on every day-of-week from Monday through Friday + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "0 22 * * 1-5" + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "0 22 * * 1-5" + pvcName: etcdbackup-pvc + - name: Should be able to create a Backup with a valid schedule - At 04:05 on Sunday. + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "5 4 * * SUN" + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "5 4 * * SUN" + pvcName: etcdbackup-pvc + - name: Should be able to create a Backup with a valid schedule - Predefined hourly + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "@hourly" + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "@hourly" + pvcName: etcdbackup-pvc + - name: Should fail to create an EtcdBackup with an invalid schedule - At 04:05 on invalid day FOO. + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "5 4 * * FOO" + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.schedule in body should match" + - name: Should fail to create an EtcdBackup with an invalid schedule - Predefined typo @hourli instead of @hourly. + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "@hourli" + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.schedule in body should match" + - name: Should fail to create an EtcdBackup with an invalid schedule - Non standard L last Friday in month + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* * * * 5L" + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.schedule in body should match" + - name: Should fail to create an EtcdBackup with an invalid schedule - Non standard L 5th day before last day of month + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* * L-5 * *" + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.schedule in body should match" + - name: Should fail to create an EtcdBackup with an invalid schedule - Non standard W closest weekday to 15th of month + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + schedule: "* * 15W * *" + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.schedule in body should match" + - name: Should be able to create a Backup with a valid time zone - Africa/Banjul + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: Africa/Banjul + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: Africa/Banjul + pvcName: etcdbackup-pvc + - name: Should be able to create a Backup with a valid time zone - Etc/GMT-8 + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: Etc/GMT-8 + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: Etc/GMT-8 + pvcName: etcdbackup-pvc + - name: Should be able to create a Backup with a valid time zone - Etc/UTC + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: Etc/UTC + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: Etc/UTC + pvcName: etcdbackup-pvc + - name: Should be able to create a Backup with a valid time zone - America/Argentina/Catamarca + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: America/Argentina/Catamarca + pvcName: etcdbackup-pvc + expected: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: America/Argentina/Catamarca + pvcName: etcdbackup-pvc + - name: Should fail to create an EtcdBackup with an invalid time zone - GMT2 + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: GMT2 + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.timeZone in body should match" + - name: Should fail to create an EtcdBackup with an invalid time zone - GMT+3 + initial: | + apiVersion: config.openshift.io/v1alpha1 + kind: Backup + spec: + etcd: + timeZone: GMT+3 + pvcName: etcdbackup-pvc + expectedError: "spec.etcd.timeZone in body should match" + diff --git a/vendor/github.com/openshift/api/config/v1alpha1/types_backup.go b/vendor/github.com/openshift/api/config/v1alpha1/types_backup.go new file mode 100644 index 000000000..9af55b540 --- /dev/null +++ b/vendor/github.com/openshift/api/config/v1alpha1/types_backup.go @@ -0,0 +1,168 @@ +package v1alpha1 + +import metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + +// +genclient +// +genclient:nonNamespaced +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +// +// Backup provides configuration for performing backups of the openshift cluster. +// +// Compatibility level 4: No compatibility is provided, the API can change at any point for any reason. These capabilities should not be used by applications needing long term support. +// +openshift:compatibility-gen:level=4 +type Backup struct { + metav1.TypeMeta `json:",inline"` + + // metadata is the standard object's metadata. + // More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata + metav1.ObjectMeta `json:"metadata,omitempty"` + + // spec holds user settable values for configuration + // +kubebuilder:validation:Required + // +required + Spec BackupSpec `json:"spec"` + // status holds observed values from the cluster. They may not be overridden. + // +kubebuilder:validation:Optional + // +optional + Status BackupStatus `json:"status"` +} + +type BackupSpec struct { + // etcd specifies the configuration for periodic backups of the etcd cluster + // +kubebuilder:validation:Required + EtcdBackupSpec EtcdBackupSpec `json:"etcd"` +} + +type BackupStatus struct { +} + +// EtcdBackupSpec provides configuration for automated etcd backups to the cluster-etcd-operator +type EtcdBackupSpec struct { + + // Schedule defines the recurring backup schedule in Cron format + // every 2 hours: 0 */2 * * * + // every day at 3am: 0 3 * * * + // Empty string means no opinion and the platform is left to choose a reasonable default which is subject to change without notice. + // The current default is "no backups", but will change in the future. + // +kubebuilder:validation:Optional + // +optional + // +kubebuilder:validation:Pattern:=`^(@(annually|yearly|monthly|weekly|daily|hourly))|(\*|(?:\*|(?:[0-9]|(?:[1-5][0-9])))\/(?:[0-9]|(?:[1-5][0-9]))|(?:[0-9]|(?:[1-5][0-9]))(?:(?:\-[0-9]|\-(?:[1-5][0-9]))?|(?:\,(?:[0-9]|(?:[1-5][0-9])))*)) (\*|(?:\*|(?:\*|(?:[0-9]|1[0-9]|2[0-3])))\/(?:[0-9]|1[0-9]|2[0-3])|(?:[0-9]|1[0-9]|2[0-3])(?:(?:\-(?:[0-9]|1[0-9]|2[0-3]))?|(?:\,(?:[0-9]|1[0-9]|2[0-3]))*)) (\*|(?:[1-9]|(?:[12][0-9])|3[01])(?:(?:\-(?:[1-9]|(?:[12][0-9])|3[01]))?|(?:\,(?:[1-9]|(?:[12][0-9])|3[01]))*)) (\*|(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC)(?:(?:\-(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC))?|(?:\,(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC))*)) (\*|(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT)(?:(?:\-(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT))?|(?:\,(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT))*))$` + Schedule string `json:"schedule"` + + // Cron Regex breakdown: + // Allow macros: (@(annually|yearly|monthly|weekly|daily|hourly)) + // OR + // Minute: + // (\*|(?:\*|(?:[0-9]|(?:[1-5][0-9])))\/(?:[0-9]|(?:[1-5][0-9]))|(?:[0-9]|(?:[1-5][0-9]))(?:(?:\-[0-9]|\-(?:[1-5][0-9]))?|(?:\,(?:[0-9]|(?:[1-5][0-9])))*)) + // Hour: + // (\*|(?:\*|(?:\*|(?:[0-9]|1[0-9]|2[0-3])))\/(?:[0-9]|1[0-9]|2[0-3])|(?:[0-9]|1[0-9]|2[0-3])(?:(?:\-(?:[0-9]|1[0-9]|2[0-3]))?|(?:\,(?:[0-9]|1[0-9]|2[0-3]))*)) + // Day of the Month: + // (\*|(?:[1-9]|(?:[12][0-9])|3[01])(?:(?:\-(?:[1-9]|(?:[12][0-9])|3[01]))?|(?:\,(?:[1-9]|(?:[12][0-9])|3[01]))*)) + // Month: + // (\*|(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC)(?:(?:\-(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC))?|(?:\,(?:[1-9]|1[012]|JAN|FEB|MAR|APR|MAY|JUN|JUL|AUG|SEP|OCT|NOV|DEC))*)) + // Day of Week: + // (\*|(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT)(?:(?:\-(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT))?|(?:\,(?:[0-6]|SUN|MON|TUE|WED|THU|FRI|SAT))*)) + // + + // The time zone name for the given schedule, see https://en.wikipedia.org/wiki/List_of_tz_database_time_zones. + // If not specified, this will default to the time zone of the kube-controller-manager process. + // See https://kubernetes.io/docs/concepts/workloads/controllers/cron-jobs/#time-zones + // +kubebuilder:validation:Optional + // +optional + // +kubebuilder:validation:Pattern:=`^([A-Za-z_]+([+-]*0)*|[A-Za-z_]+(\/[A-Za-z_]+){1,2})(\/GMT[+-]\d{1,2})?$` + TimeZone string `json:"timeZone"` + + // Timezone regex breakdown: + // ([A-Za-z_]+([+-]*0)*|[A-Za-z_]+(/[A-Za-z_]+){1,2}) - Matches either: + // [A-Za-z_]+([+-]*0)* - One or more alphabetical characters (uppercase or lowercase) or underscores, followed by a +0 or -0 to account for GMT+0 or GMT-0 (for the first part of the timezone identifier). + // [A-Za-z_]+(/[A-Za-z_]+){1,2} - One or more alphabetical characters (uppercase or lowercase) or underscores, followed by one or two occurrences of a forward slash followed by one or more alphabetical characters or underscores. This allows for matching timezone identifiers with 2 or 3 parts, e.g America/Argentina/Buenos_Aires + // (/GMT[+-]\d{1,2})? - Makes the GMT offset suffix optional. It matches "/GMT" followed by either a plus ("+") or minus ("-") sign and one or two digits (the GMT offset) + + // RetentionPolicy defines the retention policy for retaining and deleting existing backups. + // +kubebuilder:validation:Optional + // +optional + RetentionPolicy RetentionPolicy `json:"retentionPolicy"` + + // PVCName specifies the name of the PersistentVolumeClaim (PVC) which binds a PersistentVolume where the + // etcd backup files would be saved + // The PVC itself must always be created in the "openshift-etcd" namespace + // If the PVC is left unspecified "" then the platform will choose a reasonable default location to save the backup. + // In the future this would be backups saved across the control-plane master nodes. + // +kubebuilder:validation:Optional + // +optional + PVCName string `json:"pvcName"` +} + +// RetentionType is the enumeration of valid retention policy types +// +enum +// +kubebuilder:validation:Enum:="RetentionNumber";"RetentionSize" +type RetentionType string + +const ( + // RetentionTypeNumber sets the retention policy based on the number of backup files saved + RetentionTypeNumber RetentionType = "RetentionNumber" + // RetentionTypeSize sets the retention policy based on the total size of the backup files saved + RetentionTypeSize RetentionType = "RetentionSize" +) + +// RetentionPolicy defines the retention policy for retaining and deleting existing backups. +// This struct is a discriminated union that allows users to select the type of retention policy from the supported types. +// +union +type RetentionPolicy struct { + // RetentionType sets the type of retention policy. + // Currently, the only valid policies are retention by number of backups (RetentionNumber), by the size of backups (RetentionSize). More policies or types may be added in the future. + // Empty string means no opinion and the platform is left to choose a reasonable default which is subject to change without notice. + // The current default is RetentionNumber with 15 backups kept. + // +unionDiscriminator + // +required + // +kubebuilder:validation:Required + // +kubebuilder:validation:Enum:="";"RetentionNumber";"RetentionSize" + RetentionType RetentionType `json:"retentionType"` + + // RetentionNumber configures the retention policy based on the number of backups + // +kubebuilder:validation:Optional + // +optional + RetentionNumber *RetentionNumberConfig `json:"retentionNumber,omitempty"` + + // RetentionSize configures the retention policy based on the size of backups + // +kubebuilder:validation:Optional + // +optional + RetentionSize *RetentionSizeConfig `json:"retentionSize,omitempty"` +} + +// RetentionNumberConfig specifies the configuration of the retention policy on the number of backups +type RetentionNumberConfig struct { + // MaxNumberOfBackups defines the maximum number of backups to retain. + // If the existing number of backups saved is equal to MaxNumberOfBackups then + // the oldest backup will be removed before a new backup is initiated. + // +kubebuilder:validation:Minimum=1 + // +kubebuilder:validation:Required + // +required + MaxNumberOfBackups int `json:"maxNumberOfBackups,omitempty"` +} + +// RetentionSizeConfig specifies the configuration of the retention policy on the total size of backups +type RetentionSizeConfig struct { + // MaxSizeOfBackupsGb defines the total size in GB of backups to retain. + // If the current total size backups exceeds MaxSizeOfBackupsGb then + // the oldest backup will be removed before a new backup is initiated. + // +kubebuilder:validation:Minimum=1 + // +kubebuilder:validation:Required + // +required + MaxSizeOfBackupsGb int `json:"maxSizeOfBackupsGb,omitempty"` +} + +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object + +// BackupList is a collection of items +// +// Compatibility level 4: No compatibility is provided, the API can change at any point for any reason. These capabilities should not be used by applications needing long term support. +// +openshift:compatibility-gen:level=4 +type BackupList struct { + metav1.TypeMeta `json:",inline"` + + // metadata is the standard list's metadata. + // More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata + metav1.ListMeta `json:"metadata"` + Items []Backup `json:"items"` +} diff --git a/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.deepcopy.go b/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.deepcopy.go index 440cfd2e0..8cd8536f3 100644 --- a/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.deepcopy.go +++ b/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.deepcopy.go @@ -9,6 +9,117 @@ import ( runtime "k8s.io/apimachinery/pkg/runtime" ) +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *Backup) DeepCopyInto(out *Backup) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) + in.Spec.DeepCopyInto(&out.Spec) + out.Status = in.Status + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Backup. +func (in *Backup) DeepCopy() *Backup { + if in == nil { + return nil + } + out := new(Backup) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *Backup) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *BackupList) DeepCopyInto(out *BackupList) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) + if in.Items != nil { + in, out := &in.Items, &out.Items + *out = make([]Backup, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new BackupList. +func (in *BackupList) DeepCopy() *BackupList { + if in == nil { + return nil + } + out := new(BackupList) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *BackupList) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *BackupSpec) DeepCopyInto(out *BackupSpec) { + *out = *in + in.EtcdBackupSpec.DeepCopyInto(&out.EtcdBackupSpec) + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new BackupSpec. +func (in *BackupSpec) DeepCopy() *BackupSpec { + if in == nil { + return nil + } + out := new(BackupSpec) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *BackupStatus) DeepCopyInto(out *BackupStatus) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new BackupStatus. +func (in *BackupStatus) DeepCopy() *BackupStatus { + if in == nil { + return nil + } + out := new(BackupStatus) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *EtcdBackupSpec) DeepCopyInto(out *EtcdBackupSpec) { + *out = *in + in.RetentionPolicy.DeepCopyInto(&out.RetentionPolicy) + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new EtcdBackupSpec. +func (in *EtcdBackupSpec) DeepCopy() *EtcdBackupSpec { + if in == nil { + return nil + } + out := new(EtcdBackupSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *GatherConfig) DeepCopyInto(out *GatherConfig) { *out = *in @@ -123,3 +234,61 @@ func (in *InsightsDataGatherStatus) DeepCopy() *InsightsDataGatherStatus { in.DeepCopyInto(out) return out } + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *RetentionNumberConfig) DeepCopyInto(out *RetentionNumberConfig) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new RetentionNumberConfig. +func (in *RetentionNumberConfig) DeepCopy() *RetentionNumberConfig { + if in == nil { + return nil + } + out := new(RetentionNumberConfig) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *RetentionPolicy) DeepCopyInto(out *RetentionPolicy) { + *out = *in + if in.RetentionNumber != nil { + in, out := &in.RetentionNumber, &out.RetentionNumber + *out = new(RetentionNumberConfig) + **out = **in + } + if in.RetentionSize != nil { + in, out := &in.RetentionSize, &out.RetentionSize + *out = new(RetentionSizeConfig) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new RetentionPolicy. +func (in *RetentionPolicy) DeepCopy() *RetentionPolicy { + if in == nil { + return nil + } + out := new(RetentionPolicy) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *RetentionSizeConfig) DeepCopyInto(out *RetentionSizeConfig) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new RetentionSizeConfig. +func (in *RetentionSizeConfig) DeepCopy() *RetentionSizeConfig { + if in == nil { + return nil + } + out := new(RetentionSizeConfig) + in.DeepCopyInto(out) + return out +} diff --git a/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.swagger_doc_generated.go b/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.swagger_doc_generated.go index 6bc6e2522..425c1ec51 100644 --- a/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.swagger_doc_generated.go +++ b/vendor/github.com/openshift/api/config/v1alpha1/zz_generated.swagger_doc_generated.go @@ -11,6 +11,75 @@ package v1alpha1 // Those methods can be generated by using hack/update-swagger-docs.sh // AUTO-GENERATED FUNCTIONS START HERE +var map_Backup = map[string]string{ + "": "\n\nBackup provides configuration for performing backups of the openshift cluster.\n\nCompatibility level 4: No compatibility is provided, the API can change at any point for any reason. These capabilities should not be used by applications needing long term support.", + "metadata": "metadata is the standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + "spec": "spec holds user settable values for configuration", + "status": "status holds observed values from the cluster. They may not be overridden.", +} + +func (Backup) SwaggerDoc() map[string]string { + return map_Backup +} + +var map_BackupList = map[string]string{ + "": "BackupList is a collection of items\n\nCompatibility level 4: No compatibility is provided, the API can change at any point for any reason. These capabilities should not be used by applications needing long term support.", + "metadata": "metadata is the standard list's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", +} + +func (BackupList) SwaggerDoc() map[string]string { + return map_BackupList +} + +var map_BackupSpec = map[string]string{ + "etcd": "etcd specifies the configuration for periodic backups of the etcd cluster", +} + +func (BackupSpec) SwaggerDoc() map[string]string { + return map_BackupSpec +} + +var map_EtcdBackupSpec = map[string]string{ + "": "EtcdBackupSpec provides configuration for automated etcd backups to the cluster-etcd-operator", + "schedule": "Schedule defines the recurring backup schedule in Cron format every 2 hours: 0 */2 * * * every day at 3am: 0 3 * * * Empty string means no opinion and the platform is left to choose a reasonable default which is subject to change without notice. The current default is \"no backups\", but will change in the future.", + "timeZone": "The time zone name for the given schedule, see https://en.wikipedia.org/wiki/List_of_tz_database_time_zones. If not specified, this will default to the time zone of the kube-controller-manager process. See https://kubernetes.io/docs/concepts/workloads/controllers/cron-jobs/#time-zones", + "retentionPolicy": "RetentionPolicy defines the retention policy for retaining and deleting existing backups.", + "pvcName": "PVCName specifies the name of the PersistentVolumeClaim (PVC) which binds a PersistentVolume where the etcd backup files would be saved The PVC itself must always be created in the \"openshift-etcd\" namespace If the PVC is left unspecified \"\" then the platform will choose a reasonable default location to save the backup. In the future this would be backups saved across the control-plane master nodes.", +} + +func (EtcdBackupSpec) SwaggerDoc() map[string]string { + return map_EtcdBackupSpec +} + +var map_RetentionNumberConfig = map[string]string{ + "": "RetentionNumberConfig specifies the configuration of the retention policy on the number of backups", + "maxNumberOfBackups": "MaxNumberOfBackups defines the maximum number of backups to retain. If the existing number of backups saved is equal to MaxNumberOfBackups then the oldest backup will be removed before a new backup is initiated.", +} + +func (RetentionNumberConfig) SwaggerDoc() map[string]string { + return map_RetentionNumberConfig +} + +var map_RetentionPolicy = map[string]string{ + "": "RetentionPolicy defines the retention policy for retaining and deleting existing backups. This struct is a discriminated union that allows users to select the type of retention policy from the supported types.", + "retentionType": "RetentionType sets the type of retention policy. Currently, the only valid policies are retention by number of backups (RetentionNumber), by the size of backups (RetentionSize). More policies or types may be added in the future. Empty string means no opinion and the platform is left to choose a reasonable default which is subject to change without notice. The current default is RetentionNumber with 15 backups kept.", + "retentionNumber": "RetentionNumber configures the retention policy based on the number of backups", + "retentionSize": "RetentionSize configures the retention policy based on the size of backups", +} + +func (RetentionPolicy) SwaggerDoc() map[string]string { + return map_RetentionPolicy +} + +var map_RetentionSizeConfig = map[string]string{ + "": "RetentionSizeConfig specifies the configuration of the retention policy on the total size of backups", + "maxSizeOfBackupsGb": "MaxSizeOfBackupsGb defines the total size in GB of backups to retain. If the current total size backups exceeds MaxSizeOfBackupsGb then the oldest backup will be removed before a new backup is initiated.", +} + +func (RetentionSizeConfig) SwaggerDoc() map[string]string { + return map_RetentionSizeConfig +} + var map_GatherConfig = map[string]string{ "": "gatherConfig provides data gathering configuration options.", "dataPolicy": "dataPolicy allows user to enable additional global obfuscation of the IP addresses and base domain in the Insights archive data. Valid values are \"None\" and \"ObfuscateNetworking\". When set to None the data is not obfuscated. When set to ObfuscateNetworking the IP addresses and the cluster domain name are obfuscated. When omitted, this means no opinion and the platform is left to choose a reasonable default, which is subject to change over time. The current default is None.", diff --git a/vendor/github.com/openshift/api/machine/v1/0000_10_controlplanemachineset.crd.yaml b/vendor/github.com/openshift/api/machine/v1/0000_10_controlplanemachineset.crd.yaml index bdaa49242..00b5311a0 100644 --- a/vendor/github.com/openshift/api/machine/v1/0000_10_controlplanemachineset.crd.yaml +++ b/vendor/github.com/openshift/api/machine/v1/0000_10_controlplanemachineset.crd.yaml @@ -2,6 +2,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: + capability.openshift.io/name: MachineAPI api-approved.openshift.io: https://github.com/openshift/api/pull/1112 exclude.release.openshift.io/internal-openshift-hosted: "true" include.release.openshift.io/self-managed-high-availability: "true" @@ -243,6 +244,39 @@ spec: zone: description: Zone is the zone in which the GCP machine provider will create the VM. type: string + openstack: + description: OpenStack configures failure domain information for the OpenStack platform. + type: array + items: + description: OpenStackFailureDomain configures failure domain information for the OpenStack platform. + type: object + minProperties: 1 + properties: + availabilityZone: + description: 'availabilityZone is the nova availability zone in which the OpenStack machine provider will create the VM. If not specified, the VM will be created in the default availability zone specified in the nova configuration. Availability zone names must NOT contain : since it is used by admin users to specify hosts where instances are launched in server creation. Also, it must not contain spaces otherwise it will lead to node that belongs to this availability zone register failure, see kubernetes/cloud-provider-openstack#1379 for further information. The maximum length of availability zone name is 63 as per labels limits.' + type: string + maxLength: 63 + minLength: 1 + pattern: '^[^: ]*$' + rootVolume: + description: rootVolume contains settings that will be used by the OpenStack machine provider to create the root volume attached to the VM. If not specified, no root volume will be created. + type: object + minProperties: 1 + properties: + availabilityZone: + description: availabilityZone specifies the Cinder availability zone where the root volume will be created. If not specifified, the root volume will be created in the availability zone specified by the volume type in the cinder configuration. If the volume type (configured in the OpenStack cluster) does not specify an availability zone, the root volume will be created in the default availability zone specified in the cinder configuration. See https://docs.openstack.org/cinder/latest/admin/availability-zone-type.html for more details. If the OpenStack cluster is deployed with the cross_az_attach configuration option set to false, the root volume will have to be in the same availability zone as the VM (defined by OpenStackFailureDomain.AvailabilityZone). Availability zone names must NOT contain spaces otherwise it will lead to volume that belongs to this availability zone register failure, see kubernetes/cloud-provider-openstack#1379 for further information. The maximum length of availability zone name is 63 as per labels limits. + type: string + maxLength: 63 + minLength: 1 + pattern: ^[^ ]*$ + volumeType: + description: volumeType specifies the type of the root volume that will be provisioned. If not specifified, the root volume will be created as the type in the machine template. The maximum length of a volume type name is 255 characters, as per the OpenStack limit. + type: string + maxLength: 255 + minLength: 1 + x-kubernetes-validations: + - rule: '!has(self.availabilityZone) || !has(self.rootVolume) || has(self.rootVolume.availabilityZone)' + message: rootVolume.availabilityZone is required when availabilityZone is set platform: description: Platform identifies the platform for which the FailureDomain represents. Currently supported values are AWS, Azure, and GCP. type: string @@ -271,6 +305,8 @@ spec: message: azure configuration is required when platform is Azure, and forbidden otherwise - rule: 'has(self.platform) && self.platform == ''GCP'' ? has(self.gcp) : !has(self.gcp)' message: gcp configuration is required when platform is GCP, and forbidden otherwise + - rule: 'has(self.platform) && self.platform == ''OpenStack'' ? has(self.openstack) : !has(self.openstack)' + message: openstack configuration is required when platform is OpenStack, and forbidden otherwise metadata: description: 'ObjectMeta is the standard object metadata More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata Labels are required to match the ControlPlaneMachineSet selector.' type: object diff --git a/vendor/github.com/openshift/api/machine/v1/stable.controlplanemachineset.openstack.testsuite.yaml b/vendor/github.com/openshift/api/machine/v1/stable.controlplanemachineset.openstack.testsuite.yaml new file mode 100644 index 000000000..e5759f4b0 --- /dev/null +++ b/vendor/github.com/openshift/api/machine/v1/stable.controlplanemachineset.openstack.testsuite.yaml @@ -0,0 +1,601 @@ +apiVersion: apiextensions.k8s.io/v1 # Hack because controller-gen complains if we don't have this +name: "[Stable] ControlPlaneMachineSet" +crd: 0000_10_controlplanemachineset.crd.yaml +tests: + onCreate: + - name: Should reject an OpenStack platform failure domain without any OpenStack config + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains: Invalid value: \"object\": openstack configuration is required when platform is OpenStack" + - name: Should reject an OpenStack configured failure domain without a platform type + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + openstack: + - availabilityZone: foo + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.platform: Required value" + - name: Should reject an OpenStack configured failure domain with an empty OpenStack config + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: {} + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack in body must be of type array: \"object\"" + - name: Should accept no failureDomains + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: "" + expected: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + replicas: 3 + state: Inactive + strategy: + type: RollingUpdate + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: "" + - name: Should reject an OpenStack configured failure domain with the wrong platform type + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: BareMetal + openstack: + - availabilityZone: foo + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains: Invalid value: \"object\": openstack configuration is required when platform is OpenStack, and forbidden otherwise" + - name: Should accept an OpenStack failure domain with only the availabilityZone provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + expected: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + replicas: 3 + state: Inactive + strategy: + type: RollingUpdate + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + - name: Should accept an OpenStack failure domain with only the rootVolume provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - rootVolume: + availabilityZone: foo + expected: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + replicas: 3 + state: Inactive + strategy: + type: RollingUpdate + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - rootVolume: + availabilityZone: foo + - name: Should accept an OpenStack failure domain with only the root volume type provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - rootVolume: + volumeType: typeone + expected: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + replicas: 3 + state: Inactive + strategy: + type: RollingUpdate + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - rootVolume: + volumeType: typeone + - name: Should accept an OpenStack failure domain with both availabilityZone and rootVolume provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: + availabilityZone: foo + expected: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + replicas: 3 + state: Inactive + strategy: + type: RollingUpdate + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: + availabilityZone: foo + - name: Should accept an OpenStack failure domain with both availabilityZone and root volume type provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: + availabilityZone: foo + volumeType: bar + expected: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + replicas: 3 + state: Inactive + strategy: + type: RollingUpdate + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: + availabilityZone: foo + volumeType: bar + - name: Should reject an OpenStack failure domain with too long a rootVolume volumeType name + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: + volumeType: a123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345 + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0].rootVolume.volumeType: Too long: may not be longer than 255" + - name: Should reject an OpenStack failure domain with an empty rootVolume provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: {} + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0].rootVolume in body should have at least 1 properties" + - name: Should reject an OpenStack failure domain with both availabilityZone and root volume provided but with missing root volume availabilityZone + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + rootVolume: + volumeType: bar + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0]: Invalid value: \"object\": rootVolume.availabilityZone is required when availabilityZone is set" + - name: Should reject an empty OpenStack failure domain + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo + - {} + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[1] in body should have at least 1 properties" + - name: Should reject an OpenStack failure domain with an empty availabilityZone provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: "" + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0].availabilityZone in body should be at least 1 chars long" + - name: Should reject an OpenStack failure domain with an empty rootVolume availabilityZone provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - rootVolume: + availabilityZone: "" + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0].rootVolume.availabilityZone in body should be at least 1 chars long" + - name: Should reject an OpenStack failure domain with an invalid availabilityZone provided + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - availabilityZone: foo:bar + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0].availabilityZone in body should match" + - name: Should reject an OpenStack failure domain with an invalid availabilityZone provided for rootVolume + initial: | + apiVersion: machine.openshift.io/v1 + kind: ControlPlaneMachineSet + spec: + selector: + matchLabels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + template: + machineType: machines_v1beta1_machine_openshift_io + machines_v1beta1_machine_openshift_io: + metadata: + labels: + machine.openshift.io/cluster-api-machine-role: master + machine.openshift.io/cluster-api-machine-type: master + machine.openshift.io/cluster-api-cluster: cluster + spec: + providerSpec: {} + failureDomains: + platform: OpenStack + openstack: + - rootVolume: + availabilityZone: "foo bar" + expectedError: "spec.template.machines_v1beta1_machine_openshift_io.failureDomains.openstack[0].rootVolume.availabilityZone in body should match" diff --git a/vendor/github.com/openshift/api/machine/v1/types_controlplanemachineset.go b/vendor/github.com/openshift/api/machine/v1/types_controlplanemachineset.go index 91fa896e2..b31e0e548 100644 --- a/vendor/github.com/openshift/api/machine/v1/types_controlplanemachineset.go +++ b/vendor/github.com/openshift/api/machine/v1/types_controlplanemachineset.go @@ -230,6 +230,7 @@ const ( // +kubebuilder:validation:XValidation:rule="has(self.platform) && self.platform == 'AWS' ? has(self.aws) : !has(self.aws)",message="aws configuration is required when platform is AWS, and forbidden otherwise" // +kubebuilder:validation:XValidation:rule="has(self.platform) && self.platform == 'Azure' ? has(self.azure) : !has(self.azure)",message="azure configuration is required when platform is Azure, and forbidden otherwise" // +kubebuilder:validation:XValidation:rule="has(self.platform) && self.platform == 'GCP' ? has(self.gcp) : !has(self.gcp)",message="gcp configuration is required when platform is GCP, and forbidden otherwise" +// +kubebuilder:validation:XValidation:rule="has(self.platform) && self.platform == 'OpenStack' ? has(self.openstack) : !has(self.openstack)",message="openstack configuration is required when platform is OpenStack, and forbidden otherwise" type FailureDomains struct { // Platform identifies the platform for which the FailureDomain represents. // Currently supported values are AWS, Azure, and GCP. @@ -248,6 +249,17 @@ type FailureDomains struct { // GCP configures failure domain information for the GCP platform. // +optional GCP *[]GCPFailureDomain `json:"gcp,omitempty"` + + // OpenStack configures failure domain information for the OpenStack platform. + // +optional + // + // + --- + // + Unlike other platforms, OpenStack failure domains can be empty. + // + Some OpenStack deployments may not have availability zones or root volumes. + // + Therefore we'll check the length of the list to determine if it's empty instead + // + of nil if it would be a pointer. + // +optional + OpenStack []OpenStackFailureDomain `json:"openstack,omitempty"` } // AWSFailureDomain configures failure domain information for the AWS platform. @@ -284,6 +296,61 @@ type GCPFailureDomain struct { Zone string `json:"zone"` } +// OpenStackFailureDomain configures failure domain information for the OpenStack platform. +// +kubebuilder:validation:MinProperties:=1 +// +kubebuilder:validation:XValidation:rule="!has(self.availabilityZone) || !has(self.rootVolume) || has(self.rootVolume.availabilityZone)",message="rootVolume.availabilityZone is required when availabilityZone is set" +type OpenStackFailureDomain struct { + // availabilityZone is the nova availability zone in which the OpenStack machine provider will create the VM. + // If not specified, the VM will be created in the default availability zone specified in the nova configuration. + // Availability zone names must NOT contain : since it is used by admin users to specify hosts where instances + // are launched in server creation. Also, it must not contain spaces otherwise it will lead to node that belongs + // to this availability zone register failure, see kubernetes/cloud-provider-openstack#1379 for further information. + // The maximum length of availability zone name is 63 as per labels limits. + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:Pattern=`^[^: ]*$` + // +kubebuilder:validation:MaxLength=63 + // +optional + AvailabilityZone string `json:"availabilityZone,omitempty"` + + // rootVolume contains settings that will be used by the OpenStack machine provider to create the root volume attached to the VM. + // If not specified, no root volume will be created. + // + // + --- + // + RootVolume must be a pointer to allow us to require at least one valid property is set within the failure domain. + // + If it were a reference then omitempty doesn't work and the minProperties validations are no longer valid. + // +optional + RootVolume *RootVolume `json:"rootVolume,omitempty"` +} + +// RootVolume represents the volume metadata to boot from. +// The original RootVolume struct is defined in the v1alpha1 but it's not best practice to use it directly here so we define a new one +// that should stay in sync with the original one. +// +kubebuilder:validation:MinProperties:=1 +type RootVolume struct { + // availabilityZone specifies the Cinder availability zone where the root volume will be created. + // If not specifified, the root volume will be created in the availability zone specified by the volume type in the cinder configuration. + // If the volume type (configured in the OpenStack cluster) does not specify an availability zone, the root volume will be created in the default availability + // zone specified in the cinder configuration. See https://docs.openstack.org/cinder/latest/admin/availability-zone-type.html for more details. + // If the OpenStack cluster is deployed with the cross_az_attach configuration option set to false, the root volume will have to be in the same + // availability zone as the VM (defined by OpenStackFailureDomain.AvailabilityZone). + // Availability zone names must NOT contain spaces otherwise it will lead to volume that belongs to this availability zone register failure, + // see kubernetes/cloud-provider-openstack#1379 for further information. + // The maximum length of availability zone name is 63 as per labels limits. + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=63 + // +kubebuilder:validation:Pattern=`^[^ ]*$` + // +optional + AvailabilityZone string `json:"availabilityZone,omitempty"` + + // volumeType specifies the type of the root volume that will be provisioned. + // If not specifified, the root volume will be created as the type in the machine template. + // The maximum length of a volume type name is 255 characters, as per the OpenStack limit. + // +kubebuilder:validation:MinLength=1 + // +kubebuilder:validation:MaxLength=255 + // +optional + VolumeType string `json:"volumeType,omitempty"` +} + // ControlPlaneMachineSetStatus represents the status of the ControlPlaneMachineSet CRD. type ControlPlaneMachineSetStatus struct { // Conditions represents the observations of the ControlPlaneMachineSet's current state. diff --git a/vendor/github.com/openshift/api/machine/v1/zz_generated.deepcopy.go b/vendor/github.com/openshift/api/machine/v1/zz_generated.deepcopy.go index 83c0d21ad..ca3184327 100644 --- a/vendor/github.com/openshift/api/machine/v1/zz_generated.deepcopy.go +++ b/vendor/github.com/openshift/api/machine/v1/zz_generated.deepcopy.go @@ -530,6 +530,13 @@ func (in *FailureDomains) DeepCopyInto(out *FailureDomains) { copy(*out, *in) } } + if in.OpenStack != nil { + in, out := &in.OpenStack, &out.OpenStack + *out = make([]OpenStackFailureDomain, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } return } @@ -726,6 +733,27 @@ func (in *OpenShiftMachineV1Beta1MachineTemplate) DeepCopy() *OpenShiftMachineV1 return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *OpenStackFailureDomain) DeepCopyInto(out *OpenStackFailureDomain) { + *out = *in + if in.RootVolume != nil { + in, out := &in.RootVolume, &out.RootVolume + *out = new(RootVolume) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new OpenStackFailureDomain. +func (in *OpenStackFailureDomain) DeepCopy() *OpenStackFailureDomain { + if in == nil { + return nil + } + out := new(OpenStackFailureDomain) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *PowerVSMachineProviderConfig) DeepCopyInto(out *PowerVSMachineProviderConfig) { *out = *in @@ -865,6 +893,22 @@ func (in *PowerVSSecretReference) DeepCopy() *PowerVSSecretReference { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *RootVolume) DeepCopyInto(out *RootVolume) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new RootVolume. +func (in *RootVolume) DeepCopy() *RootVolume { + if in == nil { + return nil + } + out := new(RootVolume) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *SystemDiskProperties) DeepCopyInto(out *SystemDiskProperties) { *out = *in diff --git a/vendor/github.com/openshift/api/machine/v1/zz_generated.swagger_doc_generated.go b/vendor/github.com/openshift/api/machine/v1/zz_generated.swagger_doc_generated.go index 27d3eb26f..01269a67d 100644 --- a/vendor/github.com/openshift/api/machine/v1/zz_generated.swagger_doc_generated.go +++ b/vendor/github.com/openshift/api/machine/v1/zz_generated.swagger_doc_generated.go @@ -242,11 +242,12 @@ func (ControlPlaneMachineSetTemplateObjectMeta) SwaggerDoc() map[string]string { } var map_FailureDomains = map[string]string{ - "": "FailureDomain represents the different configurations required to spread Machines across failure domains on different platforms.", - "platform": "Platform identifies the platform for which the FailureDomain represents. Currently supported values are AWS, Azure, and GCP.", - "aws": "AWS configures failure domain information for the AWS platform.", - "azure": "Azure configures failure domain information for the Azure platform.", - "gcp": "GCP configures failure domain information for the GCP platform.", + "": "FailureDomain represents the different configurations required to spread Machines across failure domains on different platforms.", + "platform": "Platform identifies the platform for which the FailureDomain represents. Currently supported values are AWS, Azure, and GCP.", + "aws": "AWS configures failure domain information for the AWS platform.", + "azure": "Azure configures failure domain information for the Azure platform.", + "gcp": "GCP configures failure domain information for the GCP platform.", + "openstack": "OpenStack configures failure domain information for the OpenStack platform.", } func (FailureDomains) SwaggerDoc() map[string]string { @@ -273,6 +274,26 @@ func (OpenShiftMachineV1Beta1MachineTemplate) SwaggerDoc() map[string]string { return map_OpenShiftMachineV1Beta1MachineTemplate } +var map_OpenStackFailureDomain = map[string]string{ + "": "OpenStackFailureDomain configures failure domain information for the OpenStack platform.", + "availabilityZone": "availabilityZone is the nova availability zone in which the OpenStack machine provider will create the VM. If not specified, the VM will be created in the default availability zone specified in the nova configuration. Availability zone names must NOT contain : since it is used by admin users to specify hosts where instances are launched in server creation. Also, it must not contain spaces otherwise it will lead to node that belongs to this availability zone register failure, see kubernetes/cloud-provider-openstack#1379 for further information. The maximum length of availability zone name is 63 as per labels limits.", + "rootVolume": "rootVolume contains settings that will be used by the OpenStack machine provider to create the root volume attached to the VM. If not specified, no root volume will be created.", +} + +func (OpenStackFailureDomain) SwaggerDoc() map[string]string { + return map_OpenStackFailureDomain +} + +var map_RootVolume = map[string]string{ + "": "RootVolume represents the volume metadata to boot from. The original RootVolume struct is defined in the v1alpha1 but it's not best practice to use it directly here so we define a new one that should stay in sync with the original one.", + "availabilityZone": "availabilityZone specifies the Cinder availability zone where the root volume will be created. If not specifified, the root volume will be created in the availability zone specified by the volume type in the cinder configuration. If the volume type (configured in the OpenStack cluster) does not specify an availability zone, the root volume will be created in the default availability zone specified in the cinder configuration. See https://docs.openstack.org/cinder/latest/admin/availability-zone-type.html for more details. If the OpenStack cluster is deployed with the cross_az_attach configuration option set to false, the root volume will have to be in the same availability zone as the VM (defined by OpenStackFailureDomain.AvailabilityZone). Availability zone names must NOT contain spaces otherwise it will lead to volume that belongs to this availability zone register failure, see kubernetes/cloud-provider-openstack#1379 for further information. The maximum length of availability zone name is 63 as per labels limits.", + "volumeType": "volumeType specifies the type of the root volume that will be provisioned. If not specifified, the root volume will be created as the type in the machine template. The maximum length of a volume type name is 255 characters, as per the OpenStack limit.", +} + +func (RootVolume) SwaggerDoc() map[string]string { + return map_RootVolume +} + var map_NutanixCategory = map[string]string{ "": "NutanixCategory identifies a pair of prism category key and value", "key": "key is the prism category key name", diff --git a/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machine.crd.yaml b/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machine.crd.yaml index d11c3c72b..6de9c06b2 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machine.crd.yaml +++ b/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machine.crd.yaml @@ -2,6 +2,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: + capability.openshift.io/name: MachineAPI api-approved.openshift.io: https://github.com/openshift/api/pull/948 exclude.release.openshift.io/internal-openshift-hosted: "true" include.release.openshift.io/self-managed-high-availability: "true" diff --git a/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machinehealthcheck.yaml b/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machinehealthcheck.yaml index f15c6f044..614b7a724 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machinehealthcheck.yaml +++ b/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machinehealthcheck.yaml @@ -2,6 +2,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: + capability.openshift.io/name: MachineAPI exclude.release.openshift.io/internal-openshift-hosted: "true" include.release.openshift.io/self-managed-high-availability: "true" include.release.openshift.io/single-node-developer: "true" diff --git a/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machineset.crd.yaml b/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machineset.crd.yaml index c4bcfef24..2145f033f 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machineset.crd.yaml +++ b/vendor/github.com/openshift/api/machine/v1beta1/0000_10_machineset.crd.yaml @@ -2,6 +2,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: + capability.openshift.io/name: MachineAPI api-approved.openshift.io: https://github.com/openshift/api/pull/1032 exclude.release.openshift.io/internal-openshift-hosted: "true" include.release.openshift.io/self-managed-high-availability: "true" diff --git a/vendor/github.com/openshift/api/machine/v1beta1/types_awsprovider.go b/vendor/github.com/openshift/api/machine/v1beta1/types_awsprovider.go index e2eec1a6a..f3853579b 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/types_awsprovider.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/types_awsprovider.go @@ -79,6 +79,11 @@ type AWSMachineProviderConfig struct { // https://docs.aws.amazon.com/AWSEC2/latest/APIReference/API_InstanceMetadataOptionsRequest.html // +optional MetadataServiceOptions MetadataServiceOptions `json:"metadataServiceOptions,omitempty"` + // PlacementGroupName specifies the name of the placement group in which to launch the instance. + // The placement group must already be created and may use any placement strategy. + // When omitted, no placement group is used when creating the EC2 instance. + // +optional + PlacementGroupName string `json:"placementGroupName,omitempty"` } // BlockDeviceMappingSpec describes a block device mapping diff --git a/vendor/github.com/openshift/api/machine/v1beta1/types_azureprovider.go b/vendor/github.com/openshift/api/machine/v1beta1/types_azureprovider.go index 547da1af7..1d565e5d2 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/types_azureprovider.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/types_azureprovider.go @@ -6,6 +6,28 @@ import ( metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" ) +// SecurityEncryptionTypes represents the Encryption Type when the Azure Virtual Machine is a +// Confidential VM. +type SecurityEncryptionTypes string + +const ( + // SecurityEncryptionTypesVMGuestStateOnly disables OS disk confidential encryption. + SecurityEncryptionTypesVMGuestStateOnly SecurityEncryptionTypes = "VMGuestStateOnly" + // SecurityEncryptionTypesDiskWithVMGuestState enables OS disk confidential encryption with a + // platform-managed key (PMK) or a customer-managed key (CMK). + SecurityEncryptionTypesDiskWithVMGuestState SecurityEncryptionTypes = "DiskWithVMGuestState" +) + +// SecurityTypes represents the SecurityType of the virtual machine. +type SecurityTypes string + +const ( + // SecurityTypesConfidentialVM defines the SecurityType of the virtual machine as a Confidential VM. + SecurityTypesConfidentialVM SecurityTypes = "ConfidentialVM" + // SecurityTypesTrustedLaunch defines the SecurityType of the virtual machine as a Trusted Launch VM. + SecurityTypesTrustedLaunch SecurityTypes = "TrustedLaunch" +) + // AzureMachineProviderSpec is the type that will be embedded in a Machine.Spec.ProviderSpec field // for an Azure virtual machine. It is used by the Azure machine actuator to create a single Machine. // Required parameters such as location that are not specified by this configuration, will be defaulted @@ -397,6 +419,36 @@ type OSDiskManagedDiskParameters struct { // DiskEncryptionSet is the disk encryption set properties // +optional DiskEncryptionSet *DiskEncryptionSetParameters `json:"diskEncryptionSet,omitempty"` + // securityProfile specifies the security profile for the managed disk. + // +optional + SecurityProfile VMDiskSecurityProfile `json:"securityProfile,omitempty"` +} + +// VMDiskSecurityProfile specifies the security profile settings for the managed disk. +// It can be set only for Confidential VMs. +type VMDiskSecurityProfile struct { + // diskEncryptionSet specifies the customer managed disk encryption set resource id for the + // managed disk that is used for Customer Managed Key encrypted ConfidentialVM OS Disk and + // VMGuest blob. + // +optional + DiskEncryptionSet DiskEncryptionSetParameters `json:"diskEncryptionSet,omitempty"` + // securityEncryptionType specifies the encryption type of the managed disk. + // It is set to DiskWithVMGuestState to encrypt the managed disk along with the VMGuestState + // blob, and to VMGuestStateOnly to encrypt the VMGuestState blob only. + // When set to VMGuestStateOnly, the vTPM should be enabled. + // When set to DiskWithVMGuestState, both SecureBoot and vTPM should be enabled. + // If the above conditions are not fulfilled, the VM will not be created and the respective error + // will be returned. + // It can be set only for Confidential VMs. Confidential VMs are defined by their + // SecurityProfile.SecurityType being set to ConfidentialVM, the SecurityEncryptionType of their + // OS disk being set to one of the allowed values and by enabling the respective + // SecurityProfile.UEFISettings of the VM (i.e. vTPM and SecureBoot), depending on the selected + // SecurityEncryptionType. + // For further details on Azure Confidential VMs, please refer to the respective documentation: + // https://learn.microsoft.com/azure/confidential-computing/confidential-vm-overview + // +kubebuilder:validation:Enum=VMGuestStateOnly;DiskWithVMGuestState + // +optional + SecurityEncryptionType SecurityEncryptionTypes `json:"securityEncryptionType,omitempty"` } // DataDiskManagedDiskParameters is the parameters of a DataDisk managed disk. @@ -437,11 +489,71 @@ type DiskEncryptionSetParameters struct { // SecurityProfile specifies the Security profile settings for a // virtual machine or virtual machine scale set. type SecurityProfile struct { - // This field indicates whether Host Encryption should be enabled - // or disabled for a virtual machine or virtual machine scale - // set. Default is disabled. + // encryptionAtHost indicates whether Host Encryption should be enabled or disabled for a virtual + // machine or virtual machine scale set. + // This should be disabled when SecurityEncryptionType is set to DiskWithVMGuestState. + // Default is disabled. // +optional EncryptionAtHost *bool `json:"encryptionAtHost,omitempty"` + // settings specify the security type and the UEFI settings of the virtual machine. This field can + // be set for Confidential VMs and Trusted Launch for VMs. + // +optional + Settings SecuritySettings `json:"settings,omitempty"` +} + +// SecuritySettings define the security type and the UEFI settings of the virtual machine. +// +union +type SecuritySettings struct { + // securityType specifies the SecurityType of the virtual machine. It has to be set to any specified value to + // enable UEFISettings. The default behavior is: UEFISettings will not be enabled unless this property is set. + // +kubebuilder:validation:Enum=ConfidentialVM;TrustedLaunch + // +kubebuilder:validation:Required + // +unionDiscriminator + SecurityType SecurityTypes `json:"securityType,omitempty"` + // confidentialVM specifies the security configuration of the virtual machine. + // For more information regarding Confidential VMs, please refer to: + // https://learn.microsoft.com/azure/confidential-computing/confidential-vm-overview + // +optional + ConfidentialVM *ConfidentialVM `json:"confidentialVM,omitempty"` + // trustedLaunch specifies the security configuration of the virtual machine. + // For more information regarding TrustedLaunch for VMs, please refer to: + // https://learn.microsoft.com/azure/virtual-machines/trusted-launch + // +optional + TrustedLaunch *TrustedLaunch `json:"trustedLaunch,omitempty"` +} + +// ConfidentialVM defines the UEFI settings for the virtual machine. +type ConfidentialVM struct { + // uefiSettings specifies the security settings like secure boot and vTPM used while creating the virtual machine. + // +kubebuilder:validation:Required + UEFISettings UEFISettings `json:"uefiSettings,omitempty"` +} + +// TrustedLaunch defines the UEFI settings for the virtual machine. +type TrustedLaunch struct { + // uefiSettings specifies the security settings like secure boot and vTPM used while creating the virtual machine. + // +kubebuilder:validation:Required + UEFISettings UEFISettings `json:"uefiSettings,omitempty"` +} + +// UEFISettings specifies the security settings like secure boot and vTPM used while creating the +// virtual machine. +type UEFISettings struct { + // secureBoot specifies whether secure boot should be enabled on the virtual machine. + // Secure Boot verifies the digital signature of all boot components and halts the boot process if + // signature verification fails. + // If omitted, the platform chooses a default, which is subject to change over time, currently that default is disabled. + // +kubebuilder:validation:Enum=Enabled;Disabled + // +optional + SecureBoot SecureBootPolicy `json:"secureBoot,omitempty"` + // virtualizedTrustedPlatformModule specifies whether vTPM should be enabled on the virtual machine. + // When enabled the virtualized trusted platform module measurements are used to create a known good boot integrity policy baseline. + // The integrity policy baseline is used for comparison with measurements from subsequent VM boots to determine if anything has changed. + // This is required to be enabled if SecurityEncryptionType is defined. + // If omitted, the platform chooses a default, which is subject to change over time, currently that default is disabled. + // +kubebuilder:validation:Enum=Enabled;Disabled + // +optional + VirtualizedTrustedPlatformModule VirtualizedTrustedPlatformModulePolicy `json:"virtualizedTrustedPlatformModule,omitempty"` } // AzureUltraSSDCapabilityState defines the different states of an UltraSSDCapability diff --git a/vendor/github.com/openshift/api/machine/v1beta1/types_machine.go b/vendor/github.com/openshift/api/machine/v1beta1/types_machine.go index f294d1f6c..3f4b12893 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/types_machine.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/types_machine.go @@ -19,6 +19,11 @@ const ( // MachineClusterIDLabel is the label that a machine must have to identify the // cluster to which it belongs. MachineClusterIDLabel = "machine.openshift.io/cluster-api-cluster" + + // IPClaimProtectionFinalizer is placed on an IPAddressClaim by the machine reconciler + // when an IPAddressClaim associated with a machine is created. This finalizer is removed + // from the IPAddressClaim when the associated machine is deleted. + IPClaimProtectionFinalizer = "machine.openshift.io/ip-claim-protection" ) type MachineStatusError string @@ -89,6 +94,9 @@ const ( // not result in a Node joining the cluster within a given timeout // and that are managed by a MachineSet JoinClusterTimeoutMachineError = "JoinClusterTimeoutError" + + // IPAddressInvalidReason is set to indicate that the claimed IP address is not valid. + IPAddressInvalidReason MachineStatusError = "IPAddressInvalid" ) type ClusterStatusError string diff --git a/vendor/github.com/openshift/api/machine/v1beta1/types_provider.go b/vendor/github.com/openshift/api/machine/v1beta1/types_provider.go index 69a5bd07e..2d9bc4853 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/types_provider.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/types_provider.go @@ -153,6 +153,8 @@ const ( // MachineTerminable is set on a machine to indicate whether or not the machine can be terminated, or, whether some // deletion hook is blocking the termination operation. MachineTerminable ConditionType = "Terminable" + // IPAddressClaimedCondition is set to indicate that a machine has a claimed an IP address. + IPAddressClaimedCondition ConditionType = "IPAddressClaimed" ) const ( @@ -180,6 +182,9 @@ const ( // MachineDrainError indicates an error occurred when draining the machine. // This should be used with the `Drained` condition type. MachineDrainError = "DrainError" + // WaitingForIPAddressReason is set to indicate that a machine is + // currently waiting for an IP address to be provisioned. + WaitingForIPAddressReason string = "WaitingForIPAddress" ) // Condition defines an observation of a Machine API resource operational state. diff --git a/vendor/github.com/openshift/api/machine/v1beta1/types_vsphereprovider.go b/vendor/github.com/openshift/api/machine/v1beta1/types_vsphereprovider.go index c1ba1af01..27245c8a4 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/types_vsphereprovider.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/types_vsphereprovider.go @@ -87,12 +87,83 @@ type NetworkSpec struct { Devices []NetworkDeviceSpec `json:"devices"` } +// AddressesFromPool is an IPAddressPool that will be used to create +// IPAddressClaims for fulfillment by an external controller. +type AddressesFromPool struct { + // group of the IP address pool type known to an external IPAM controller. + // This should be a fully qualified domain name, for example, externalipam.controller.io. + // +kubebuilder:example=externalipam.controller.io + // +kubebuilder:validation:Pattern:="^$|^[a-z0-9]([-a-z0-9]*[a-z0-9])?(.[a-z0-9]([-a-z0-9]*[a-z0-9])?)*$" + // +kubebuilder:validation:Required + Group string `json:"group"` + // resource of the IP address pool type known to an external IPAM controller. + // It is normally the plural form of the resource kind in lowercase, for example, + // ippools. + // +kubebuilder:example=ippools + // +kubebuilder:validation:Pattern:="^[a-z0-9]([-a-z0-9]*[a-z0-9])?$" + // +kubebuilder:validation:Required + Resource string `json:"resource"` + // name of an IP address pool, for example, pool-config-1. + // +kubebuilder:example=pool-config-1 + // +kubebuilder:validation:Pattern:="^[a-z0-9]([-a-z0-9]*[a-z0-9])?$" + // +kubebuilder:validation:Required + Name string `json:"name"` +} + // NetworkDeviceSpec defines the network configuration for a virtual machine's // network device. type NetworkDeviceSpec struct { - // NetworkName is the name of the vSphere network to which the device - // will be connected. - NetworkName string `json:"networkName"` + // networkName is the name of the vSphere network or port group to which the network + // device will be connected, for example, port-group-1. When not provided, the vCenter + // API will attempt to select a default network. + // The available networks (port groups) can be listed using `govc ls 'network/*'` + // +kubebuilder:example=port-group-1 + // +kubebuilder:validation:MaxLength=80 + // +optional + NetworkName string `json:"networkName,omitempty"` + + // gateway is an IPv4 or IPv6 address which represents the subnet gateway, + // for example, 192.168.1.1. + // +kubebuilder:validation:Format=ipv4 + // +kubebuilder:validation:Format=ipv6 + // +kubebuilder:example=192.168.1.1 + // +kubebuilder:example=2001:DB8:0000:0000:244:17FF:FEB6:D37D + // +optional + Gateway string `json:"gateway,omitempty"` + + // ipAddrs is a list of one or more IPv4 and/or IPv6 addresses and CIDR to assign to + // this device, for example, 192.168.1.100/24. IP addresses provided via ipAddrs are + // intended to allow explicit assignment of a machine's IP address. IP pool configurations + // provided via addressesFromPool, however, defer IP address assignment to an external controller. + // If both addressesFromPool and ipAddrs are empty or not defined, DHCP will be used to assign + // an IP address. If both ipAddrs and addressesFromPools are defined, the IP addresses associated with + // ipAddrs will be applied first followed by IP addresses from addressesFromPools. + // +kubebuilder:validation:Format=ipv4 + // +kubebuilder:validation:Format=ipv6 + // +kubebuilder:example=192.168.1.100/24 + // +kubebuilder:example=2001:DB8:0000:0000:244:17FF:FEB6:D37D/64 + // +optional + IPAddrs []string `json:"ipAddrs,omitempty"` + + // nameservers is a list of IPv4 and/or IPv6 addresses used as DNS nameservers, for example, + // 8.8.8.8. a nameserver is not provided by a fulfilled IPAddressClaim. If DHCP is not the + // source of IP addresses for this network device, nameservers should include a valid nameserver. + // +kubebuilder:validation:Format=ipv4 + // +kubebuilder:validation:Format=ipv6 + // +kubebuilder:example=8.8.8.8 + // +optional + Nameservers []string `json:"nameservers,omitempty"` + + // addressesFromPools is a list of references to IP pool types and instances which are handled + // by an external controller. addressesFromPool configurations provided via addressesFromPools + // defer IP address assignment to an external controller. IP addresses provided via ipAddrs, + // however, are intended to allow explicit assignment of a machine's IP address. If both + // addressesFromPool and ipAddrs are empty or not defined, DHCP will assign an IP address. + // If both ipAddrs and addressesFromPools are defined, the IP addresses associated with + // ipAddrs will be applied first followed by IP addresses from addressesFromPools. + // +kubebuilder:validation:Format=ipv4 + // +optional + AddressesFromPools []AddressesFromPool `json:"addressesFromPools,omitempty"` } // WorkspaceConfig defines a workspace configuration for the vSphere cloud diff --git a/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.deepcopy.go b/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.deepcopy.go index e1b4c33f4..4cca127cb 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.deepcopy.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.deepcopy.go @@ -188,6 +188,22 @@ func (in *AWSResourceReference) DeepCopy() *AWSResourceReference { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *AddressesFromPool) DeepCopyInto(out *AddressesFromPool) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AddressesFromPool. +func (in *AddressesFromPool) DeepCopy() *AddressesFromPool { + if in == nil { + return nil + } + out := new(AddressesFromPool) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *AzureBootDiagnostics) DeepCopyInto(out *AzureBootDiagnostics) { *out = *in @@ -434,6 +450,23 @@ func (in Conditions) DeepCopy() Conditions { return *out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ConfidentialVM) DeepCopyInto(out *ConfidentialVM) { + *out = *in + out.UEFISettings = in.UEFISettings + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ConfidentialVM. +func (in *ConfidentialVM) DeepCopy() *ConfidentialVM { + if in == nil { + return nil + } + out := new(ConfidentialVM) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *DataDisk) DeepCopyInto(out *DataDisk) { *out = *in @@ -1397,6 +1430,21 @@ func (in *MetadataServiceOptions) DeepCopy() *MetadataServiceOptions { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *NetworkDeviceSpec) DeepCopyInto(out *NetworkDeviceSpec) { *out = *in + if in.IPAddrs != nil { + in, out := &in.IPAddrs, &out.IPAddrs + *out = make([]string, len(*in)) + copy(*out, *in) + } + if in.Nameservers != nil { + in, out := &in.Nameservers, &out.Nameservers + *out = make([]string, len(*in)) + copy(*out, *in) + } + if in.AddressesFromPools != nil { + in, out := &in.AddressesFromPools, &out.AddressesFromPools + *out = make([]AddressesFromPool, len(*in)) + copy(*out, *in) + } return } @@ -1416,7 +1464,9 @@ func (in *NetworkSpec) DeepCopyInto(out *NetworkSpec) { if in.Devices != nil { in, out := &in.Devices, &out.Devices *out = make([]NetworkDeviceSpec, len(*in)) - copy(*out, *in) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } } return } @@ -1457,6 +1507,7 @@ func (in *OSDiskManagedDiskParameters) DeepCopyInto(out *OSDiskManagedDiskParame *out = new(DiskEncryptionSetParameters) **out = **in } + out.SecurityProfile = in.SecurityProfile return } @@ -1552,6 +1603,7 @@ func (in *SecurityProfile) DeepCopyInto(out *SecurityProfile) { *out = new(bool) **out = **in } + in.Settings.DeepCopyInto(&out.Settings) return } @@ -1565,6 +1617,32 @@ func (in *SecurityProfile) DeepCopy() *SecurityProfile { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *SecuritySettings) DeepCopyInto(out *SecuritySettings) { + *out = *in + if in.ConfidentialVM != nil { + in, out := &in.ConfidentialVM, &out.ConfidentialVM + *out = new(ConfidentialVM) + **out = **in + } + if in.TrustedLaunch != nil { + in, out := &in.TrustedLaunch, &out.TrustedLaunch + *out = new(TrustedLaunch) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new SecuritySettings. +func (in *SecuritySettings) DeepCopy() *SecuritySettings { + if in == nil { + return nil + } + out := new(SecuritySettings) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *SpotMarketOptions) DeepCopyInto(out *SpotMarketOptions) { *out = *in @@ -1623,6 +1701,39 @@ func (in *TagSpecification) DeepCopy() *TagSpecification { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *TrustedLaunch) DeepCopyInto(out *TrustedLaunch) { + *out = *in + out.UEFISettings = in.UEFISettings + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TrustedLaunch. +func (in *TrustedLaunch) DeepCopy() *TrustedLaunch { + if in == nil { + return nil + } + out := new(TrustedLaunch) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *UEFISettings) DeepCopyInto(out *UEFISettings) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new UEFISettings. +func (in *UEFISettings) DeepCopy() *UEFISettings { + if in == nil { + return nil + } + out := new(UEFISettings) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *UnhealthyCondition) DeepCopyInto(out *UnhealthyCondition) { *out = *in @@ -1640,6 +1751,23 @@ func (in *UnhealthyCondition) DeepCopy() *UnhealthyCondition { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *VMDiskSecurityProfile) DeepCopyInto(out *VMDiskSecurityProfile) { + *out = *in + out.DiskEncryptionSet = in.DiskEncryptionSet + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new VMDiskSecurityProfile. +func (in *VMDiskSecurityProfile) DeepCopy() *VMDiskSecurityProfile { + if in == nil { + return nil + } + out := new(VMDiskSecurityProfile) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *VSphereMachineProviderSpec) DeepCopyInto(out *VSphereMachineProviderSpec) { *out = *in diff --git a/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.swagger_doc_generated.go b/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.swagger_doc_generated.go index fa1a451da..108ba557c 100644 --- a/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.swagger_doc_generated.go +++ b/vendor/github.com/openshift/api/machine/v1beta1/zz_generated.swagger_doc_generated.go @@ -30,6 +30,7 @@ var map_AWSMachineProviderConfig = map[string]string{ "blockDevices": "BlockDevices is the set of block device mapping associated to this instance, block device without a name will be used as a root device and only one device without a name is allowed https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/block-device-mapping-concepts.html", "spotMarketOptions": "SpotMarketOptions allows users to configure instances to be run using AWS Spot instances.", "metadataServiceOptions": "MetadataServiceOptions allows users to configure instance metadata service interaction options. If nothing specified, default AWS IMDS settings will be applied. https://docs.aws.amazon.com/AWSEC2/latest/APIReference/API_InstanceMetadataOptionsRequest.html", + "placementGroupName": "PlacementGroupName specifies the name of the placement group in which to launch the instance. The placement group must already be created and may use any placement strategy. When omitted, no placement group is used when creating the EC2 instance.", } func (AWSMachineProviderConfig) SwaggerDoc() map[string]string { @@ -223,6 +224,15 @@ func (AzureMachineProviderStatus) SwaggerDoc() map[string]string { return map_AzureMachineProviderStatus } +var map_ConfidentialVM = map[string]string{ + "": "ConfidentialVM defines the UEFI settings for the virtual machine.", + "uefiSettings": "uefiSettings specifies the security settings like secure boot and vTPM used while creating the virtual machine.", +} + +func (ConfidentialVM) SwaggerDoc() map[string]string { + return map_ConfidentialVM +} + var map_DataDisk = map[string]string{ "": "DataDisk specifies the parameters that are used to add one or more data disks to the machine. A Data Disk is a managed disk that's attached to a virtual machine to store application data. It differs from an OS Disk as it doesn't come with a pre-installed OS, and it cannot contain the boot volume. It is registered as SCSI drive and labeled with the chosen `lun`. e.g. for `lun: 0` the raw disk device will be available at `/dev/disk/azure/scsi1/lun0`.\n\nAs the Data Disk disk device is attached raw to the virtual machine, it will need to be partitioned, formatted with a filesystem and mounted, in order for it to be usable. This can be done by creating a custom userdata Secret with custom Ignition configuration to achieve the desired initialization. At this stage the previously defined `lun` is to be used as the \"device\" key for referencing the raw disk device to be initialized. Once the custom userdata Secret has been created, it can be referenced in the Machine's `.providerSpec.userDataSecret`. For further guidance and examples, please refer to the official OpenShift docs.", "nameSuffix": "NameSuffix is the suffix to be appended to the machine name to generate the disk name. Each disk name will be in format _. NameSuffix name must start and finish with an alphanumeric character and can only contain letters, numbers, underscores, periods or hyphens. The overall disk name must not exceed 80 chars in length.", @@ -295,6 +305,7 @@ var map_OSDiskManagedDiskParameters = map[string]string{ "": "OSDiskManagedDiskParameters is the parameters of a OSDisk managed disk.", "storageAccountType": "StorageAccountType is the storage account type to use. Possible values include \"Standard_LRS\", \"Premium_LRS\".", "diskEncryptionSet": "DiskEncryptionSet is the disk encryption set properties", + "securityProfile": "securityProfile specifies the security profile for the managed disk.", } func (OSDiskManagedDiskParameters) SwaggerDoc() map[string]string { @@ -303,13 +314,25 @@ func (OSDiskManagedDiskParameters) SwaggerDoc() map[string]string { var map_SecurityProfile = map[string]string{ "": "SecurityProfile specifies the Security profile settings for a virtual machine or virtual machine scale set.", - "encryptionAtHost": "This field indicates whether Host Encryption should be enabled or disabled for a virtual machine or virtual machine scale set. Default is disabled.", + "encryptionAtHost": "encryptionAtHost indicates whether Host Encryption should be enabled or disabled for a virtual machine or virtual machine scale set. This should be disabled when SecurityEncryptionType is set to DiskWithVMGuestState. Default is disabled.", + "settings": "settings specify the security type and the UEFI settings of the virtual machine. This field can be set for Confidential VMs and Trusted Launch for VMs.", } func (SecurityProfile) SwaggerDoc() map[string]string { return map_SecurityProfile } +var map_SecuritySettings = map[string]string{ + "": "SecuritySettings define the security type and the UEFI settings of the virtual machine.", + "securityType": "securityType specifies the SecurityType of the virtual machine. It has to be set to any specified value to enable UEFISettings. The default behavior is: UEFISettings will not be enabled unless this property is set.", + "confidentialVM": "confidentialVM specifies the security configuration of the virtual machine. For more information regarding Confidential VMs, please refer to: https://learn.microsoft.com/azure/confidential-computing/confidential-vm-overview", + "trustedLaunch": "trustedLaunch specifies the security configuration of the virtual machine. For more information regarding TrustedLaunch for VMs, please refer to: https://learn.microsoft.com/azure/virtual-machines/trusted-launch", +} + +func (SecuritySettings) SwaggerDoc() map[string]string { + return map_SecuritySettings +} + var map_SpotVMOptions = map[string]string{ "": "SpotVMOptions defines the options relevant to running the Machine on Spot VMs", "maxPrice": "MaxPrice defines the maximum price the user is willing to pay for Spot VM instances", @@ -319,6 +342,35 @@ func (SpotVMOptions) SwaggerDoc() map[string]string { return map_SpotVMOptions } +var map_TrustedLaunch = map[string]string{ + "": "TrustedLaunch defines the UEFI settings for the virtual machine.", + "uefiSettings": "uefiSettings specifies the security settings like secure boot and vTPM used while creating the virtual machine.", +} + +func (TrustedLaunch) SwaggerDoc() map[string]string { + return map_TrustedLaunch +} + +var map_UEFISettings = map[string]string{ + "": "UEFISettings specifies the security settings like secure boot and vTPM used while creating the virtual machine.", + "secureBoot": "secureBoot specifies whether secure boot should be enabled on the virtual machine. Secure Boot verifies the digital signature of all boot components and halts the boot process if signature verification fails. If omitted, the platform chooses a default, which is subject to change over time, currently that default is disabled.", + "virtualizedTrustedPlatformModule": "virtualizedTrustedPlatformModule specifies whether vTPM should be enabled on the virtual machine. When enabled the virtualized trusted platform module measurements are used to create a known good boot integrity policy baseline. The integrity policy baseline is used for comparison with measurements from subsequent VM boots to determine if anything has changed. This is required to be enabled if SecurityEncryptionType is defined. If omitted, the platform chooses a default, which is subject to change over time, currently that default is disabled.", +} + +func (UEFISettings) SwaggerDoc() map[string]string { + return map_UEFISettings +} + +var map_VMDiskSecurityProfile = map[string]string{ + "": "VMDiskSecurityProfile specifies the security profile settings for the managed disk. It can be set only for Confidential VMs.", + "diskEncryptionSet": "diskEncryptionSet specifies the customer managed disk encryption set resource id for the managed disk that is used for Customer Managed Key encrypted ConfidentialVM OS Disk and VMGuest blob.", + "securityEncryptionType": "securityEncryptionType specifies the encryption type of the managed disk. It is set to DiskWithVMGuestState to encrypt the managed disk along with the VMGuestState blob, and to VMGuestStateOnly to encrypt the VMGuestState blob only. When set to VMGuestStateOnly, the vTPM should be enabled. When set to DiskWithVMGuestState, both SecureBoot and vTPM should be enabled. If the above conditions are not fulfilled, the VM will not be created and the respective error will be returned. It can be set only for Confidential VMs. Confidential VMs are defined by their SecurityProfile.SecurityType being set to ConfidentialVM, the SecurityEncryptionType of their OS disk being set to one of the allowed values and by enabling the respective SecurityProfile.UEFISettings of the VM (i.e. vTPM and SecureBoot), depending on the selected SecurityEncryptionType. For further details on Azure Confidential VMs, please refer to the respective documentation: https://learn.microsoft.com/azure/confidential-computing/confidential-vm-overview", +} + +func (VMDiskSecurityProfile) SwaggerDoc() map[string]string { + return map_VMDiskSecurityProfile +} + var map_GCPDisk = map[string]string{ "": "GCPDisk describes disks for GCP.", "autoDelete": "AutoDelete indicates if the disk will be auto-deleted when the instance is deleted (default false).", @@ -676,9 +728,24 @@ func (ProviderSpec) SwaggerDoc() map[string]string { return map_ProviderSpec } +var map_AddressesFromPool = map[string]string{ + "": "AddressesFromPool is an IPAddressPool that will be used to create IPAddressClaims for fulfillment by an external controller.", + "group": "group of the IP address pool type known to an external IPAM controller. This should be a fully qualified domain name, for example, externalipam.controller.io.", + "resource": "resource of the IP address pool type known to an external IPAM controller. It is normally the plural form of the resource kind in lowercase, for example, ippools.", + "name": "name of an IP address pool, for example, pool-config-1.", +} + +func (AddressesFromPool) SwaggerDoc() map[string]string { + return map_AddressesFromPool +} + var map_NetworkDeviceSpec = map[string]string{ - "": "NetworkDeviceSpec defines the network configuration for a virtual machine's network device.", - "networkName": "NetworkName is the name of the vSphere network to which the device will be connected.", + "": "NetworkDeviceSpec defines the network configuration for a virtual machine's network device.", + "networkName": "networkName is the name of the vSphere network or port group to which the network device will be connected, for example, port-group-1. When not provided, the vCenter API will attempt to select a default network. The available networks (port groups) can be listed using `govc ls 'network/*'`", + "gateway": "gateway is an IPv4 or IPv6 address which represents the subnet gateway, for example, 192.168.1.1.", + "ipAddrs": "ipAddrs is a list of one or more IPv4 and/or IPv6 addresses and CIDR to assign to this device, for example, 192.168.1.100/24. IP addresses provided via ipAddrs are intended to allow explicit assignment of a machine's IP address. IP pool configurations provided via addressesFromPool, however, defer IP address assignment to an external controller. If both addressesFromPool and ipAddrs are empty or not defined, DHCP will be used to assign an IP address. If both ipAddrs and addressesFromPools are defined, the IP addresses associated with ipAddrs will be applied first followed by IP addresses from addressesFromPools.", + "nameservers": "nameservers is a list of IPv4 and/or IPv6 addresses used as DNS nameservers, for example, 8.8.8.8. a nameserver is not provided by a fulfilled IPAddressClaim. If DHCP is not the source of IP addresses for this network device, nameservers should include a valid nameserver.", + "addressesFromPools": "addressesFromPools is a list of references to IP pool types and instances which are handled by an external controller. addressesFromPool configurations provided via addressesFromPools defer IP address assignment to an external controller. IP addresses provided via ipAddrs, however, are intended to allow explicit assignment of a machine's IP address. If both addressesFromPool and ipAddrs are empty or not defined, DHCP will assign an IP address. If both ipAddrs and addressesFromPools are defined, the IP addresses associated with ipAddrs will be applied first followed by IP addresses from addressesFromPools.", } func (NetworkDeviceSpec) SwaggerDoc() map[string]string { diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go index 8b2803190..e8c123345 100644 --- a/vendor/golang.org/x/net/html/render.go +++ b/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index 5c2a1f4ef..de67f938a 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index cd057f398..033b6e6db 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -441,7 +441,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { if s.NewWriteScheduler != nil { sc.writeSched = s.NewWriteScheduler() } else { - sc.writeSched = NewPriorityWriteScheduler(nil) + sc.writeSched = newRoundRobinWriteScheduler() } // These start at the RFC-specified defaults. If there is a higher @@ -2429,7 +2429,7 @@ type requestBody struct { conn *serverConn closeOnce sync.Once // for use by Close only sawEOF bool // for use by Read only - pipe *pipe // non-nil if we have a HTTP entity message body + pipe *pipe // non-nil if we have an HTTP entity message body needsContinue bool // need to send a 100-continue } @@ -2569,7 +2569,8 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { clen = "" } } - if clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { + _, hasContentLength := rws.snapHeader["Content-Length"] + if !hasContentLength && clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { clen = strconv.Itoa(len(p)) } _, hasContentType := rws.snapHeader["Content-Type"] @@ -2774,7 +2775,7 @@ func (w *responseWriter) FlushError() error { err = rws.bw.Flush() } else { // The bufio.Writer won't call chunkWriter.Write - // (writeChunk with zero bytes, so we have to do it + // (writeChunk with zero bytes), so we have to do it // ourselves to force the HTTP response header and/or // final DATA frame (with END_STREAM) to be sent. _, err = chunkWriter{rws}.Write(nil) diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index ac90a2631..b0d482f9f 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -19,6 +19,7 @@ import ( "io/fs" "log" "math" + "math/bits" mathrand "math/rand" "net" "net/http" @@ -518,11 +519,14 @@ func (t *Transport) RoundTrip(req *http.Request) (*http.Response, error) { func authorityAddr(scheme string, authority string) (addr string) { host, port, err := net.SplitHostPort(authority) if err != nil { // authority didn't have a port + host = authority + port = "" + } + if port == "" { // authority's port was empty port = "443" if scheme == "http" { port = "80" } - host = authority } if a, err := idna.ToASCII(host); err == nil { host = a @@ -1268,21 +1272,23 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { cancelRequest := func(cs *clientStream, err error) error { cs.cc.mu.Lock() - defer cs.cc.mu.Unlock() - cs.abortStreamLocked(err) - if cs.ID != 0 { - // This request may have failed because of a problem with the connection, - // or for some unrelated reason. (For example, the user might have canceled - // the request without waiting for a response.) Mark the connection as - // not reusable, since trying to reuse a dead connection is worse than - // unnecessarily creating a new one. - // - // If cs.ID is 0, then the request was never allocated a stream ID and - // whatever went wrong was unrelated to the connection. We might have - // timed out waiting for a stream slot when StrictMaxConcurrentStreams - // is set, for example, in which case retrying on a different connection - // will not help. - cs.cc.doNotReuse = true + bodyClosed := cs.reqBodyClosed + cs.cc.mu.Unlock() + // Wait for the request body to be closed. + // + // If nothing closed the body before now, abortStreamLocked + // will have started a goroutine to close it. + // + // Closing the body before returning avoids a race condition + // with net/http checking its readTrackingBody to see if the + // body was read from or closed. See golang/go#60041. + // + // The body is closed in a separate goroutine without the + // connection mutex held, but dropping the mutex before waiting + // will keep us from holding it indefinitely if the body + // close is slow for some reason. + if bodyClosed != nil { + <-bodyClosed } return err } @@ -1301,11 +1307,14 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { return handleResponseHeaders() default: waitDone() - return nil, cancelRequest(cs, cs.abortErr) + return nil, cs.abortErr } case <-ctx.Done(): - return nil, cancelRequest(cs, ctx.Err()) + err := ctx.Err() + cs.abortStream(err) + return nil, cancelRequest(cs, err) case <-cs.reqCancel: + cs.abortStream(errRequestCanceled) return nil, cancelRequest(cs, errRequestCanceled) } } @@ -1672,7 +1681,27 @@ func (cs *clientStream) frameScratchBufferLen(maxFrameSize int) int { return int(n) // doesn't truncate; max is 512K } -var bufPool sync.Pool // of *[]byte +// Seven bufPools manage different frame sizes. This helps to avoid scenarios where long-running +// streaming requests using small frame sizes occupy large buffers initially allocated for prior +// requests needing big buffers. The size ranges are as follows: +// {0 KB, 16 KB], {16 KB, 32 KB], {32 KB, 64 KB], {64 KB, 128 KB], {128 KB, 256 KB], +// {256 KB, 512 KB], {512 KB, infinity} +// In practice, the maximum scratch buffer size should not exceed 512 KB due to +// frameScratchBufferLen(maxFrameSize), thus the "infinity pool" should never be used. +// It exists mainly as a safety measure, for potential future increases in max buffer size. +var bufPools [7]sync.Pool // of *[]byte +func bufPoolIndex(size int) int { + if size <= 16384 { + return 0 + } + size -= 1 + bits := bits.Len(uint(size)) + index := bits - 14 + if index >= len(bufPools) { + return len(bufPools) - 1 + } + return index +} func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { cc := cs.cc @@ -1690,12 +1719,13 @@ func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { // Scratch buffer for reading into & writing from. scratchLen := cs.frameScratchBufferLen(maxFrameSize) var buf []byte - if bp, ok := bufPool.Get().(*[]byte); ok && len(*bp) >= scratchLen { - defer bufPool.Put(bp) + index := bufPoolIndex(scratchLen) + if bp, ok := bufPools[index].Get().(*[]byte); ok && len(*bp) >= scratchLen { + defer bufPools[index].Put(bp) buf = *bp } else { buf = make([]byte, scratchLen) - defer bufPool.Put(&buf) + defer bufPools[index].Put(&buf) } var sawEOF bool @@ -1863,6 +1893,9 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail if err != nil { return nil, err } + if !httpguts.ValidHostHeader(host) { + return nil, errors.New("http2: invalid Host header") + } var path string if req.Method != "CONNECT" { @@ -1899,7 +1932,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail // 8.1.2.3 Request Pseudo-Header Fields // The :path pseudo-header field includes the path and query parts of the // target URI (the path-absolute production and optionally a '?' character - // followed by the query production (see Sections 3.3 and 3.4 of + // followed by the query production, see Sections 3.3 and 3.4 of // [RFC3986]). f(":authority", host) m := req.Method diff --git a/vendor/golang.org/x/net/http2/writesched.go b/vendor/golang.org/x/net/http2/writesched.go index c7cd00173..cc893adc2 100644 --- a/vendor/golang.org/x/net/http2/writesched.go +++ b/vendor/golang.org/x/net/http2/writesched.go @@ -184,7 +184,8 @@ func (wr *FrameWriteRequest) replyToWriter(err error) { // writeQueue is used by implementations of WriteScheduler. type writeQueue struct { - s []FrameWriteRequest + s []FrameWriteRequest + prev, next *writeQueue } func (q *writeQueue) empty() bool { return len(q.s) == 0 } diff --git a/vendor/golang.org/x/net/http2/writesched_roundrobin.go b/vendor/golang.org/x/net/http2/writesched_roundrobin.go new file mode 100644 index 000000000..54fe86322 --- /dev/null +++ b/vendor/golang.org/x/net/http2/writesched_roundrobin.go @@ -0,0 +1,119 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "fmt" + "math" +) + +type roundRobinWriteScheduler struct { + // control contains control frames (SETTINGS, PING, etc.). + control writeQueue + + // streams maps stream ID to a queue. + streams map[uint32]*writeQueue + + // stream queues are stored in a circular linked list. + // head is the next stream to write, or nil if there are no streams open. + head *writeQueue + + // pool of empty queues for reuse. + queuePool writeQueuePool +} + +// newRoundRobinWriteScheduler constructs a new write scheduler. +// The round robin scheduler priorizes control frames +// like SETTINGS and PING over DATA frames. +// When there are no control frames to send, it performs a round-robin +// selection from the ready streams. +func newRoundRobinWriteScheduler() WriteScheduler { + ws := &roundRobinWriteScheduler{ + streams: make(map[uint32]*writeQueue), + } + return ws +} + +func (ws *roundRobinWriteScheduler) OpenStream(streamID uint32, options OpenStreamOptions) { + if ws.streams[streamID] != nil { + panic(fmt.Errorf("stream %d already opened", streamID)) + } + q := ws.queuePool.get() + ws.streams[streamID] = q + if ws.head == nil { + ws.head = q + q.next = q + q.prev = q + } else { + // Queues are stored in a ring. + // Insert the new stream before ws.head, putting it at the end of the list. + q.prev = ws.head.prev + q.next = ws.head + q.prev.next = q + q.next.prev = q + } +} + +func (ws *roundRobinWriteScheduler) CloseStream(streamID uint32) { + q := ws.streams[streamID] + if q == nil { + return + } + if q.next == q { + // This was the only open stream. + ws.head = nil + } else { + q.prev.next = q.next + q.next.prev = q.prev + if ws.head == q { + ws.head = q.next + } + } + delete(ws.streams, streamID) + ws.queuePool.put(q) +} + +func (ws *roundRobinWriteScheduler) AdjustStream(streamID uint32, priority PriorityParam) {} + +func (ws *roundRobinWriteScheduler) Push(wr FrameWriteRequest) { + if wr.isControl() { + ws.control.push(wr) + return + } + q := ws.streams[wr.StreamID()] + if q == nil { + // This is a closed stream. + // wr should not be a HEADERS or DATA frame. + // We push the request onto the control queue. + if wr.DataSize() > 0 { + panic("add DATA on non-open stream") + } + ws.control.push(wr) + return + } + q.push(wr) +} + +func (ws *roundRobinWriteScheduler) Pop() (FrameWriteRequest, bool) { + // Control and RST_STREAM frames first. + if !ws.control.empty() { + return ws.control.shift(), true + } + if ws.head == nil { + return FrameWriteRequest{}, false + } + q := ws.head + for { + if wr, ok := q.consume(math.MaxInt32); ok { + ws.head = q.next + return wr, true + } + q = q.next + if q == ws.head { + break + } + } + return FrameWriteRequest{}, false +} diff --git a/vendor/golang.org/x/net/idna/idna9.0.0.go b/vendor/golang.org/x/net/idna/idna9.0.0.go index aae6aac87..ee1698cef 100644 --- a/vendor/golang.org/x/net/idna/idna9.0.0.go +++ b/vendor/golang.org/x/net/idna/idna9.0.0.go @@ -121,7 +121,7 @@ func CheckJoiners(enable bool) Option { } } -// StrictDomainName limits the set of permissable ASCII characters to those +// StrictDomainName limits the set of permissible ASCII characters to those // allowed in domain names as defined in RFC 1034 (A-Z, a-z, 0-9 and the // hyphen). This is set by default for MapForLookup and ValidateForRegistration, // but is only useful if ValidateLabels is set. diff --git a/vendor/golang.org/x/net/idna/tables13.0.0.go b/vendor/golang.org/x/net/idna/tables13.0.0.go index 390c5e56d..66701eadf 100644 --- a/vendor/golang.org/x/net/idna/tables13.0.0.go +++ b/vendor/golang.org/x/net/idna/tables13.0.0.go @@ -1,151 +1,294 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package idna // UnicodeVersion is the Unicode version from which the tables in this package are derived. const UnicodeVersion = "13.0.0" -var mappings string = "" + // Size: 8188 bytes - "\x00\x01 \x03 ̈\x01a\x03 ̄\x012\x013\x03 ́\x03 ̧\x011\x01o\x051⁄4\x051⁄2" + - "\x053⁄4\x03i̇\x03l·\x03ʼn\x01s\x03dž\x03ⱥ\x03ⱦ\x01h\x01j\x01r\x01w\x01y" + - "\x03 ̆\x03 ̇\x03 ̊\x03 ̨\x03 ̃\x03 ̋\x01l\x01x\x04̈́\x03 ι\x01;\x05 ̈́" + - "\x04եւ\x04اٴ\x04وٴ\x04ۇٴ\x04يٴ\x06क़\x06ख़\x06ग़\x06ज़\x06ड़\x06ढ़\x06फ़" + - "\x06य़\x06ড়\x06ঢ়\x06য়\x06ਲ਼\x06ਸ਼\x06ਖ਼\x06ਗ਼\x06ਜ਼\x06ਫ਼\x06ଡ଼\x06ଢ଼" + - "\x06ํา\x06ໍາ\x06ຫນ\x06ຫມ\x06གྷ\x06ཌྷ\x06དྷ\x06བྷ\x06ཛྷ\x06ཀྵ\x06ཱི\x06ཱུ" + - "\x06ྲྀ\x09ྲཱྀ\x06ླྀ\x09ླཱྀ\x06ཱྀ\x06ྒྷ\x06ྜྷ\x06ྡྷ\x06ྦྷ\x06ྫྷ\x06ྐྵ\x02" + - "в\x02д\x02о\x02с\x02т\x02ъ\x02ѣ\x02æ\x01b\x01d\x01e\x02ǝ\x01g\x01i\x01k" + - "\x01m\x01n\x02ȣ\x01p\x01t\x01u\x02ɐ\x02ɑ\x02ə\x02ɛ\x02ɜ\x02ŋ\x02ɔ\x02ɯ" + - "\x01v\x02β\x02γ\x02δ\x02φ\x02χ\x02ρ\x02н\x02ɒ\x01c\x02ɕ\x02ð\x01f\x02ɟ" + - "\x02ɡ\x02ɥ\x02ɨ\x02ɩ\x02ɪ\x02ʝ\x02ɭ\x02ʟ\x02ɱ\x02ɰ\x02ɲ\x02ɳ\x02ɴ\x02ɵ" + - "\x02ɸ\x02ʂ\x02ʃ\x02ƫ\x02ʉ\x02ʊ\x02ʋ\x02ʌ\x01z\x02ʐ\x02ʑ\x02ʒ\x02θ\x02ss" + - "\x02ά\x02έ\x02ή\x02ί\x02ό\x02ύ\x02ώ\x05ἀι\x05ἁι\x05ἂι\x05ἃι\x05ἄι\x05ἅι" + - "\x05ἆι\x05ἇι\x05ἠι\x05ἡι\x05ἢι\x05ἣι\x05ἤι\x05ἥι\x05ἦι\x05ἧι\x05ὠι\x05ὡι" + - "\x05ὢι\x05ὣι\x05ὤι\x05ὥι\x05ὦι\x05ὧι\x05ὰι\x04αι\x04άι\x05ᾶι\x02ι\x05 ̈͂" + - "\x05ὴι\x04ηι\x04ήι\x05ῆι\x05 ̓̀\x05 ̓́\x05 ̓͂\x02ΐ\x05 ̔̀\x05 ̔́\x05 ̔͂" + - "\x02ΰ\x05 ̈̀\x01`\x05ὼι\x04ωι\x04ώι\x05ῶι\x06′′\x09′′′\x06‵‵\x09‵‵‵\x02!" + - "!\x02??\x02?!\x02!?\x0c′′′′\x010\x014\x015\x016\x017\x018\x019\x01+\x01=" + - "\x01(\x01)\x02rs\x02ħ\x02no\x01q\x02sm\x02tm\x02ω\x02å\x02א\x02ב\x02ג" + - "\x02ד\x02π\x051⁄7\x051⁄9\x061⁄10\x051⁄3\x052⁄3\x051⁄5\x052⁄5\x053⁄5\x054" + - "⁄5\x051⁄6\x055⁄6\x051⁄8\x053⁄8\x055⁄8\x057⁄8\x041⁄\x02ii\x02iv\x02vi" + - "\x04viii\x02ix\x02xi\x050⁄3\x06∫∫\x09∫∫∫\x06∮∮\x09∮∮∮\x0210\x0211\x0212" + - "\x0213\x0214\x0215\x0216\x0217\x0218\x0219\x0220\x04(10)\x04(11)\x04(12)" + - "\x04(13)\x04(14)\x04(15)\x04(16)\x04(17)\x04(18)\x04(19)\x04(20)\x0c∫∫∫∫" + - "\x02==\x05⫝̸\x02ɫ\x02ɽ\x02ȿ\x02ɀ\x01.\x04 ゙\x04 ゚\x06より\x06コト\x05(ᄀ)\x05" + - "(ᄂ)\x05(ᄃ)\x05(ᄅ)\x05(ᄆ)\x05(ᄇ)\x05(ᄉ)\x05(ᄋ)\x05(ᄌ)\x05(ᄎ)\x05(ᄏ)\x05(ᄐ" + - ")\x05(ᄑ)\x05(ᄒ)\x05(가)\x05(나)\x05(다)\x05(라)\x05(마)\x05(바)\x05(사)\x05(아)" + - "\x05(자)\x05(차)\x05(카)\x05(타)\x05(파)\x05(하)\x05(주)\x08(오전)\x08(오후)\x05(一)" + - "\x05(二)\x05(三)\x05(四)\x05(五)\x05(六)\x05(七)\x05(八)\x05(九)\x05(十)\x05(月)" + - "\x05(火)\x05(水)\x05(木)\x05(金)\x05(土)\x05(日)\x05(株)\x05(有)\x05(社)\x05(名)" + - "\x05(特)\x05(財)\x05(祝)\x05(労)\x05(代)\x05(呼)\x05(学)\x05(監)\x05(企)\x05(資)" + - "\x05(協)\x05(祭)\x05(休)\x05(自)\x05(至)\x0221\x0222\x0223\x0224\x0225\x0226" + - "\x0227\x0228\x0229\x0230\x0231\x0232\x0233\x0234\x0235\x06참고\x06주의\x0236" + - "\x0237\x0238\x0239\x0240\x0241\x0242\x0243\x0244\x0245\x0246\x0247\x0248" + - "\x0249\x0250\x041月\x042月\x043月\x044月\x045月\x046月\x047月\x048月\x049月\x0510" + - "月\x0511月\x0512月\x02hg\x02ev\x06令和\x0cアパート\x0cアルファ\x0cアンペア\x09アール\x0cイニ" + - "ング\x09インチ\x09ウォン\x0fエスクード\x0cエーカー\x09オンス\x09オーム\x09カイリ\x0cカラット\x0cカロリー" + - "\x09ガロン\x09ガンマ\x06ギガ\x09ギニー\x0cキュリー\x0cギルダー\x06キロ\x0fキログラム\x12キロメートル\x0f" + - "キロワット\x09グラム\x0fグラムトン\x0fクルゼイロ\x0cクローネ\x09ケース\x09コルナ\x09コーポ\x0cサイクル" + - "\x0fサンチーム\x0cシリング\x09センチ\x09セント\x09ダース\x06デシ\x06ドル\x06トン\x06ナノ\x09ノット" + - "\x09ハイツ\x0fパーセント\x09パーツ\x0cバーレル\x0fピアストル\x09ピクル\x06ピコ\x06ビル\x0fファラッド\x0c" + - "フィート\x0fブッシェル\x09フラン\x0fヘクタール\x06ペソ\x09ペニヒ\x09ヘルツ\x09ペンス\x09ページ\x09ベータ" + - "\x0cポイント\x09ボルト\x06ホン\x09ポンド\x09ホール\x09ホーン\x0cマイクロ\x09マイル\x09マッハ\x09マルク" + - "\x0fマンション\x0cミクロン\x06ミリ\x0fミリバール\x06メガ\x0cメガトン\x0cメートル\x09ヤード\x09ヤール\x09" + - "ユアン\x0cリットル\x06リラ\x09ルピー\x0cルーブル\x06レム\x0fレントゲン\x09ワット\x040点\x041点\x04" + - "2点\x043点\x044点\x045点\x046点\x047点\x048点\x049点\x0510点\x0511点\x0512点\x0513点" + - "\x0514点\x0515点\x0516点\x0517点\x0518点\x0519点\x0520点\x0521点\x0522点\x0523点" + - "\x0524点\x02da\x02au\x02ov\x02pc\x02dm\x02iu\x06平成\x06昭和\x06大正\x06明治\x0c株" + - "式会社\x02pa\x02na\x02ma\x02ka\x02kb\x02mb\x02gb\x04kcal\x02pf\x02nf\x02m" + - "g\x02kg\x02hz\x02ml\x02dl\x02kl\x02fm\x02nm\x02mm\x02cm\x02km\x02m2\x02m" + - "3\x05m∕s\x06m∕s2\x07rad∕s\x08rad∕s2\x02ps\x02ns\x02ms\x02pv\x02nv\x02mv" + - "\x02kv\x02pw\x02nw\x02mw\x02kw\x02bq\x02cc\x02cd\x06c∕kg\x02db\x02gy\x02" + - "ha\x02hp\x02in\x02kk\x02kt\x02lm\x02ln\x02lx\x02ph\x02pr\x02sr\x02sv\x02" + - "wb\x05v∕m\x05a∕m\x041日\x042日\x043日\x044日\x045日\x046日\x047日\x048日\x049日" + - "\x0510日\x0511日\x0512日\x0513日\x0514日\x0515日\x0516日\x0517日\x0518日\x0519日" + - "\x0520日\x0521日\x0522日\x0523日\x0524日\x0525日\x0526日\x0527日\x0528日\x0529日" + - "\x0530日\x0531日\x02ь\x02ɦ\x02ɬ\x02ʞ\x02ʇ\x02œ\x02ʍ\x04𤋮\x04𢡊\x04𢡄\x04𣏕" + - "\x04𥉉\x04𥳐\x04𧻓\x02ff\x02fi\x02fl\x02st\x04մն\x04մե\x04մի\x04վն\x04մխ" + - "\x04יִ\x04ײַ\x02ע\x02ה\x02כ\x02ל\x02ם\x02ר\x02ת\x04שׁ\x04שׂ\x06שּׁ\x06שּ" + - "ׂ\x04אַ\x04אָ\x04אּ\x04בּ\x04גּ\x04דּ\x04הּ\x04וּ\x04זּ\x04טּ\x04יּ\x04" + - "ךּ\x04כּ\x04לּ\x04מּ\x04נּ\x04סּ\x04ףּ\x04פּ\x04צּ\x04קּ\x04רּ\x04שּ" + - "\x04תּ\x04וֹ\x04בֿ\x04כֿ\x04פֿ\x04אל\x02ٱ\x02ٻ\x02پ\x02ڀ\x02ٺ\x02ٿ\x02ٹ" + - "\x02ڤ\x02ڦ\x02ڄ\x02ڃ\x02چ\x02ڇ\x02ڍ\x02ڌ\x02ڎ\x02ڈ\x02ژ\x02ڑ\x02ک\x02گ" + - "\x02ڳ\x02ڱ\x02ں\x02ڻ\x02ۀ\x02ہ\x02ھ\x02ے\x02ۓ\x02ڭ\x02ۇ\x02ۆ\x02ۈ\x02ۋ" + - "\x02ۅ\x02ۉ\x02ې\x02ى\x04ئا\x04ئە\x04ئو\x04ئۇ\x04ئۆ\x04ئۈ\x04ئې\x04ئى\x02" + - "ی\x04ئج\x04ئح\x04ئم\x04ئي\x04بج\x04بح\x04بخ\x04بم\x04بى\x04بي\x04تج\x04" + - "تح\x04تخ\x04تم\x04تى\x04تي\x04ثج\x04ثم\x04ثى\x04ثي\x04جح\x04جم\x04حج" + - "\x04حم\x04خج\x04خح\x04خم\x04سج\x04سح\x04سخ\x04سم\x04صح\x04صم\x04ضج\x04ضح" + - "\x04ضخ\x04ضم\x04طح\x04طم\x04ظم\x04عج\x04عم\x04غج\x04غم\x04فج\x04فح\x04فخ" + - "\x04فم\x04فى\x04في\x04قح\x04قم\x04قى\x04قي\x04كا\x04كج\x04كح\x04كخ\x04كل" + - "\x04كم\x04كى\x04كي\x04لج\x04لح\x04لخ\x04لم\x04لى\x04لي\x04مج\x04مح\x04مخ" + - "\x04مم\x04مى\x04مي\x04نج\x04نح\x04نخ\x04نم\x04نى\x04ني\x04هج\x04هم\x04هى" + - "\x04هي\x04يج\x04يح\x04يخ\x04يم\x04يى\x04يي\x04ذٰ\x04رٰ\x04ىٰ\x05 ٌّ\x05 " + - "ٍّ\x05 َّ\x05 ُّ\x05 ِّ\x05 ّٰ\x04ئر\x04ئز\x04ئن\x04بر\x04بز\x04بن\x04ت" + - "ر\x04تز\x04تن\x04ثر\x04ثز\x04ثن\x04ما\x04نر\x04نز\x04نن\x04ير\x04يز\x04" + - "ين\x04ئخ\x04ئه\x04به\x04ته\x04صخ\x04له\x04نه\x04هٰ\x04يه\x04ثه\x04سه" + - "\x04شم\x04شه\x06ـَّ\x06ـُّ\x06ـِّ\x04طى\x04طي\x04عى\x04عي\x04غى\x04غي" + - "\x04سى\x04سي\x04شى\x04شي\x04حى\x04حي\x04جى\x04جي\x04خى\x04خي\x04صى\x04صي" + - "\x04ضى\x04ضي\x04شج\x04شح\x04شخ\x04شر\x04سر\x04صر\x04ضر\x04اً\x06تجم\x06ت" + - "حج\x06تحم\x06تخم\x06تمج\x06تمح\x06تمخ\x06جمح\x06حمي\x06حمى\x06سحج\x06سج" + - "ح\x06سجى\x06سمح\x06سمج\x06سمم\x06صحح\x06صمم\x06شحم\x06شجي\x06شمخ\x06شمم" + - "\x06ضحى\x06ضخم\x06طمح\x06طمم\x06طمي\x06عجم\x06عمم\x06عمى\x06غمم\x06غمي" + - "\x06غمى\x06فخم\x06قمح\x06قمم\x06لحم\x06لحي\x06لحى\x06لجج\x06لخم\x06لمح" + - "\x06محج\x06محم\x06محي\x06مجح\x06مجم\x06مخج\x06مخم\x06مجخ\x06همج\x06همم" + - "\x06نحم\x06نحى\x06نجم\x06نجى\x06نمي\x06نمى\x06يمم\x06بخي\x06تجي\x06تجى" + - "\x06تخي\x06تخى\x06تمي\x06تمى\x06جمي\x06جحى\x06جمى\x06سخى\x06صحي\x06شحي" + - "\x06ضحي\x06لجي\x06لمي\x06يحي\x06يجي\x06يمي\x06ممي\x06قمي\x06نحي\x06عمي" + - "\x06كمي\x06نجح\x06مخي\x06لجم\x06كمم\x06جحي\x06حجي\x06مجي\x06فمي\x06بحي" + - "\x06سخي\x06نجي\x06صلے\x06قلے\x08الله\x08اكبر\x08محمد\x08صلعم\x08رسول\x08" + - "عليه\x08وسلم\x06صلى!صلى الله عليه وسلم\x0fجل جلاله\x08ریال\x01,\x01:" + - "\x01!\x01?\x01_\x01{\x01}\x01[\x01]\x01#\x01&\x01*\x01-\x01<\x01>\x01\\" + - "\x01$\x01%\x01@\x04ـً\x04ـَ\x04ـُ\x04ـِ\x04ـّ\x04ـْ\x02ء\x02آ\x02أ\x02ؤ" + - "\x02إ\x02ئ\x02ا\x02ب\x02ة\x02ت\x02ث\x02ج\x02ح\x02خ\x02د\x02ذ\x02ر\x02ز" + - "\x02س\x02ش\x02ص\x02ض\x02ط\x02ظ\x02ع\x02غ\x02ف\x02ق\x02ك\x02ل\x02م\x02ن" + - "\x02ه\x02و\x02ي\x04لآ\x04لأ\x04لإ\x04لا\x01\x22\x01'\x01/\x01^\x01|\x01~" + - "\x02¢\x02£\x02¬\x02¦\x02¥\x08𝅗𝅥\x08𝅘𝅥\x0c𝅘𝅥𝅮\x0c𝅘𝅥𝅯\x0c𝅘𝅥𝅰\x0c𝅘𝅥𝅱\x0c𝅘𝅥𝅲" + - "\x08𝆹𝅥\x08𝆺𝅥\x0c𝆹𝅥𝅮\x0c𝆺𝅥𝅮\x0c𝆹𝅥𝅯\x0c𝆺𝅥𝅯\x02ı\x02ȷ\x02α\x02ε\x02ζ\x02η" + - "\x02κ\x02λ\x02μ\x02ν\x02ξ\x02ο\x02σ\x02τ\x02υ\x02ψ\x03∇\x03∂\x02ϝ\x02ٮ" + - "\x02ڡ\x02ٯ\x020,\x021,\x022,\x023,\x024,\x025,\x026,\x027,\x028,\x029," + - "\x03(a)\x03(b)\x03(c)\x03(d)\x03(e)\x03(f)\x03(g)\x03(h)\x03(i)\x03(j)" + - "\x03(k)\x03(l)\x03(m)\x03(n)\x03(o)\x03(p)\x03(q)\x03(r)\x03(s)\x03(t)" + - "\x03(u)\x03(v)\x03(w)\x03(x)\x03(y)\x03(z)\x07〔s〕\x02wz\x02hv\x02sd\x03p" + - "pv\x02wc\x02mc\x02md\x02mr\x02dj\x06ほか\x06ココ\x03サ\x03手\x03字\x03双\x03デ" + - "\x03二\x03多\x03解\x03天\x03交\x03映\x03無\x03料\x03前\x03後\x03再\x03新\x03初\x03終" + - "\x03生\x03販\x03声\x03吹\x03演\x03投\x03捕\x03一\x03三\x03遊\x03左\x03中\x03右\x03指" + - "\x03走\x03打\x03禁\x03空\x03合\x03満\x03有\x03月\x03申\x03割\x03営\x03配\x09〔本〕\x09〔" + - "三〕\x09〔二〕\x09〔安〕\x09〔点〕\x09〔打〕\x09〔盗〕\x09〔勝〕\x09〔敗〕\x03得\x03可\x03丽\x03" + - "丸\x03乁\x03你\x03侮\x03侻\x03倂\x03偺\x03備\x03僧\x03像\x03㒞\x03免\x03兔\x03兤\x03" + - "具\x03㒹\x03內\x03冗\x03冤\x03仌\x03冬\x03况\x03凵\x03刃\x03㓟\x03刻\x03剆\x03剷\x03" + - "㔕\x03勇\x03勉\x03勤\x03勺\x03包\x03匆\x03北\x03卉\x03卑\x03博\x03即\x03卽\x03卿\x03" + - "灰\x03及\x03叟\x03叫\x03叱\x03吆\x03咞\x03吸\x03呈\x03周\x03咢\x03哶\x03唐\x03啓\x03" + - "啣\x03善\x03喙\x03喫\x03喳\x03嗂\x03圖\x03嘆\x03圗\x03噑\x03噴\x03切\x03壮\x03城\x03" + - "埴\x03堍\x03型\x03堲\x03報\x03墬\x03売\x03壷\x03夆\x03夢\x03奢\x03姬\x03娛\x03娧\x03" + - "姘\x03婦\x03㛮\x03嬈\x03嬾\x03寃\x03寘\x03寧\x03寳\x03寿\x03将\x03尢\x03㞁\x03屠\x03" + - "屮\x03峀\x03岍\x03嵃\x03嵮\x03嵫\x03嵼\x03巡\x03巢\x03㠯\x03巽\x03帨\x03帽\x03幩\x03" + - "㡢\x03㡼\x03庰\x03庳\x03庶\x03廊\x03廾\x03舁\x03弢\x03㣇\x03形\x03彫\x03㣣\x03徚\x03" + - "忍\x03志\x03忹\x03悁\x03㤺\x03㤜\x03悔\x03惇\x03慈\x03慌\x03慎\x03慺\x03憎\x03憲\x03" + - "憤\x03憯\x03懞\x03懲\x03懶\x03成\x03戛\x03扝\x03抱\x03拔\x03捐\x03挽\x03拼\x03捨\x03" + - "掃\x03揤\x03搢\x03揅\x03掩\x03㨮\x03摩\x03摾\x03撝\x03摷\x03㩬\x03敏\x03敬\x03旣\x03" + - "書\x03晉\x03㬙\x03暑\x03㬈\x03㫤\x03冒\x03冕\x03最\x03暜\x03肭\x03䏙\x03朗\x03望\x03" + - "朡\x03杞\x03杓\x03㭉\x03柺\x03枅\x03桒\x03梅\x03梎\x03栟\x03椔\x03㮝\x03楂\x03榣\x03" + - "槪\x03檨\x03櫛\x03㰘\x03次\x03歔\x03㱎\x03歲\x03殟\x03殺\x03殻\x03汎\x03沿\x03泍\x03" + - "汧\x03洖\x03派\x03海\x03流\x03浩\x03浸\x03涅\x03洴\x03港\x03湮\x03㴳\x03滋\x03滇\x03" + - "淹\x03潮\x03濆\x03瀹\x03瀞\x03瀛\x03㶖\x03灊\x03災\x03灷\x03炭\x03煅\x03熜\x03爨\x03" + - "爵\x03牐\x03犀\x03犕\x03獺\x03王\x03㺬\x03玥\x03㺸\x03瑇\x03瑜\x03瑱\x03璅\x03瓊\x03" + - "㼛\x03甤\x03甾\x03異\x03瘐\x03㿼\x03䀈\x03直\x03眞\x03真\x03睊\x03䀹\x03瞋\x03䁆\x03" + - "䂖\x03硎\x03碌\x03磌\x03䃣\x03祖\x03福\x03秫\x03䄯\x03穀\x03穊\x03穏\x03䈂\x03篆\x03" + - "築\x03䈧\x03糒\x03䊠\x03糨\x03糣\x03紀\x03絣\x03䌁\x03緇\x03縂\x03繅\x03䌴\x03䍙\x03" + - "罺\x03羕\x03翺\x03者\x03聠\x03聰\x03䏕\x03育\x03脃\x03䐋\x03脾\x03媵\x03舄\x03辞\x03" + - "䑫\x03芑\x03芋\x03芝\x03劳\x03花\x03芳\x03芽\x03苦\x03若\x03茝\x03荣\x03莭\x03茣\x03" + - "莽\x03菧\x03著\x03荓\x03菊\x03菌\x03菜\x03䔫\x03蓱\x03蓳\x03蔖\x03蕤\x03䕝\x03䕡\x03" + - "䕫\x03虐\x03虜\x03虧\x03虩\x03蚩\x03蚈\x03蜎\x03蛢\x03蝹\x03蜨\x03蝫\x03螆\x03蟡\x03" + - "蠁\x03䗹\x03衠\x03衣\x03裗\x03裞\x03䘵\x03裺\x03㒻\x03䚾\x03䛇\x03誠\x03諭\x03變\x03" + - "豕\x03貫\x03賁\x03贛\x03起\x03跋\x03趼\x03跰\x03軔\x03輸\x03邔\x03郱\x03鄑\x03鄛\x03" + - "鈸\x03鋗\x03鋘\x03鉼\x03鏹\x03鐕\x03開\x03䦕\x03閷\x03䧦\x03雃\x03嶲\x03霣\x03䩮\x03" + - "䩶\x03韠\x03䪲\x03頋\x03頩\x03飢\x03䬳\x03餩\x03馧\x03駂\x03駾\x03䯎\x03鬒\x03鱀\x03" + - "鳽\x03䳎\x03䳭\x03鵧\x03䳸\x03麻\x03䵖\x03黹\x03黾\x03鼅\x03鼏\x03鼖\x03鼻" +var mappings string = "" + // Size: 6539 bytes + " ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक" + + "़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱ" + + "ཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳ" + + "ɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧ" + + "ιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?" + + "′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83" + + "⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12" + + ")(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)" + + "(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전" + + ")(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(" + + "財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)21222324252627282930313233343" + + "5참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパート" + + "アルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキロ" + + "グラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノ" + + "ノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポ" + + "イントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリ" + + "ラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20" + + "点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlk" + + "lfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhah" + + "pinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日1" + + "8日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմ" + + "խיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּו" + + "ֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئم" + + "ئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحط" + + "مظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمي" + + "نجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترت" + + "زتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيس" + + "ىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميح" + + "مىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمى" + + "فخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنم" + + "ينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمين" + + "حيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليه" + + "وسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\\$%@ـًـَـُـِـّـْءآ" + + "أؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا\x22'/^|~¢£¬¦¥𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱" + + "𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκλμνξοστυψ∇∂ϝٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c" + + ")(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s" + + "〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申割営配〔" + + "本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉卑博即卽" + + "卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢㠯巽帨帽" + + "幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最暜肭䏙朗" + + "望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸瑇瑜瑱璅" + + "瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦若茝荣莭" + + "茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷䧦雃嶲霣" + + "䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻" + +var mappingIndex = []uint16{ // 1650 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0004, 0x0005, 0x0008, 0x0009, 0x000a, + 0x000d, 0x0010, 0x0011, 0x0012, 0x0017, 0x001c, 0x0021, 0x0024, + 0x0027, 0x002a, 0x002b, 0x002e, 0x0031, 0x0034, 0x0035, 0x0036, + 0x0037, 0x0038, 0x0039, 0x003c, 0x003f, 0x0042, 0x0045, 0x0048, + 0x004b, 0x004c, 0x004d, 0x0051, 0x0054, 0x0055, 0x005a, 0x005e, + 0x0062, 0x0066, 0x006a, 0x006e, 0x0074, 0x007a, 0x0080, 0x0086, + 0x008c, 0x0092, 0x0098, 0x009e, 0x00a4, 0x00aa, 0x00b0, 0x00b6, + 0x00bc, 0x00c2, 0x00c8, 0x00ce, 0x00d4, 0x00da, 0x00e0, 0x00e6, + // Entry 40 - 7F + 0x00ec, 0x00f2, 0x00f8, 0x00fe, 0x0104, 0x010a, 0x0110, 0x0116, + 0x011c, 0x0122, 0x0128, 0x012e, 0x0137, 0x013d, 0x0146, 0x014c, + 0x0152, 0x0158, 0x015e, 0x0164, 0x016a, 0x0170, 0x0172, 0x0174, + 0x0176, 0x0178, 0x017a, 0x017c, 0x017e, 0x0180, 0x0181, 0x0182, + 0x0183, 0x0185, 0x0186, 0x0187, 0x0188, 0x0189, 0x018a, 0x018c, + 0x018d, 0x018e, 0x018f, 0x0191, 0x0193, 0x0195, 0x0197, 0x0199, + 0x019b, 0x019d, 0x019f, 0x01a0, 0x01a2, 0x01a4, 0x01a6, 0x01a8, + 0x01aa, 0x01ac, 0x01ae, 0x01b0, 0x01b1, 0x01b3, 0x01b5, 0x01b6, + // Entry 80 - BF + 0x01b8, 0x01ba, 0x01bc, 0x01be, 0x01c0, 0x01c2, 0x01c4, 0x01c6, + 0x01c8, 0x01ca, 0x01cc, 0x01ce, 0x01d0, 0x01d2, 0x01d4, 0x01d6, + 0x01d8, 0x01da, 0x01dc, 0x01de, 0x01e0, 0x01e2, 0x01e4, 0x01e5, + 0x01e7, 0x01e9, 0x01eb, 0x01ed, 0x01ef, 0x01f1, 0x01f3, 0x01f5, + 0x01f7, 0x01f9, 0x01fb, 0x01fd, 0x0202, 0x0207, 0x020c, 0x0211, + 0x0216, 0x021b, 0x0220, 0x0225, 0x022a, 0x022f, 0x0234, 0x0239, + 0x023e, 0x0243, 0x0248, 0x024d, 0x0252, 0x0257, 0x025c, 0x0261, + 0x0266, 0x026b, 0x0270, 0x0275, 0x027a, 0x027e, 0x0282, 0x0287, + // Entry C0 - FF + 0x0289, 0x028e, 0x0293, 0x0297, 0x029b, 0x02a0, 0x02a5, 0x02aa, + 0x02af, 0x02b1, 0x02b6, 0x02bb, 0x02c0, 0x02c2, 0x02c7, 0x02c8, + 0x02cd, 0x02d1, 0x02d5, 0x02da, 0x02e0, 0x02e9, 0x02ef, 0x02f8, + 0x02fa, 0x02fc, 0x02fe, 0x0300, 0x030c, 0x030d, 0x030e, 0x030f, + 0x0310, 0x0311, 0x0312, 0x0313, 0x0314, 0x0315, 0x0316, 0x0317, + 0x0319, 0x031b, 0x031d, 0x031e, 0x0320, 0x0322, 0x0324, 0x0326, + 0x0328, 0x032a, 0x032c, 0x032e, 0x0330, 0x0335, 0x033a, 0x0340, + 0x0345, 0x034a, 0x034f, 0x0354, 0x0359, 0x035e, 0x0363, 0x0368, + // Entry 100 - 13F + 0x036d, 0x0372, 0x0377, 0x037c, 0x0380, 0x0382, 0x0384, 0x0386, + 0x038a, 0x038c, 0x038e, 0x0393, 0x0399, 0x03a2, 0x03a8, 0x03b1, + 0x03b3, 0x03b5, 0x03b7, 0x03b9, 0x03bb, 0x03bd, 0x03bf, 0x03c1, + 0x03c3, 0x03c5, 0x03c7, 0x03cb, 0x03cf, 0x03d3, 0x03d7, 0x03db, + 0x03df, 0x03e3, 0x03e7, 0x03eb, 0x03ef, 0x03f3, 0x03ff, 0x0401, + 0x0406, 0x0408, 0x040a, 0x040c, 0x040e, 0x040f, 0x0413, 0x0417, + 0x041d, 0x0423, 0x0428, 0x042d, 0x0432, 0x0437, 0x043c, 0x0441, + 0x0446, 0x044b, 0x0450, 0x0455, 0x045a, 0x045f, 0x0464, 0x0469, + // Entry 140 - 17F + 0x046e, 0x0473, 0x0478, 0x047d, 0x0482, 0x0487, 0x048c, 0x0491, + 0x0496, 0x049b, 0x04a0, 0x04a5, 0x04aa, 0x04af, 0x04b4, 0x04bc, + 0x04c4, 0x04c9, 0x04ce, 0x04d3, 0x04d8, 0x04dd, 0x04e2, 0x04e7, + 0x04ec, 0x04f1, 0x04f6, 0x04fb, 0x0500, 0x0505, 0x050a, 0x050f, + 0x0514, 0x0519, 0x051e, 0x0523, 0x0528, 0x052d, 0x0532, 0x0537, + 0x053c, 0x0541, 0x0546, 0x054b, 0x0550, 0x0555, 0x055a, 0x055f, + 0x0564, 0x0569, 0x056e, 0x0573, 0x0578, 0x057a, 0x057c, 0x057e, + 0x0580, 0x0582, 0x0584, 0x0586, 0x0588, 0x058a, 0x058c, 0x058e, + // Entry 180 - 1BF + 0x0590, 0x0592, 0x0594, 0x0596, 0x059c, 0x05a2, 0x05a4, 0x05a6, + 0x05a8, 0x05aa, 0x05ac, 0x05ae, 0x05b0, 0x05b2, 0x05b4, 0x05b6, + 0x05b8, 0x05ba, 0x05bc, 0x05be, 0x05c0, 0x05c4, 0x05c8, 0x05cc, + 0x05d0, 0x05d4, 0x05d8, 0x05dc, 0x05e0, 0x05e4, 0x05e9, 0x05ee, + 0x05f3, 0x05f5, 0x05f7, 0x05fd, 0x0609, 0x0615, 0x0621, 0x062a, + 0x0636, 0x063f, 0x0648, 0x0657, 0x0663, 0x066c, 0x0675, 0x067e, + 0x068a, 0x0696, 0x069f, 0x06a8, 0x06ae, 0x06b7, 0x06c3, 0x06cf, + 0x06d5, 0x06e4, 0x06f6, 0x0705, 0x070e, 0x071d, 0x072c, 0x0738, + // Entry 1C0 - 1FF + 0x0741, 0x074a, 0x0753, 0x075f, 0x076e, 0x077a, 0x0783, 0x078c, + 0x0795, 0x079b, 0x07a1, 0x07a7, 0x07ad, 0x07b6, 0x07bf, 0x07ce, + 0x07d7, 0x07e3, 0x07f2, 0x07fb, 0x0801, 0x0807, 0x0816, 0x0822, + 0x0831, 0x083a, 0x0849, 0x084f, 0x0858, 0x0861, 0x086a, 0x0873, + 0x087c, 0x0888, 0x0891, 0x0897, 0x08a0, 0x08a9, 0x08b2, 0x08be, + 0x08c7, 0x08d0, 0x08d9, 0x08e8, 0x08f4, 0x08fa, 0x0909, 0x090f, + 0x091b, 0x0927, 0x0930, 0x0939, 0x0942, 0x094e, 0x0954, 0x095d, + 0x0969, 0x096f, 0x097e, 0x0987, 0x098b, 0x098f, 0x0993, 0x0997, + // Entry 200 - 23F + 0x099b, 0x099f, 0x09a3, 0x09a7, 0x09ab, 0x09af, 0x09b4, 0x09b9, + 0x09be, 0x09c3, 0x09c8, 0x09cd, 0x09d2, 0x09d7, 0x09dc, 0x09e1, + 0x09e6, 0x09eb, 0x09f0, 0x09f5, 0x09fa, 0x09fc, 0x09fe, 0x0a00, + 0x0a02, 0x0a04, 0x0a06, 0x0a0c, 0x0a12, 0x0a18, 0x0a1e, 0x0a2a, + 0x0a2c, 0x0a2e, 0x0a30, 0x0a32, 0x0a34, 0x0a36, 0x0a38, 0x0a3c, + 0x0a3e, 0x0a40, 0x0a42, 0x0a44, 0x0a46, 0x0a48, 0x0a4a, 0x0a4c, + 0x0a4e, 0x0a50, 0x0a52, 0x0a54, 0x0a56, 0x0a58, 0x0a5a, 0x0a5f, + 0x0a65, 0x0a6c, 0x0a74, 0x0a76, 0x0a78, 0x0a7a, 0x0a7c, 0x0a7e, + // Entry 240 - 27F + 0x0a80, 0x0a82, 0x0a84, 0x0a86, 0x0a88, 0x0a8a, 0x0a8c, 0x0a8e, + 0x0a90, 0x0a96, 0x0a98, 0x0a9a, 0x0a9c, 0x0a9e, 0x0aa0, 0x0aa2, + 0x0aa4, 0x0aa6, 0x0aa8, 0x0aaa, 0x0aac, 0x0aae, 0x0ab0, 0x0ab2, + 0x0ab4, 0x0ab9, 0x0abe, 0x0ac2, 0x0ac6, 0x0aca, 0x0ace, 0x0ad2, + 0x0ad6, 0x0ada, 0x0ade, 0x0ae2, 0x0ae7, 0x0aec, 0x0af1, 0x0af6, + 0x0afb, 0x0b00, 0x0b05, 0x0b0a, 0x0b0f, 0x0b14, 0x0b19, 0x0b1e, + 0x0b23, 0x0b28, 0x0b2d, 0x0b32, 0x0b37, 0x0b3c, 0x0b41, 0x0b46, + 0x0b4b, 0x0b50, 0x0b52, 0x0b54, 0x0b56, 0x0b58, 0x0b5a, 0x0b5c, + // Entry 280 - 2BF + 0x0b5e, 0x0b62, 0x0b66, 0x0b6a, 0x0b6e, 0x0b72, 0x0b76, 0x0b7a, + 0x0b7c, 0x0b7e, 0x0b80, 0x0b82, 0x0b86, 0x0b8a, 0x0b8e, 0x0b92, + 0x0b96, 0x0b9a, 0x0b9e, 0x0ba0, 0x0ba2, 0x0ba4, 0x0ba6, 0x0ba8, + 0x0baa, 0x0bac, 0x0bb0, 0x0bb4, 0x0bba, 0x0bc0, 0x0bc4, 0x0bc8, + 0x0bcc, 0x0bd0, 0x0bd4, 0x0bd8, 0x0bdc, 0x0be0, 0x0be4, 0x0be8, + 0x0bec, 0x0bf0, 0x0bf4, 0x0bf8, 0x0bfc, 0x0c00, 0x0c04, 0x0c08, + 0x0c0c, 0x0c10, 0x0c14, 0x0c18, 0x0c1c, 0x0c20, 0x0c24, 0x0c28, + 0x0c2c, 0x0c30, 0x0c34, 0x0c36, 0x0c38, 0x0c3a, 0x0c3c, 0x0c3e, + // Entry 2C0 - 2FF + 0x0c40, 0x0c42, 0x0c44, 0x0c46, 0x0c48, 0x0c4a, 0x0c4c, 0x0c4e, + 0x0c50, 0x0c52, 0x0c54, 0x0c56, 0x0c58, 0x0c5a, 0x0c5c, 0x0c5e, + 0x0c60, 0x0c62, 0x0c64, 0x0c66, 0x0c68, 0x0c6a, 0x0c6c, 0x0c6e, + 0x0c70, 0x0c72, 0x0c74, 0x0c76, 0x0c78, 0x0c7a, 0x0c7c, 0x0c7e, + 0x0c80, 0x0c82, 0x0c86, 0x0c8a, 0x0c8e, 0x0c92, 0x0c96, 0x0c9a, + 0x0c9e, 0x0ca2, 0x0ca4, 0x0ca8, 0x0cac, 0x0cb0, 0x0cb4, 0x0cb8, + 0x0cbc, 0x0cc0, 0x0cc4, 0x0cc8, 0x0ccc, 0x0cd0, 0x0cd4, 0x0cd8, + 0x0cdc, 0x0ce0, 0x0ce4, 0x0ce8, 0x0cec, 0x0cf0, 0x0cf4, 0x0cf8, + // Entry 300 - 33F + 0x0cfc, 0x0d00, 0x0d04, 0x0d08, 0x0d0c, 0x0d10, 0x0d14, 0x0d18, + 0x0d1c, 0x0d20, 0x0d24, 0x0d28, 0x0d2c, 0x0d30, 0x0d34, 0x0d38, + 0x0d3c, 0x0d40, 0x0d44, 0x0d48, 0x0d4c, 0x0d50, 0x0d54, 0x0d58, + 0x0d5c, 0x0d60, 0x0d64, 0x0d68, 0x0d6c, 0x0d70, 0x0d74, 0x0d78, + 0x0d7c, 0x0d80, 0x0d84, 0x0d88, 0x0d8c, 0x0d90, 0x0d94, 0x0d98, + 0x0d9c, 0x0da0, 0x0da4, 0x0da8, 0x0dac, 0x0db0, 0x0db4, 0x0db8, + 0x0dbc, 0x0dc0, 0x0dc4, 0x0dc8, 0x0dcc, 0x0dd0, 0x0dd4, 0x0dd8, + 0x0ddc, 0x0de0, 0x0de4, 0x0de8, 0x0dec, 0x0df0, 0x0df4, 0x0df8, + // Entry 340 - 37F + 0x0dfc, 0x0e00, 0x0e04, 0x0e08, 0x0e0c, 0x0e10, 0x0e14, 0x0e18, + 0x0e1d, 0x0e22, 0x0e27, 0x0e2c, 0x0e31, 0x0e36, 0x0e3a, 0x0e3e, + 0x0e42, 0x0e46, 0x0e4a, 0x0e4e, 0x0e52, 0x0e56, 0x0e5a, 0x0e5e, + 0x0e62, 0x0e66, 0x0e6a, 0x0e6e, 0x0e72, 0x0e76, 0x0e7a, 0x0e7e, + 0x0e82, 0x0e86, 0x0e8a, 0x0e8e, 0x0e92, 0x0e96, 0x0e9a, 0x0e9e, + 0x0ea2, 0x0ea6, 0x0eaa, 0x0eae, 0x0eb2, 0x0eb6, 0x0ebc, 0x0ec2, + 0x0ec8, 0x0ecc, 0x0ed0, 0x0ed4, 0x0ed8, 0x0edc, 0x0ee0, 0x0ee4, + 0x0ee8, 0x0eec, 0x0ef0, 0x0ef4, 0x0ef8, 0x0efc, 0x0f00, 0x0f04, + // Entry 380 - 3BF + 0x0f08, 0x0f0c, 0x0f10, 0x0f14, 0x0f18, 0x0f1c, 0x0f20, 0x0f24, + 0x0f28, 0x0f2c, 0x0f30, 0x0f34, 0x0f38, 0x0f3e, 0x0f44, 0x0f4a, + 0x0f50, 0x0f56, 0x0f5c, 0x0f62, 0x0f68, 0x0f6e, 0x0f74, 0x0f7a, + 0x0f80, 0x0f86, 0x0f8c, 0x0f92, 0x0f98, 0x0f9e, 0x0fa4, 0x0faa, + 0x0fb0, 0x0fb6, 0x0fbc, 0x0fc2, 0x0fc8, 0x0fce, 0x0fd4, 0x0fda, + 0x0fe0, 0x0fe6, 0x0fec, 0x0ff2, 0x0ff8, 0x0ffe, 0x1004, 0x100a, + 0x1010, 0x1016, 0x101c, 0x1022, 0x1028, 0x102e, 0x1034, 0x103a, + 0x1040, 0x1046, 0x104c, 0x1052, 0x1058, 0x105e, 0x1064, 0x106a, + // Entry 3C0 - 3FF + 0x1070, 0x1076, 0x107c, 0x1082, 0x1088, 0x108e, 0x1094, 0x109a, + 0x10a0, 0x10a6, 0x10ac, 0x10b2, 0x10b8, 0x10be, 0x10c4, 0x10ca, + 0x10d0, 0x10d6, 0x10dc, 0x10e2, 0x10e8, 0x10ee, 0x10f4, 0x10fa, + 0x1100, 0x1106, 0x110c, 0x1112, 0x1118, 0x111e, 0x1124, 0x112a, + 0x1130, 0x1136, 0x113c, 0x1142, 0x1148, 0x114e, 0x1154, 0x115a, + 0x1160, 0x1166, 0x116c, 0x1172, 0x1178, 0x1180, 0x1188, 0x1190, + 0x1198, 0x11a0, 0x11a8, 0x11b0, 0x11b6, 0x11d7, 0x11e6, 0x11ee, + 0x11ef, 0x11f0, 0x11f1, 0x11f2, 0x11f3, 0x11f4, 0x11f5, 0x11f6, + // Entry 400 - 43F + 0x11f7, 0x11f8, 0x11f9, 0x11fa, 0x11fb, 0x11fc, 0x11fd, 0x11fe, + 0x11ff, 0x1200, 0x1201, 0x1205, 0x1209, 0x120d, 0x1211, 0x1215, + 0x1219, 0x121b, 0x121d, 0x121f, 0x1221, 0x1223, 0x1225, 0x1227, + 0x1229, 0x122b, 0x122d, 0x122f, 0x1231, 0x1233, 0x1235, 0x1237, + 0x1239, 0x123b, 0x123d, 0x123f, 0x1241, 0x1243, 0x1245, 0x1247, + 0x1249, 0x124b, 0x124d, 0x124f, 0x1251, 0x1253, 0x1255, 0x1257, + 0x1259, 0x125b, 0x125d, 0x125f, 0x1263, 0x1267, 0x126b, 0x126f, + 0x1270, 0x1271, 0x1272, 0x1273, 0x1274, 0x1275, 0x1277, 0x1279, + // Entry 440 - 47F + 0x127b, 0x127d, 0x127f, 0x1287, 0x128f, 0x129b, 0x12a7, 0x12b3, + 0x12bf, 0x12cb, 0x12d3, 0x12db, 0x12e7, 0x12f3, 0x12ff, 0x130b, + 0x130d, 0x130f, 0x1311, 0x1313, 0x1315, 0x1317, 0x1319, 0x131b, + 0x131d, 0x131f, 0x1321, 0x1323, 0x1325, 0x1327, 0x1329, 0x132b, + 0x132e, 0x1331, 0x1333, 0x1335, 0x1337, 0x1339, 0x133b, 0x133d, + 0x133f, 0x1341, 0x1343, 0x1345, 0x1347, 0x1349, 0x134b, 0x134d, + 0x1350, 0x1353, 0x1356, 0x1359, 0x135c, 0x135f, 0x1362, 0x1365, + 0x1368, 0x136b, 0x136e, 0x1371, 0x1374, 0x1377, 0x137a, 0x137d, + // Entry 480 - 4BF + 0x1380, 0x1383, 0x1386, 0x1389, 0x138c, 0x138f, 0x1392, 0x1395, + 0x1398, 0x139b, 0x13a2, 0x13a4, 0x13a6, 0x13a8, 0x13ab, 0x13ad, + 0x13af, 0x13b1, 0x13b3, 0x13b5, 0x13bb, 0x13c1, 0x13c4, 0x13c7, + 0x13ca, 0x13cd, 0x13d0, 0x13d3, 0x13d6, 0x13d9, 0x13dc, 0x13df, + 0x13e2, 0x13e5, 0x13e8, 0x13eb, 0x13ee, 0x13f1, 0x13f4, 0x13f7, + 0x13fa, 0x13fd, 0x1400, 0x1403, 0x1406, 0x1409, 0x140c, 0x140f, + 0x1412, 0x1415, 0x1418, 0x141b, 0x141e, 0x1421, 0x1424, 0x1427, + 0x142a, 0x142d, 0x1430, 0x1433, 0x1436, 0x1439, 0x143c, 0x143f, + // Entry 4C0 - 4FF + 0x1442, 0x1445, 0x1448, 0x1451, 0x145a, 0x1463, 0x146c, 0x1475, + 0x147e, 0x1487, 0x1490, 0x1499, 0x149c, 0x149f, 0x14a2, 0x14a5, + 0x14a8, 0x14ab, 0x14ae, 0x14b1, 0x14b4, 0x14b7, 0x14ba, 0x14bd, + 0x14c0, 0x14c3, 0x14c6, 0x14c9, 0x14cc, 0x14cf, 0x14d2, 0x14d5, + 0x14d8, 0x14db, 0x14de, 0x14e1, 0x14e4, 0x14e7, 0x14ea, 0x14ed, + 0x14f0, 0x14f3, 0x14f6, 0x14f9, 0x14fc, 0x14ff, 0x1502, 0x1505, + 0x1508, 0x150b, 0x150e, 0x1511, 0x1514, 0x1517, 0x151a, 0x151d, + 0x1520, 0x1523, 0x1526, 0x1529, 0x152c, 0x152f, 0x1532, 0x1535, + // Entry 500 - 53F + 0x1538, 0x153b, 0x153e, 0x1541, 0x1544, 0x1547, 0x154a, 0x154d, + 0x1550, 0x1553, 0x1556, 0x1559, 0x155c, 0x155f, 0x1562, 0x1565, + 0x1568, 0x156b, 0x156e, 0x1571, 0x1574, 0x1577, 0x157a, 0x157d, + 0x1580, 0x1583, 0x1586, 0x1589, 0x158c, 0x158f, 0x1592, 0x1595, + 0x1598, 0x159b, 0x159e, 0x15a1, 0x15a4, 0x15a7, 0x15aa, 0x15ad, + 0x15b0, 0x15b3, 0x15b6, 0x15b9, 0x15bc, 0x15bf, 0x15c2, 0x15c5, + 0x15c8, 0x15cb, 0x15ce, 0x15d1, 0x15d4, 0x15d7, 0x15da, 0x15dd, + 0x15e0, 0x15e3, 0x15e6, 0x15e9, 0x15ec, 0x15ef, 0x15f2, 0x15f5, + // Entry 540 - 57F + 0x15f8, 0x15fb, 0x15fe, 0x1601, 0x1604, 0x1607, 0x160a, 0x160d, + 0x1610, 0x1613, 0x1616, 0x1619, 0x161c, 0x161f, 0x1622, 0x1625, + 0x1628, 0x162b, 0x162e, 0x1631, 0x1634, 0x1637, 0x163a, 0x163d, + 0x1640, 0x1643, 0x1646, 0x1649, 0x164c, 0x164f, 0x1652, 0x1655, + 0x1658, 0x165b, 0x165e, 0x1661, 0x1664, 0x1667, 0x166a, 0x166d, + 0x1670, 0x1673, 0x1676, 0x1679, 0x167c, 0x167f, 0x1682, 0x1685, + 0x1688, 0x168b, 0x168e, 0x1691, 0x1694, 0x1697, 0x169a, 0x169d, + 0x16a0, 0x16a3, 0x16a6, 0x16a9, 0x16ac, 0x16af, 0x16b2, 0x16b5, + // Entry 580 - 5BF + 0x16b8, 0x16bb, 0x16be, 0x16c1, 0x16c4, 0x16c7, 0x16ca, 0x16cd, + 0x16d0, 0x16d3, 0x16d6, 0x16d9, 0x16dc, 0x16df, 0x16e2, 0x16e5, + 0x16e8, 0x16eb, 0x16ee, 0x16f1, 0x16f4, 0x16f7, 0x16fa, 0x16fd, + 0x1700, 0x1703, 0x1706, 0x1709, 0x170c, 0x170f, 0x1712, 0x1715, + 0x1718, 0x171b, 0x171e, 0x1721, 0x1724, 0x1727, 0x172a, 0x172d, + 0x1730, 0x1733, 0x1736, 0x1739, 0x173c, 0x173f, 0x1742, 0x1745, + 0x1748, 0x174b, 0x174e, 0x1751, 0x1754, 0x1757, 0x175a, 0x175d, + 0x1760, 0x1763, 0x1766, 0x1769, 0x176c, 0x176f, 0x1772, 0x1775, + // Entry 5C0 - 5FF + 0x1778, 0x177b, 0x177e, 0x1781, 0x1784, 0x1787, 0x178a, 0x178d, + 0x1790, 0x1793, 0x1796, 0x1799, 0x179c, 0x179f, 0x17a2, 0x17a5, + 0x17a8, 0x17ab, 0x17ae, 0x17b1, 0x17b4, 0x17b7, 0x17ba, 0x17bd, + 0x17c0, 0x17c3, 0x17c6, 0x17c9, 0x17cc, 0x17cf, 0x17d2, 0x17d5, + 0x17d8, 0x17db, 0x17de, 0x17e1, 0x17e4, 0x17e7, 0x17ea, 0x17ed, + 0x17f0, 0x17f3, 0x17f6, 0x17f9, 0x17fc, 0x17ff, 0x1802, 0x1805, + 0x1808, 0x180b, 0x180e, 0x1811, 0x1814, 0x1817, 0x181a, 0x181d, + 0x1820, 0x1823, 0x1826, 0x1829, 0x182c, 0x182f, 0x1832, 0x1835, + // Entry 600 - 63F + 0x1838, 0x183b, 0x183e, 0x1841, 0x1844, 0x1847, 0x184a, 0x184d, + 0x1850, 0x1853, 0x1856, 0x1859, 0x185c, 0x185f, 0x1862, 0x1865, + 0x1868, 0x186b, 0x186e, 0x1871, 0x1874, 0x1877, 0x187a, 0x187d, + 0x1880, 0x1883, 0x1886, 0x1889, 0x188c, 0x188f, 0x1892, 0x1895, + 0x1898, 0x189b, 0x189e, 0x18a1, 0x18a4, 0x18a7, 0x18aa, 0x18ad, + 0x18b0, 0x18b3, 0x18b6, 0x18b9, 0x18bc, 0x18bf, 0x18c2, 0x18c5, + 0x18c8, 0x18cb, 0x18ce, 0x18d1, 0x18d4, 0x18d7, 0x18da, 0x18dd, + 0x18e0, 0x18e3, 0x18e6, 0x18e9, 0x18ec, 0x18ef, 0x18f2, 0x18f5, + // Entry 640 - 67F + 0x18f8, 0x18fb, 0x18fe, 0x1901, 0x1904, 0x1907, 0x190a, 0x190d, + 0x1910, 0x1913, 0x1916, 0x1919, 0x191c, 0x191f, 0x1922, 0x1925, + 0x1928, 0x192b, 0x192e, 0x1931, 0x1934, 0x1937, 0x193a, 0x193d, + 0x1940, 0x1943, 0x1946, 0x1949, 0x194c, 0x194f, 0x1952, 0x1955, + 0x1958, 0x195b, 0x195e, 0x1961, 0x1964, 0x1967, 0x196a, 0x196d, + 0x1970, 0x1973, 0x1976, 0x1979, 0x197c, 0x197f, 0x1982, 0x1985, + 0x1988, 0x198b, +} // Size: 3324 bytes var xorData string = "" + // Size: 4862 bytes "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + @@ -547,7 +690,7 @@ func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// idnaTrie. Total size: 30288 bytes (29.58 KiB). Checksum: c0cd84404a2f6f19. +// idnaTrie. Total size: 30196 bytes (29.49 KiB). Checksum: e2ae95a945f04016. type idnaTrie struct{} func newIdnaTrie(i int) *idnaTrie { @@ -600,11 +743,11 @@ var idnaValues = [8192]uint16{ 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, - 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x001a, 0xe9: 0x0018, - 0xea: 0x0039, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x004a, - 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0069, 0xf3: 0x0079, 0xf4: 0x008a, 0xf5: 0x0005, - 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x00aa, 0xf9: 0x00c9, 0xfa: 0x00d9, 0xfb: 0x0018, - 0xfc: 0x00e9, 0xfd: 0x0119, 0xfe: 0x0149, 0xff: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x0012, 0xe9: 0x0018, + 0xea: 0x0019, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x0022, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0029, 0xf3: 0x0031, 0xf4: 0x003a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x0042, 0xf9: 0x0049, 0xfa: 0x0051, 0xfb: 0x0018, + 0xfc: 0x0059, 0xfd: 0x0061, 0xfe: 0x0069, 0xff: 0x0018, // Block 0x4, offset 0x100 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, @@ -614,12 +757,12 @@ var idnaValues = [8192]uint16{ 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, - 0x130: 0x0179, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x130: 0x0071, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, - 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0199, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0079, // Block 0x5, offset 0x140 - 0x140: 0x0199, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, - 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x01b9, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x140: 0x0079, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x0081, 0x14a: 0xe00d, 0x14b: 0x0008, 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, @@ -628,7 +771,7 @@ var idnaValues = [8192]uint16{ 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, - 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x01d9, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x0089, // Block 0x6, offset 0x180 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, @@ -642,8 +785,8 @@ var idnaValues = [8192]uint16{ 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, // Block 0x7, offset 0x1c0 - 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x01e9, 0x1c5: 0x01e9, - 0x1c6: 0x01e9, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x0091, 0x1c5: 0x0091, + 0x1c6: 0x0091, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, @@ -663,22 +806,22 @@ var idnaValues = [8192]uint16{ 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, - 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0209, 0x23b: 0xe03d, - 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x0229, 0x23f: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0099, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x00a1, 0x23f: 0x0008, // Block 0x9, offset 0x240 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, - 0x258: 0x029a, 0x259: 0x02ba, 0x25a: 0x02da, 0x25b: 0x02fa, 0x25c: 0x031a, 0x25d: 0x033a, - 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0359, 0x262: 0x01d9, 0x263: 0x0369, + 0x258: 0x00d2, 0x259: 0x00da, 0x25a: 0x00e2, 0x25b: 0x00ea, 0x25c: 0x00f2, 0x25d: 0x00fa, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0101, 0x262: 0x0089, 0x263: 0x0109, 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, // Block 0xa, offset 0x280 - 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0379, 0x285: 0x040d, + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0111, 0x285: 0x040d, 0x286: 0x3308, 0x287: 0x3308, 0x288: 0x3308, 0x289: 0x3308, 0x28a: 0x3308, 0x28b: 0x3308, 0x28c: 0x3308, 0x28d: 0x3308, 0x28e: 0x3308, 0x28f: 0x33c0, 0x290: 0x3308, 0x291: 0x3308, 0x292: 0x3308, 0x293: 0x3308, 0x294: 0x3308, 0x295: 0x3308, 0x296: 0x3308, 0x297: 0x3308, @@ -687,10 +830,10 @@ var idnaValues = [8192]uint16{ 0x2a4: 0x3308, 0x2a5: 0x3308, 0x2a6: 0x3308, 0x2a7: 0x3308, 0x2a8: 0x3308, 0x2a9: 0x3308, 0x2aa: 0x3308, 0x2ab: 0x3308, 0x2ac: 0x3308, 0x2ad: 0x3308, 0x2ae: 0x3308, 0x2af: 0x3308, 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, - 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x03a2, 0x2bb: 0x0008, - 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x03c2, 0x2bf: 0x043d, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x011a, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x0122, 0x2bf: 0x043d, // Block 0xb, offset 0x2c0 - 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x008a, 0x2c5: 0x03d2, + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x003a, 0x2c5: 0x012a, 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, @@ -782,8 +925,8 @@ var idnaValues = [8192]uint16{ 0x49e: 0x3308, 0x49f: 0x3308, 0x4a0: 0x0808, 0x4a1: 0x0808, 0x4a2: 0x0808, 0x4a3: 0x0808, 0x4a4: 0x0808, 0x4a5: 0x0808, 0x4a6: 0x0808, 0x4a7: 0x0808, 0x4a8: 0x0808, 0x4a9: 0x0808, 0x4aa: 0x0018, 0x4ab: 0x0818, 0x4ac: 0x0818, 0x4ad: 0x0818, 0x4ae: 0x0a08, 0x4af: 0x0a08, - 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0429, - 0x4b6: 0x0451, 0x4b7: 0x0479, 0x4b8: 0x04a1, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, + 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0139, + 0x4b6: 0x0141, 0x4b7: 0x0149, 0x4b8: 0x0151, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, 0x4bc: 0x0a08, 0x4bd: 0x0a08, 0x4be: 0x0a08, 0x4bf: 0x0a08, // Block 0x13, offset 0x4c0 0x4c0: 0x0c08, 0x4c1: 0x0a08, 0x4c2: 0x0a08, 0x4c3: 0x0c08, 0x4c4: 0x0c08, 0x4c5: 0x0c08, @@ -826,8 +969,8 @@ var idnaValues = [8192]uint16{ 0x586: 0x3308, 0x587: 0x3308, 0x588: 0x3308, 0x589: 0x3008, 0x58a: 0x3008, 0x58b: 0x3008, 0x58c: 0x3008, 0x58d: 0x3b08, 0x58e: 0x3008, 0x58f: 0x3008, 0x590: 0x0008, 0x591: 0x3308, 0x592: 0x3308, 0x593: 0x3308, 0x594: 0x3308, 0x595: 0x3308, 0x596: 0x3308, 0x597: 0x3308, - 0x598: 0x04c9, 0x599: 0x0501, 0x59a: 0x0539, 0x59b: 0x0571, 0x59c: 0x05a9, 0x59d: 0x05e1, - 0x59e: 0x0619, 0x59f: 0x0651, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x3308, 0x5a3: 0x3308, + 0x598: 0x0159, 0x599: 0x0161, 0x59a: 0x0169, 0x59b: 0x0171, 0x59c: 0x0179, 0x59d: 0x0181, + 0x59e: 0x0189, 0x59f: 0x0191, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x3308, 0x5a3: 0x3308, 0x5a4: 0x0018, 0x5a5: 0x0018, 0x5a6: 0x0008, 0x5a7: 0x0008, 0x5a8: 0x0008, 0x5a9: 0x0008, 0x5aa: 0x0008, 0x5ab: 0x0008, 0x5ac: 0x0008, 0x5ad: 0x0008, 0x5ae: 0x0008, 0x5af: 0x0008, 0x5b0: 0x0018, 0x5b1: 0x0008, 0x5b2: 0x0008, 0x5b3: 0x0008, 0x5b4: 0x0008, 0x5b5: 0x0008, @@ -850,8 +993,8 @@ var idnaValues = [8192]uint16{ 0x606: 0x0040, 0x607: 0x3008, 0x608: 0x3008, 0x609: 0x0040, 0x60a: 0x0040, 0x60b: 0x3008, 0x60c: 0x3008, 0x60d: 0x3b08, 0x60e: 0x0008, 0x60f: 0x0040, 0x610: 0x0040, 0x611: 0x0040, 0x612: 0x0040, 0x613: 0x0040, 0x614: 0x0040, 0x615: 0x0040, 0x616: 0x0040, 0x617: 0x3008, - 0x618: 0x0040, 0x619: 0x0040, 0x61a: 0x0040, 0x61b: 0x0040, 0x61c: 0x0689, 0x61d: 0x06c1, - 0x61e: 0x0040, 0x61f: 0x06f9, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x3308, 0x623: 0x3308, + 0x618: 0x0040, 0x619: 0x0040, 0x61a: 0x0040, 0x61b: 0x0040, 0x61c: 0x0199, 0x61d: 0x01a1, + 0x61e: 0x0040, 0x61f: 0x01a9, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x3308, 0x623: 0x3308, 0x624: 0x0040, 0x625: 0x0040, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0008, 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, 0x630: 0x0008, 0x631: 0x0008, 0x632: 0x0018, 0x633: 0x0018, 0x634: 0x0018, 0x635: 0x0018, @@ -866,16 +1009,16 @@ var idnaValues = [8192]uint16{ 0x65e: 0x0008, 0x65f: 0x0008, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x0008, 0x663: 0x0008, 0x664: 0x0008, 0x665: 0x0008, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0040, 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, - 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x0731, 0x674: 0x0040, 0x675: 0x0008, - 0x676: 0x0769, 0x677: 0x0040, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, + 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x01b1, 0x674: 0x0040, 0x675: 0x0008, + 0x676: 0x01b9, 0x677: 0x0040, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, 0x67c: 0x3308, 0x67d: 0x0040, 0x67e: 0x3008, 0x67f: 0x3008, // Block 0x1a, offset 0x680 0x680: 0x3008, 0x681: 0x3308, 0x682: 0x3308, 0x683: 0x0040, 0x684: 0x0040, 0x685: 0x0040, 0x686: 0x0040, 0x687: 0x3308, 0x688: 0x3308, 0x689: 0x0040, 0x68a: 0x0040, 0x68b: 0x3308, 0x68c: 0x3308, 0x68d: 0x3b08, 0x68e: 0x0040, 0x68f: 0x0040, 0x690: 0x0040, 0x691: 0x3308, 0x692: 0x0040, 0x693: 0x0040, 0x694: 0x0040, 0x695: 0x0040, 0x696: 0x0040, 0x697: 0x0040, - 0x698: 0x0040, 0x699: 0x07a1, 0x69a: 0x07d9, 0x69b: 0x0811, 0x69c: 0x0008, 0x69d: 0x0040, - 0x69e: 0x0849, 0x69f: 0x0040, 0x6a0: 0x0040, 0x6a1: 0x0040, 0x6a2: 0x0040, 0x6a3: 0x0040, + 0x698: 0x0040, 0x699: 0x01c1, 0x69a: 0x01c9, 0x69b: 0x01d1, 0x69c: 0x0008, 0x69d: 0x0040, + 0x69e: 0x01d9, 0x69f: 0x0040, 0x6a0: 0x0040, 0x6a1: 0x0040, 0x6a2: 0x0040, 0x6a3: 0x0040, 0x6a4: 0x0040, 0x6a5: 0x0040, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0008, 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, 0x6b0: 0x3308, 0x6b1: 0x3308, 0x6b2: 0x0008, 0x6b3: 0x0008, 0x6b4: 0x0008, 0x6b5: 0x3308, @@ -922,7 +1065,7 @@ var idnaValues = [8192]uint16{ 0x786: 0x0040, 0x787: 0x3008, 0x788: 0x3008, 0x789: 0x0040, 0x78a: 0x0040, 0x78b: 0x3008, 0x78c: 0x3008, 0x78d: 0x3b08, 0x78e: 0x0040, 0x78f: 0x0040, 0x790: 0x0040, 0x791: 0x0040, 0x792: 0x0040, 0x793: 0x0040, 0x794: 0x0040, 0x795: 0x3308, 0x796: 0x3308, 0x797: 0x3008, - 0x798: 0x0040, 0x799: 0x0040, 0x79a: 0x0040, 0x79b: 0x0040, 0x79c: 0x0881, 0x79d: 0x08b9, + 0x798: 0x0040, 0x799: 0x0040, 0x79a: 0x0040, 0x79b: 0x0040, 0x79c: 0x01e1, 0x79d: 0x01e9, 0x79e: 0x0040, 0x79f: 0x0008, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x3308, 0x7a3: 0x3308, 0x7a4: 0x0040, 0x7a5: 0x0040, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0008, 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, @@ -998,32 +1141,32 @@ var idnaValues = [8192]uint16{ 0x91e: 0x0008, 0x91f: 0x0008, 0x920: 0x0008, 0x921: 0x0008, 0x922: 0x0008, 0x923: 0x0008, 0x924: 0x0040, 0x925: 0x0008, 0x926: 0x0040, 0x927: 0x0008, 0x928: 0x0008, 0x929: 0x0008, 0x92a: 0x0008, 0x92b: 0x0008, 0x92c: 0x0008, 0x92d: 0x0008, 0x92e: 0x0008, 0x92f: 0x0008, - 0x930: 0x0008, 0x931: 0x3308, 0x932: 0x0008, 0x933: 0x0929, 0x934: 0x3308, 0x935: 0x3308, + 0x930: 0x0008, 0x931: 0x3308, 0x932: 0x0008, 0x933: 0x01f9, 0x934: 0x3308, 0x935: 0x3308, 0x936: 0x3308, 0x937: 0x3308, 0x938: 0x3308, 0x939: 0x3308, 0x93a: 0x3b08, 0x93b: 0x3308, 0x93c: 0x3308, 0x93d: 0x0008, 0x93e: 0x0040, 0x93f: 0x0040, // Block 0x25, offset 0x940 - 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x09d1, 0x944: 0x0008, 0x945: 0x0008, + 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0211, 0x944: 0x0008, 0x945: 0x0008, 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0040, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0008, - 0x94c: 0x0008, 0x94d: 0x0a09, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, - 0x952: 0x0a41, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0a79, - 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0ab1, 0x95d: 0x0008, + 0x94c: 0x0008, 0x94d: 0x0219, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0221, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0229, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0231, 0x95d: 0x0008, 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, - 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0ae9, + 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0239, 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0008, 0x96d: 0x0040, 0x96e: 0x0040, 0x96f: 0x0040, - 0x970: 0x0040, 0x971: 0x3308, 0x972: 0x3308, 0x973: 0x0b21, 0x974: 0x3308, 0x975: 0x0b59, - 0x976: 0x0b91, 0x977: 0x0bc9, 0x978: 0x0c19, 0x979: 0x0c51, 0x97a: 0x3308, 0x97b: 0x3308, + 0x970: 0x0040, 0x971: 0x3308, 0x972: 0x3308, 0x973: 0x0241, 0x974: 0x3308, 0x975: 0x0249, + 0x976: 0x0251, 0x977: 0x0259, 0x978: 0x0261, 0x979: 0x0269, 0x97a: 0x3308, 0x97b: 0x3308, 0x97c: 0x3308, 0x97d: 0x3308, 0x97e: 0x3308, 0x97f: 0x3008, // Block 0x26, offset 0x980 - 0x980: 0x3308, 0x981: 0x0ca1, 0x982: 0x3308, 0x983: 0x3308, 0x984: 0x3b08, 0x985: 0x0018, + 0x980: 0x3308, 0x981: 0x0271, 0x982: 0x3308, 0x983: 0x3308, 0x984: 0x3b08, 0x985: 0x0018, 0x986: 0x3308, 0x987: 0x3308, 0x988: 0x0008, 0x989: 0x0008, 0x98a: 0x0008, 0x98b: 0x0008, 0x98c: 0x0008, 0x98d: 0x3308, 0x98e: 0x3308, 0x98f: 0x3308, 0x990: 0x3308, 0x991: 0x3308, - 0x992: 0x3308, 0x993: 0x0cd9, 0x994: 0x3308, 0x995: 0x3308, 0x996: 0x3308, 0x997: 0x3308, - 0x998: 0x0040, 0x999: 0x3308, 0x99a: 0x3308, 0x99b: 0x3308, 0x99c: 0x3308, 0x99d: 0x0d11, - 0x99e: 0x3308, 0x99f: 0x3308, 0x9a0: 0x3308, 0x9a1: 0x3308, 0x9a2: 0x0d49, 0x9a3: 0x3308, - 0x9a4: 0x3308, 0x9a5: 0x3308, 0x9a6: 0x3308, 0x9a7: 0x0d81, 0x9a8: 0x3308, 0x9a9: 0x3308, - 0x9aa: 0x3308, 0x9ab: 0x3308, 0x9ac: 0x0db9, 0x9ad: 0x3308, 0x9ae: 0x3308, 0x9af: 0x3308, + 0x992: 0x3308, 0x993: 0x0279, 0x994: 0x3308, 0x995: 0x3308, 0x996: 0x3308, 0x997: 0x3308, + 0x998: 0x0040, 0x999: 0x3308, 0x99a: 0x3308, 0x99b: 0x3308, 0x99c: 0x3308, 0x99d: 0x0281, + 0x99e: 0x3308, 0x99f: 0x3308, 0x9a0: 0x3308, 0x9a1: 0x3308, 0x9a2: 0x0289, 0x9a3: 0x3308, + 0x9a4: 0x3308, 0x9a5: 0x3308, 0x9a6: 0x3308, 0x9a7: 0x0291, 0x9a8: 0x3308, 0x9a9: 0x3308, + 0x9aa: 0x3308, 0x9ab: 0x3308, 0x9ac: 0x0299, 0x9ad: 0x3308, 0x9ae: 0x3308, 0x9af: 0x3308, 0x9b0: 0x3308, 0x9b1: 0x3308, 0x9b2: 0x3308, 0x9b3: 0x3308, 0x9b4: 0x3308, 0x9b5: 0x3308, - 0x9b6: 0x3308, 0x9b7: 0x3308, 0x9b8: 0x3308, 0x9b9: 0x0df1, 0x9ba: 0x3308, 0x9bb: 0x3308, + 0x9b6: 0x3308, 0x9b7: 0x3308, 0x9b8: 0x3308, 0x9b9: 0x02a1, 0x9ba: 0x3308, 0x9bb: 0x3308, 0x9bc: 0x3308, 0x9bd: 0x0040, 0x9be: 0x0018, 0x9bf: 0x0018, // Block 0x27, offset 0x9c0 0x9c0: 0x0008, 0x9c1: 0x0008, 0x9c2: 0x0008, 0x9c3: 0x0008, 0x9c4: 0x0008, 0x9c5: 0x0008, @@ -1033,34 +1176,34 @@ var idnaValues = [8192]uint16{ 0x9d8: 0x0008, 0x9d9: 0x0008, 0x9da: 0x0008, 0x9db: 0x0008, 0x9dc: 0x0008, 0x9dd: 0x0008, 0x9de: 0x0008, 0x9df: 0x0008, 0x9e0: 0x0008, 0x9e1: 0x0008, 0x9e2: 0x0008, 0x9e3: 0x0008, 0x9e4: 0x0008, 0x9e5: 0x0008, 0x9e6: 0x0008, 0x9e7: 0x0008, 0x9e8: 0x0008, 0x9e9: 0x0008, - 0x9ea: 0x0008, 0x9eb: 0x0008, 0x9ec: 0x0039, 0x9ed: 0x0ed1, 0x9ee: 0x0ee9, 0x9ef: 0x0008, - 0x9f0: 0x0ef9, 0x9f1: 0x0f09, 0x9f2: 0x0f19, 0x9f3: 0x0f31, 0x9f4: 0x0249, 0x9f5: 0x0f41, - 0x9f6: 0x0259, 0x9f7: 0x0f51, 0x9f8: 0x0359, 0x9f9: 0x0f61, 0x9fa: 0x0f71, 0x9fb: 0x0008, - 0x9fc: 0x00d9, 0x9fd: 0x0f81, 0x9fe: 0x0f99, 0x9ff: 0x0269, + 0x9ea: 0x0008, 0x9eb: 0x0008, 0x9ec: 0x0019, 0x9ed: 0x02e1, 0x9ee: 0x02e9, 0x9ef: 0x0008, + 0x9f0: 0x02f1, 0x9f1: 0x02f9, 0x9f2: 0x0301, 0x9f3: 0x0309, 0x9f4: 0x00a9, 0x9f5: 0x0311, + 0x9f6: 0x00b1, 0x9f7: 0x0319, 0x9f8: 0x0101, 0x9f9: 0x0321, 0x9fa: 0x0329, 0x9fb: 0x0008, + 0x9fc: 0x0051, 0x9fd: 0x0331, 0x9fe: 0x0339, 0x9ff: 0x00b9, // Block 0x28, offset 0xa00 - 0xa00: 0x0fa9, 0xa01: 0x0fb9, 0xa02: 0x0279, 0xa03: 0x0039, 0xa04: 0x0fc9, 0xa05: 0x0fe1, - 0xa06: 0x05b5, 0xa07: 0x0ee9, 0xa08: 0x0ef9, 0xa09: 0x0f09, 0xa0a: 0x0ff9, 0xa0b: 0x1011, - 0xa0c: 0x1029, 0xa0d: 0x0f31, 0xa0e: 0x0008, 0xa0f: 0x0f51, 0xa10: 0x0f61, 0xa11: 0x1041, - 0xa12: 0x00d9, 0xa13: 0x1059, 0xa14: 0x05cd, 0xa15: 0x05cd, 0xa16: 0x0f99, 0xa17: 0x0fa9, - 0xa18: 0x0fb9, 0xa19: 0x05b5, 0xa1a: 0x1071, 0xa1b: 0x1089, 0xa1c: 0x05e5, 0xa1d: 0x1099, - 0xa1e: 0x10b1, 0xa1f: 0x10c9, 0xa20: 0x10e1, 0xa21: 0x10f9, 0xa22: 0x0f41, 0xa23: 0x0269, - 0xa24: 0x0fb9, 0xa25: 0x1089, 0xa26: 0x1099, 0xa27: 0x10b1, 0xa28: 0x1111, 0xa29: 0x10e1, - 0xa2a: 0x10f9, 0xa2b: 0x0008, 0xa2c: 0x0008, 0xa2d: 0x0008, 0xa2e: 0x0008, 0xa2f: 0x0008, + 0xa00: 0x0341, 0xa01: 0x0349, 0xa02: 0x00c1, 0xa03: 0x0019, 0xa04: 0x0351, 0xa05: 0x0359, + 0xa06: 0x05b5, 0xa07: 0x02e9, 0xa08: 0x02f1, 0xa09: 0x02f9, 0xa0a: 0x0361, 0xa0b: 0x0369, + 0xa0c: 0x0371, 0xa0d: 0x0309, 0xa0e: 0x0008, 0xa0f: 0x0319, 0xa10: 0x0321, 0xa11: 0x0379, + 0xa12: 0x0051, 0xa13: 0x0381, 0xa14: 0x05cd, 0xa15: 0x05cd, 0xa16: 0x0339, 0xa17: 0x0341, + 0xa18: 0x0349, 0xa19: 0x05b5, 0xa1a: 0x0389, 0xa1b: 0x0391, 0xa1c: 0x05e5, 0xa1d: 0x0399, + 0xa1e: 0x03a1, 0xa1f: 0x03a9, 0xa20: 0x03b1, 0xa21: 0x03b9, 0xa22: 0x0311, 0xa23: 0x00b9, + 0xa24: 0x0349, 0xa25: 0x0391, 0xa26: 0x0399, 0xa27: 0x03a1, 0xa28: 0x03c1, 0xa29: 0x03b1, + 0xa2a: 0x03b9, 0xa2b: 0x0008, 0xa2c: 0x0008, 0xa2d: 0x0008, 0xa2e: 0x0008, 0xa2f: 0x0008, 0xa30: 0x0008, 0xa31: 0x0008, 0xa32: 0x0008, 0xa33: 0x0008, 0xa34: 0x0008, 0xa35: 0x0008, - 0xa36: 0x0008, 0xa37: 0x0008, 0xa38: 0x1129, 0xa39: 0x0008, 0xa3a: 0x0008, 0xa3b: 0x0008, + 0xa36: 0x0008, 0xa37: 0x0008, 0xa38: 0x03c9, 0xa39: 0x0008, 0xa3a: 0x0008, 0xa3b: 0x0008, 0xa3c: 0x0008, 0xa3d: 0x0008, 0xa3e: 0x0008, 0xa3f: 0x0008, // Block 0x29, offset 0xa40 0xa40: 0x0008, 0xa41: 0x0008, 0xa42: 0x0008, 0xa43: 0x0008, 0xa44: 0x0008, 0xa45: 0x0008, 0xa46: 0x0008, 0xa47: 0x0008, 0xa48: 0x0008, 0xa49: 0x0008, 0xa4a: 0x0008, 0xa4b: 0x0008, 0xa4c: 0x0008, 0xa4d: 0x0008, 0xa4e: 0x0008, 0xa4f: 0x0008, 0xa50: 0x0008, 0xa51: 0x0008, 0xa52: 0x0008, 0xa53: 0x0008, 0xa54: 0x0008, 0xa55: 0x0008, 0xa56: 0x0008, 0xa57: 0x0008, - 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0008, 0xa5b: 0x1141, 0xa5c: 0x1159, 0xa5d: 0x1169, - 0xa5e: 0x1181, 0xa5f: 0x1029, 0xa60: 0x1199, 0xa61: 0x11a9, 0xa62: 0x11c1, 0xa63: 0x11d9, - 0xa64: 0x11f1, 0xa65: 0x1209, 0xa66: 0x1221, 0xa67: 0x05fd, 0xa68: 0x1239, 0xa69: 0x1251, - 0xa6a: 0xe17d, 0xa6b: 0x1269, 0xa6c: 0x1281, 0xa6d: 0x1299, 0xa6e: 0x12b1, 0xa6f: 0x12c9, - 0xa70: 0x12e1, 0xa71: 0x12f9, 0xa72: 0x1311, 0xa73: 0x1329, 0xa74: 0x1341, 0xa75: 0x1359, - 0xa76: 0x1371, 0xa77: 0x1389, 0xa78: 0x0615, 0xa79: 0x13a1, 0xa7a: 0x13b9, 0xa7b: 0x13d1, - 0xa7c: 0x13e1, 0xa7d: 0x13f9, 0xa7e: 0x1411, 0xa7f: 0x1429, + 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0008, 0xa5b: 0x03d1, 0xa5c: 0x03d9, 0xa5d: 0x03e1, + 0xa5e: 0x03e9, 0xa5f: 0x0371, 0xa60: 0x03f1, 0xa61: 0x03f9, 0xa62: 0x0401, 0xa63: 0x0409, + 0xa64: 0x0411, 0xa65: 0x0419, 0xa66: 0x0421, 0xa67: 0x05fd, 0xa68: 0x0429, 0xa69: 0x0431, + 0xa6a: 0xe17d, 0xa6b: 0x0439, 0xa6c: 0x0441, 0xa6d: 0x0449, 0xa6e: 0x0451, 0xa6f: 0x0459, + 0xa70: 0x0461, 0xa71: 0x0469, 0xa72: 0x0471, 0xa73: 0x0479, 0xa74: 0x0481, 0xa75: 0x0489, + 0xa76: 0x0491, 0xa77: 0x0499, 0xa78: 0x0615, 0xa79: 0x04a1, 0xa7a: 0x04a9, 0xa7b: 0x04b1, + 0xa7c: 0x04b9, 0xa7d: 0x04c1, 0xa7e: 0x04c9, 0xa7f: 0x04d1, // Block 0x2a, offset 0xa80 0xa80: 0xe00d, 0xa81: 0x0008, 0xa82: 0xe00d, 0xa83: 0x0008, 0xa84: 0xe00d, 0xa85: 0x0008, 0xa86: 0xe00d, 0xa87: 0x0008, 0xa88: 0xe00d, 0xa89: 0x0008, 0xa8a: 0xe00d, 0xa8b: 0x0008, @@ -1079,7 +1222,7 @@ var idnaValues = [8192]uint16{ 0xacc: 0xe00d, 0xacd: 0x0008, 0xace: 0xe00d, 0xacf: 0x0008, 0xad0: 0xe00d, 0xad1: 0x0008, 0xad2: 0xe00d, 0xad3: 0x0008, 0xad4: 0xe00d, 0xad5: 0x0008, 0xad6: 0x0008, 0xad7: 0x0008, 0xad8: 0x0008, 0xad9: 0x0008, 0xada: 0x062d, 0xadb: 0x064d, 0xadc: 0x0008, 0xadd: 0x0008, - 0xade: 0x1441, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, + 0xade: 0x04d9, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, 0xae4: 0xe00d, 0xae5: 0x0008, 0xae6: 0xe00d, 0xae7: 0x0008, 0xae8: 0xe00d, 0xae9: 0x0008, 0xaea: 0xe00d, 0xaeb: 0x0008, 0xaec: 0xe00d, 0xaed: 0x0008, 0xaee: 0xe00d, 0xaef: 0x0008, 0xaf0: 0xe00d, 0xaf1: 0x0008, 0xaf2: 0xe00d, 0xaf3: 0x0008, 0xaf4: 0xe00d, 0xaf5: 0x0008, @@ -1094,33 +1237,33 @@ var idnaValues = [8192]uint16{ 0xb1e: 0x0040, 0xb1f: 0xe045, 0xb20: 0x0008, 0xb21: 0x0008, 0xb22: 0x0008, 0xb23: 0x0008, 0xb24: 0x0008, 0xb25: 0x0008, 0xb26: 0x0008, 0xb27: 0x0008, 0xb28: 0xe045, 0xb29: 0xe045, 0xb2a: 0xe045, 0xb2b: 0xe045, 0xb2c: 0xe045, 0xb2d: 0xe045, 0xb2e: 0xe045, 0xb2f: 0xe045, - 0xb30: 0x0008, 0xb31: 0x1459, 0xb32: 0x0008, 0xb33: 0x1471, 0xb34: 0x0008, 0xb35: 0x1489, - 0xb36: 0x0008, 0xb37: 0x14a1, 0xb38: 0x0008, 0xb39: 0x14b9, 0xb3a: 0x0008, 0xb3b: 0x14d1, - 0xb3c: 0x0008, 0xb3d: 0x14e9, 0xb3e: 0x0040, 0xb3f: 0x0040, + 0xb30: 0x0008, 0xb31: 0x04e1, 0xb32: 0x0008, 0xb33: 0x04e9, 0xb34: 0x0008, 0xb35: 0x04f1, + 0xb36: 0x0008, 0xb37: 0x04f9, 0xb38: 0x0008, 0xb39: 0x0501, 0xb3a: 0x0008, 0xb3b: 0x0509, + 0xb3c: 0x0008, 0xb3d: 0x0511, 0xb3e: 0x0040, 0xb3f: 0x0040, // Block 0x2d, offset 0xb40 - 0xb40: 0x1501, 0xb41: 0x1531, 0xb42: 0x1561, 0xb43: 0x1591, 0xb44: 0x15c1, 0xb45: 0x15f1, - 0xb46: 0x1621, 0xb47: 0x1651, 0xb48: 0x1501, 0xb49: 0x1531, 0xb4a: 0x1561, 0xb4b: 0x1591, - 0xb4c: 0x15c1, 0xb4d: 0x15f1, 0xb4e: 0x1621, 0xb4f: 0x1651, 0xb50: 0x1681, 0xb51: 0x16b1, - 0xb52: 0x16e1, 0xb53: 0x1711, 0xb54: 0x1741, 0xb55: 0x1771, 0xb56: 0x17a1, 0xb57: 0x17d1, - 0xb58: 0x1681, 0xb59: 0x16b1, 0xb5a: 0x16e1, 0xb5b: 0x1711, 0xb5c: 0x1741, 0xb5d: 0x1771, - 0xb5e: 0x17a1, 0xb5f: 0x17d1, 0xb60: 0x1801, 0xb61: 0x1831, 0xb62: 0x1861, 0xb63: 0x1891, - 0xb64: 0x18c1, 0xb65: 0x18f1, 0xb66: 0x1921, 0xb67: 0x1951, 0xb68: 0x1801, 0xb69: 0x1831, - 0xb6a: 0x1861, 0xb6b: 0x1891, 0xb6c: 0x18c1, 0xb6d: 0x18f1, 0xb6e: 0x1921, 0xb6f: 0x1951, - 0xb70: 0x0008, 0xb71: 0x0008, 0xb72: 0x1981, 0xb73: 0x19b1, 0xb74: 0x19d9, 0xb75: 0x0040, - 0xb76: 0x0008, 0xb77: 0x1a01, 0xb78: 0xe045, 0xb79: 0xe045, 0xb7a: 0x0665, 0xb7b: 0x1459, - 0xb7c: 0x19b1, 0xb7d: 0x067e, 0xb7e: 0x1a31, 0xb7f: 0x069e, + 0xb40: 0x0519, 0xb41: 0x0521, 0xb42: 0x0529, 0xb43: 0x0531, 0xb44: 0x0539, 0xb45: 0x0541, + 0xb46: 0x0549, 0xb47: 0x0551, 0xb48: 0x0519, 0xb49: 0x0521, 0xb4a: 0x0529, 0xb4b: 0x0531, + 0xb4c: 0x0539, 0xb4d: 0x0541, 0xb4e: 0x0549, 0xb4f: 0x0551, 0xb50: 0x0559, 0xb51: 0x0561, + 0xb52: 0x0569, 0xb53: 0x0571, 0xb54: 0x0579, 0xb55: 0x0581, 0xb56: 0x0589, 0xb57: 0x0591, + 0xb58: 0x0559, 0xb59: 0x0561, 0xb5a: 0x0569, 0xb5b: 0x0571, 0xb5c: 0x0579, 0xb5d: 0x0581, + 0xb5e: 0x0589, 0xb5f: 0x0591, 0xb60: 0x0599, 0xb61: 0x05a1, 0xb62: 0x05a9, 0xb63: 0x05b1, + 0xb64: 0x05b9, 0xb65: 0x05c1, 0xb66: 0x05c9, 0xb67: 0x05d1, 0xb68: 0x0599, 0xb69: 0x05a1, + 0xb6a: 0x05a9, 0xb6b: 0x05b1, 0xb6c: 0x05b9, 0xb6d: 0x05c1, 0xb6e: 0x05c9, 0xb6f: 0x05d1, + 0xb70: 0x0008, 0xb71: 0x0008, 0xb72: 0x05d9, 0xb73: 0x05e1, 0xb74: 0x05e9, 0xb75: 0x0040, + 0xb76: 0x0008, 0xb77: 0x05f1, 0xb78: 0xe045, 0xb79: 0xe045, 0xb7a: 0x0665, 0xb7b: 0x04e1, + 0xb7c: 0x05e1, 0xb7d: 0x067e, 0xb7e: 0x05f9, 0xb7f: 0x069e, // Block 0x2e, offset 0xb80 - 0xb80: 0x06be, 0xb81: 0x1a4a, 0xb82: 0x1a79, 0xb83: 0x1aa9, 0xb84: 0x1ad1, 0xb85: 0x0040, - 0xb86: 0x0008, 0xb87: 0x1af9, 0xb88: 0x06dd, 0xb89: 0x1471, 0xb8a: 0x06f5, 0xb8b: 0x1489, - 0xb8c: 0x1aa9, 0xb8d: 0x1b2a, 0xb8e: 0x1b5a, 0xb8f: 0x1b8a, 0xb90: 0x0008, 0xb91: 0x0008, - 0xb92: 0x0008, 0xb93: 0x1bb9, 0xb94: 0x0040, 0xb95: 0x0040, 0xb96: 0x0008, 0xb97: 0x0008, - 0xb98: 0xe045, 0xb99: 0xe045, 0xb9a: 0x070d, 0xb9b: 0x14a1, 0xb9c: 0x0040, 0xb9d: 0x1bd2, - 0xb9e: 0x1c02, 0xb9f: 0x1c32, 0xba0: 0x0008, 0xba1: 0x0008, 0xba2: 0x0008, 0xba3: 0x1c61, + 0xb80: 0x06be, 0xb81: 0x0602, 0xb82: 0x0609, 0xb83: 0x0611, 0xb84: 0x0619, 0xb85: 0x0040, + 0xb86: 0x0008, 0xb87: 0x0621, 0xb88: 0x06dd, 0xb89: 0x04e9, 0xb8a: 0x06f5, 0xb8b: 0x04f1, + 0xb8c: 0x0611, 0xb8d: 0x062a, 0xb8e: 0x0632, 0xb8f: 0x063a, 0xb90: 0x0008, 0xb91: 0x0008, + 0xb92: 0x0008, 0xb93: 0x0641, 0xb94: 0x0040, 0xb95: 0x0040, 0xb96: 0x0008, 0xb97: 0x0008, + 0xb98: 0xe045, 0xb99: 0xe045, 0xb9a: 0x070d, 0xb9b: 0x04f9, 0xb9c: 0x0040, 0xb9d: 0x064a, + 0xb9e: 0x0652, 0xb9f: 0x065a, 0xba0: 0x0008, 0xba1: 0x0008, 0xba2: 0x0008, 0xba3: 0x0661, 0xba4: 0x0008, 0xba5: 0x0008, 0xba6: 0x0008, 0xba7: 0x0008, 0xba8: 0xe045, 0xba9: 0xe045, - 0xbaa: 0x0725, 0xbab: 0x14d1, 0xbac: 0xe04d, 0xbad: 0x1c7a, 0xbae: 0x03d2, 0xbaf: 0x1caa, - 0xbb0: 0x0040, 0xbb1: 0x0040, 0xbb2: 0x1cb9, 0xbb3: 0x1ce9, 0xbb4: 0x1d11, 0xbb5: 0x0040, - 0xbb6: 0x0008, 0xbb7: 0x1d39, 0xbb8: 0x073d, 0xbb9: 0x14b9, 0xbba: 0x0515, 0xbbb: 0x14e9, - 0xbbc: 0x1ce9, 0xbbd: 0x0756, 0xbbe: 0x0776, 0xbbf: 0x0040, + 0xbaa: 0x0725, 0xbab: 0x0509, 0xbac: 0xe04d, 0xbad: 0x066a, 0xbae: 0x012a, 0xbaf: 0x0672, + 0xbb0: 0x0040, 0xbb1: 0x0040, 0xbb2: 0x0679, 0xbb3: 0x0681, 0xbb4: 0x0689, 0xbb5: 0x0040, + 0xbb6: 0x0008, 0xbb7: 0x0691, 0xbb8: 0x073d, 0xbb9: 0x0501, 0xbba: 0x0515, 0xbbb: 0x0511, + 0xbbc: 0x0681, 0xbbd: 0x0756, 0xbbe: 0x0776, 0xbbf: 0x0040, // Block 0x2f, offset 0xbc0 0xbc0: 0x000a, 0xbc1: 0x000a, 0xbc2: 0x000a, 0xbc3: 0x000a, 0xbc4: 0x000a, 0xbc5: 0x000a, 0xbc6: 0x000a, 0xbc7: 0x000a, 0xbc8: 0x000a, 0xbc9: 0x000a, 0xbca: 0x000a, 0xbcb: 0x03c0, @@ -1130,72 +1273,72 @@ var idnaValues = [8192]uint16{ 0xbde: 0x0018, 0xbdf: 0x0018, 0xbe0: 0x0018, 0xbe1: 0x0018, 0xbe2: 0x0018, 0xbe3: 0x0018, 0xbe4: 0x0040, 0xbe5: 0x0040, 0xbe6: 0x0040, 0xbe7: 0x0018, 0xbe8: 0x0040, 0xbe9: 0x0040, 0xbea: 0x0340, 0xbeb: 0x0340, 0xbec: 0x0340, 0xbed: 0x0340, 0xbee: 0x0340, 0xbef: 0x000a, - 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x1d69, 0xbf4: 0x1da1, 0xbf5: 0x0018, - 0xbf6: 0x1df1, 0xbf7: 0x1e29, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, - 0xbfc: 0x1e7a, 0xbfd: 0x0018, 0xbfe: 0x07b6, 0xbff: 0x0018, + 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x0699, 0xbf4: 0x06a1, 0xbf5: 0x0018, + 0xbf6: 0x06a9, 0xbf7: 0x06b1, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, + 0xbfc: 0x06ba, 0xbfd: 0x0018, 0xbfe: 0x07b6, 0xbff: 0x0018, // Block 0x30, offset 0xc00 0xc00: 0x0018, 0xc01: 0x0018, 0xc02: 0x0018, 0xc03: 0x0018, 0xc04: 0x0018, 0xc05: 0x0018, - 0xc06: 0x0018, 0xc07: 0x1e92, 0xc08: 0x1eaa, 0xc09: 0x1ec2, 0xc0a: 0x0018, 0xc0b: 0x0018, + 0xc06: 0x0018, 0xc07: 0x06c2, 0xc08: 0x06ca, 0xc09: 0x06d2, 0xc0a: 0x0018, 0xc0b: 0x0018, 0xc0c: 0x0018, 0xc0d: 0x0018, 0xc0e: 0x0018, 0xc0f: 0x0018, 0xc10: 0x0018, 0xc11: 0x0018, - 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x1ed9, + 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x06d9, 0xc18: 0x0018, 0xc19: 0x0018, 0xc1a: 0x0018, 0xc1b: 0x0018, 0xc1c: 0x0018, 0xc1d: 0x0018, 0xc1e: 0x0018, 0xc1f: 0x000a, 0xc20: 0x03c0, 0xc21: 0x0340, 0xc22: 0x0340, 0xc23: 0x0340, 0xc24: 0x03c0, 0xc25: 0x0040, 0xc26: 0x0040, 0xc27: 0x0040, 0xc28: 0x0040, 0xc29: 0x0040, 0xc2a: 0x0340, 0xc2b: 0x0340, 0xc2c: 0x0340, 0xc2d: 0x0340, 0xc2e: 0x0340, 0xc2f: 0x0340, - 0xc30: 0x1f41, 0xc31: 0x0f41, 0xc32: 0x0040, 0xc33: 0x0040, 0xc34: 0x1f51, 0xc35: 0x1f61, - 0xc36: 0x1f71, 0xc37: 0x1f81, 0xc38: 0x1f91, 0xc39: 0x1fa1, 0xc3a: 0x1fb2, 0xc3b: 0x07d5, - 0xc3c: 0x1fc2, 0xc3d: 0x1fd2, 0xc3e: 0x1fe2, 0xc3f: 0x0f71, + 0xc30: 0x06e1, 0xc31: 0x0311, 0xc32: 0x0040, 0xc33: 0x0040, 0xc34: 0x06e9, 0xc35: 0x06f1, + 0xc36: 0x06f9, 0xc37: 0x0701, 0xc38: 0x0709, 0xc39: 0x0711, 0xc3a: 0x071a, 0xc3b: 0x07d5, + 0xc3c: 0x0722, 0xc3d: 0x072a, 0xc3e: 0x0732, 0xc3f: 0x0329, // Block 0x31, offset 0xc40 - 0xc40: 0x1f41, 0xc41: 0x00c9, 0xc42: 0x0069, 0xc43: 0x0079, 0xc44: 0x1f51, 0xc45: 0x1f61, - 0xc46: 0x1f71, 0xc47: 0x1f81, 0xc48: 0x1f91, 0xc49: 0x1fa1, 0xc4a: 0x1fb2, 0xc4b: 0x07ed, - 0xc4c: 0x1fc2, 0xc4d: 0x1fd2, 0xc4e: 0x1fe2, 0xc4f: 0x0040, 0xc50: 0x0039, 0xc51: 0x0f09, - 0xc52: 0x00d9, 0xc53: 0x0369, 0xc54: 0x0ff9, 0xc55: 0x0249, 0xc56: 0x0f51, 0xc57: 0x0359, - 0xc58: 0x0f61, 0xc59: 0x0f71, 0xc5a: 0x0f99, 0xc5b: 0x01d9, 0xc5c: 0x0fa9, 0xc5d: 0x0040, + 0xc40: 0x06e1, 0xc41: 0x0049, 0xc42: 0x0029, 0xc43: 0x0031, 0xc44: 0x06e9, 0xc45: 0x06f1, + 0xc46: 0x06f9, 0xc47: 0x0701, 0xc48: 0x0709, 0xc49: 0x0711, 0xc4a: 0x071a, 0xc4b: 0x07ed, + 0xc4c: 0x0722, 0xc4d: 0x072a, 0xc4e: 0x0732, 0xc4f: 0x0040, 0xc50: 0x0019, 0xc51: 0x02f9, + 0xc52: 0x0051, 0xc53: 0x0109, 0xc54: 0x0361, 0xc55: 0x00a9, 0xc56: 0x0319, 0xc57: 0x0101, + 0xc58: 0x0321, 0xc59: 0x0329, 0xc5a: 0x0339, 0xc5b: 0x0089, 0xc5c: 0x0341, 0xc5d: 0x0040, 0xc5e: 0x0040, 0xc5f: 0x0040, 0xc60: 0x0018, 0xc61: 0x0018, 0xc62: 0x0018, 0xc63: 0x0018, - 0xc64: 0x0018, 0xc65: 0x0018, 0xc66: 0x0018, 0xc67: 0x0018, 0xc68: 0x1ff1, 0xc69: 0x0018, + 0xc64: 0x0018, 0xc65: 0x0018, 0xc66: 0x0018, 0xc67: 0x0018, 0xc68: 0x0739, 0xc69: 0x0018, 0xc6a: 0x0018, 0xc6b: 0x0018, 0xc6c: 0x0018, 0xc6d: 0x0018, 0xc6e: 0x0018, 0xc6f: 0x0018, 0xc70: 0x0018, 0xc71: 0x0018, 0xc72: 0x0018, 0xc73: 0x0018, 0xc74: 0x0018, 0xc75: 0x0018, 0xc76: 0x0018, 0xc77: 0x0018, 0xc78: 0x0018, 0xc79: 0x0018, 0xc7a: 0x0018, 0xc7b: 0x0018, 0xc7c: 0x0018, 0xc7d: 0x0018, 0xc7e: 0x0018, 0xc7f: 0x0018, // Block 0x32, offset 0xc80 - 0xc80: 0x0806, 0xc81: 0x0826, 0xc82: 0x1159, 0xc83: 0x0845, 0xc84: 0x0018, 0xc85: 0x0866, - 0xc86: 0x0886, 0xc87: 0x1011, 0xc88: 0x0018, 0xc89: 0x08a5, 0xc8a: 0x0f31, 0xc8b: 0x0249, - 0xc8c: 0x0249, 0xc8d: 0x0249, 0xc8e: 0x0249, 0xc8f: 0x2009, 0xc90: 0x0f41, 0xc91: 0x0f41, - 0xc92: 0x0359, 0xc93: 0x0359, 0xc94: 0x0018, 0xc95: 0x0f71, 0xc96: 0x2021, 0xc97: 0x0018, - 0xc98: 0x0018, 0xc99: 0x0f99, 0xc9a: 0x2039, 0xc9b: 0x0269, 0xc9c: 0x0269, 0xc9d: 0x0269, - 0xc9e: 0x0018, 0xc9f: 0x0018, 0xca0: 0x2049, 0xca1: 0x08c5, 0xca2: 0x2061, 0xca3: 0x0018, - 0xca4: 0x13d1, 0xca5: 0x0018, 0xca6: 0x2079, 0xca7: 0x0018, 0xca8: 0x13d1, 0xca9: 0x0018, - 0xcaa: 0x0f51, 0xcab: 0x2091, 0xcac: 0x0ee9, 0xcad: 0x1159, 0xcae: 0x0018, 0xcaf: 0x0f09, - 0xcb0: 0x0f09, 0xcb1: 0x1199, 0xcb2: 0x0040, 0xcb3: 0x0f61, 0xcb4: 0x00d9, 0xcb5: 0x20a9, - 0xcb6: 0x20c1, 0xcb7: 0x20d9, 0xcb8: 0x20f1, 0xcb9: 0x0f41, 0xcba: 0x0018, 0xcbb: 0x08e5, - 0xcbc: 0x2109, 0xcbd: 0x10b1, 0xcbe: 0x10b1, 0xcbf: 0x2109, + 0xc80: 0x0806, 0xc81: 0x0826, 0xc82: 0x03d9, 0xc83: 0x0845, 0xc84: 0x0018, 0xc85: 0x0866, + 0xc86: 0x0886, 0xc87: 0x0369, 0xc88: 0x0018, 0xc89: 0x08a5, 0xc8a: 0x0309, 0xc8b: 0x00a9, + 0xc8c: 0x00a9, 0xc8d: 0x00a9, 0xc8e: 0x00a9, 0xc8f: 0x0741, 0xc90: 0x0311, 0xc91: 0x0311, + 0xc92: 0x0101, 0xc93: 0x0101, 0xc94: 0x0018, 0xc95: 0x0329, 0xc96: 0x0749, 0xc97: 0x0018, + 0xc98: 0x0018, 0xc99: 0x0339, 0xc9a: 0x0751, 0xc9b: 0x00b9, 0xc9c: 0x00b9, 0xc9d: 0x00b9, + 0xc9e: 0x0018, 0xc9f: 0x0018, 0xca0: 0x0759, 0xca1: 0x08c5, 0xca2: 0x0761, 0xca3: 0x0018, + 0xca4: 0x04b1, 0xca5: 0x0018, 0xca6: 0x0769, 0xca7: 0x0018, 0xca8: 0x04b1, 0xca9: 0x0018, + 0xcaa: 0x0319, 0xcab: 0x0771, 0xcac: 0x02e9, 0xcad: 0x03d9, 0xcae: 0x0018, 0xcaf: 0x02f9, + 0xcb0: 0x02f9, 0xcb1: 0x03f1, 0xcb2: 0x0040, 0xcb3: 0x0321, 0xcb4: 0x0051, 0xcb5: 0x0779, + 0xcb6: 0x0781, 0xcb7: 0x0789, 0xcb8: 0x0791, 0xcb9: 0x0311, 0xcba: 0x0018, 0xcbb: 0x08e5, + 0xcbc: 0x0799, 0xcbd: 0x03a1, 0xcbe: 0x03a1, 0xcbf: 0x0799, // Block 0x33, offset 0xcc0 - 0xcc0: 0x0905, 0xcc1: 0x0018, 0xcc2: 0x0018, 0xcc3: 0x0018, 0xcc4: 0x0018, 0xcc5: 0x0ef9, - 0xcc6: 0x0ef9, 0xcc7: 0x0f09, 0xcc8: 0x0f41, 0xcc9: 0x0259, 0xcca: 0x0018, 0xccb: 0x0018, - 0xccc: 0x0018, 0xccd: 0x0018, 0xcce: 0x0008, 0xccf: 0x0018, 0xcd0: 0x2121, 0xcd1: 0x2151, - 0xcd2: 0x2181, 0xcd3: 0x21b9, 0xcd4: 0x21e9, 0xcd5: 0x2219, 0xcd6: 0x2249, 0xcd7: 0x2279, - 0xcd8: 0x22a9, 0xcd9: 0x22d9, 0xcda: 0x2309, 0xcdb: 0x2339, 0xcdc: 0x2369, 0xcdd: 0x2399, - 0xcde: 0x23c9, 0xcdf: 0x23f9, 0xce0: 0x0f41, 0xce1: 0x2421, 0xce2: 0x091d, 0xce3: 0x2439, - 0xce4: 0x1089, 0xce5: 0x2451, 0xce6: 0x093d, 0xce7: 0x2469, 0xce8: 0x2491, 0xce9: 0x0369, - 0xcea: 0x24a9, 0xceb: 0x095d, 0xcec: 0x0359, 0xced: 0x1159, 0xcee: 0x0ef9, 0xcef: 0x0f61, - 0xcf0: 0x0f41, 0xcf1: 0x2421, 0xcf2: 0x097d, 0xcf3: 0x2439, 0xcf4: 0x1089, 0xcf5: 0x2451, - 0xcf6: 0x099d, 0xcf7: 0x2469, 0xcf8: 0x2491, 0xcf9: 0x0369, 0xcfa: 0x24a9, 0xcfb: 0x09bd, - 0xcfc: 0x0359, 0xcfd: 0x1159, 0xcfe: 0x0ef9, 0xcff: 0x0f61, + 0xcc0: 0x0905, 0xcc1: 0x0018, 0xcc2: 0x0018, 0xcc3: 0x0018, 0xcc4: 0x0018, 0xcc5: 0x02f1, + 0xcc6: 0x02f1, 0xcc7: 0x02f9, 0xcc8: 0x0311, 0xcc9: 0x00b1, 0xcca: 0x0018, 0xccb: 0x0018, + 0xccc: 0x0018, 0xccd: 0x0018, 0xcce: 0x0008, 0xccf: 0x0018, 0xcd0: 0x07a1, 0xcd1: 0x07a9, + 0xcd2: 0x07b1, 0xcd3: 0x07b9, 0xcd4: 0x07c1, 0xcd5: 0x07c9, 0xcd6: 0x07d1, 0xcd7: 0x07d9, + 0xcd8: 0x07e1, 0xcd9: 0x07e9, 0xcda: 0x07f1, 0xcdb: 0x07f9, 0xcdc: 0x0801, 0xcdd: 0x0809, + 0xcde: 0x0811, 0xcdf: 0x0819, 0xce0: 0x0311, 0xce1: 0x0821, 0xce2: 0x091d, 0xce3: 0x0829, + 0xce4: 0x0391, 0xce5: 0x0831, 0xce6: 0x093d, 0xce7: 0x0839, 0xce8: 0x0841, 0xce9: 0x0109, + 0xcea: 0x0849, 0xceb: 0x095d, 0xcec: 0x0101, 0xced: 0x03d9, 0xcee: 0x02f1, 0xcef: 0x0321, + 0xcf0: 0x0311, 0xcf1: 0x0821, 0xcf2: 0x097d, 0xcf3: 0x0829, 0xcf4: 0x0391, 0xcf5: 0x0831, + 0xcf6: 0x099d, 0xcf7: 0x0839, 0xcf8: 0x0841, 0xcf9: 0x0109, 0xcfa: 0x0849, 0xcfb: 0x09bd, + 0xcfc: 0x0101, 0xcfd: 0x03d9, 0xcfe: 0x02f1, 0xcff: 0x0321, // Block 0x34, offset 0xd00 0xd00: 0x0018, 0xd01: 0x0018, 0xd02: 0x0018, 0xd03: 0x0018, 0xd04: 0x0018, 0xd05: 0x0018, 0xd06: 0x0018, 0xd07: 0x0018, 0xd08: 0x0018, 0xd09: 0x0018, 0xd0a: 0x0018, 0xd0b: 0x0040, 0xd0c: 0x0040, 0xd0d: 0x0040, 0xd0e: 0x0040, 0xd0f: 0x0040, 0xd10: 0x0040, 0xd11: 0x0040, 0xd12: 0x0040, 0xd13: 0x0040, 0xd14: 0x0040, 0xd15: 0x0040, 0xd16: 0x0040, 0xd17: 0x0040, 0xd18: 0x0040, 0xd19: 0x0040, 0xd1a: 0x0040, 0xd1b: 0x0040, 0xd1c: 0x0040, 0xd1d: 0x0040, - 0xd1e: 0x0040, 0xd1f: 0x0040, 0xd20: 0x00c9, 0xd21: 0x0069, 0xd22: 0x0079, 0xd23: 0x1f51, - 0xd24: 0x1f61, 0xd25: 0x1f71, 0xd26: 0x1f81, 0xd27: 0x1f91, 0xd28: 0x1fa1, 0xd29: 0x2601, - 0xd2a: 0x2619, 0xd2b: 0x2631, 0xd2c: 0x2649, 0xd2d: 0x2661, 0xd2e: 0x2679, 0xd2f: 0x2691, - 0xd30: 0x26a9, 0xd31: 0x26c1, 0xd32: 0x26d9, 0xd33: 0x26f1, 0xd34: 0x0a1e, 0xd35: 0x0a3e, + 0xd1e: 0x0040, 0xd1f: 0x0040, 0xd20: 0x0049, 0xd21: 0x0029, 0xd22: 0x0031, 0xd23: 0x06e9, + 0xd24: 0x06f1, 0xd25: 0x06f9, 0xd26: 0x0701, 0xd27: 0x0709, 0xd28: 0x0711, 0xd29: 0x0879, + 0xd2a: 0x0881, 0xd2b: 0x0889, 0xd2c: 0x0891, 0xd2d: 0x0899, 0xd2e: 0x08a1, 0xd2f: 0x08a9, + 0xd30: 0x08b1, 0xd31: 0x08b9, 0xd32: 0x08c1, 0xd33: 0x08c9, 0xd34: 0x0a1e, 0xd35: 0x0a3e, 0xd36: 0x0a5e, 0xd37: 0x0a7e, 0xd38: 0x0a9e, 0xd39: 0x0abe, 0xd3a: 0x0ade, 0xd3b: 0x0afe, - 0xd3c: 0x0b1e, 0xd3d: 0x270a, 0xd3e: 0x2732, 0xd3f: 0x275a, + 0xd3c: 0x0b1e, 0xd3d: 0x08d2, 0xd3e: 0x08da, 0xd3f: 0x08e2, // Block 0x35, offset 0xd40 - 0xd40: 0x2782, 0xd41: 0x27aa, 0xd42: 0x27d2, 0xd43: 0x27fa, 0xd44: 0x2822, 0xd45: 0x284a, - 0xd46: 0x2872, 0xd47: 0x289a, 0xd48: 0x0040, 0xd49: 0x0040, 0xd4a: 0x0040, 0xd4b: 0x0040, + 0xd40: 0x08ea, 0xd41: 0x08f2, 0xd42: 0x08fa, 0xd43: 0x0902, 0xd44: 0x090a, 0xd45: 0x0912, + 0xd46: 0x091a, 0xd47: 0x0922, 0xd48: 0x0040, 0xd49: 0x0040, 0xd4a: 0x0040, 0xd4b: 0x0040, 0xd4c: 0x0040, 0xd4d: 0x0040, 0xd4e: 0x0040, 0xd4f: 0x0040, 0xd50: 0x0040, 0xd51: 0x0040, 0xd52: 0x0040, 0xd53: 0x0040, 0xd54: 0x0040, 0xd55: 0x0040, 0xd56: 0x0040, 0xd57: 0x0040, 0xd58: 0x0040, 0xd59: 0x0040, 0xd5a: 0x0040, 0xd5b: 0x0040, 0xd5c: 0x0b3e, 0xd5d: 0x0b5e, @@ -1203,17 +1346,17 @@ var idnaValues = [8192]uint16{ 0xd64: 0x0c3e, 0xd65: 0x0c5e, 0xd66: 0x0c7e, 0xd67: 0x0c9e, 0xd68: 0x0cbe, 0xd69: 0x0cde, 0xd6a: 0x0cfe, 0xd6b: 0x0d1e, 0xd6c: 0x0d3e, 0xd6d: 0x0d5e, 0xd6e: 0x0d7e, 0xd6f: 0x0d9e, 0xd70: 0x0dbe, 0xd71: 0x0dde, 0xd72: 0x0dfe, 0xd73: 0x0e1e, 0xd74: 0x0e3e, 0xd75: 0x0e5e, - 0xd76: 0x0039, 0xd77: 0x0ee9, 0xd78: 0x1159, 0xd79: 0x0ef9, 0xd7a: 0x0f09, 0xd7b: 0x1199, - 0xd7c: 0x0f31, 0xd7d: 0x0249, 0xd7e: 0x0f41, 0xd7f: 0x0259, + 0xd76: 0x0019, 0xd77: 0x02e9, 0xd78: 0x03d9, 0xd79: 0x02f1, 0xd7a: 0x02f9, 0xd7b: 0x03f1, + 0xd7c: 0x0309, 0xd7d: 0x00a9, 0xd7e: 0x0311, 0xd7f: 0x00b1, // Block 0x36, offset 0xd80 - 0xd80: 0x0f51, 0xd81: 0x0359, 0xd82: 0x0f61, 0xd83: 0x0f71, 0xd84: 0x00d9, 0xd85: 0x0f99, - 0xd86: 0x2039, 0xd87: 0x0269, 0xd88: 0x01d9, 0xd89: 0x0fa9, 0xd8a: 0x0fb9, 0xd8b: 0x1089, - 0xd8c: 0x0279, 0xd8d: 0x0369, 0xd8e: 0x0289, 0xd8f: 0x13d1, 0xd90: 0x0039, 0xd91: 0x0ee9, - 0xd92: 0x1159, 0xd93: 0x0ef9, 0xd94: 0x0f09, 0xd95: 0x1199, 0xd96: 0x0f31, 0xd97: 0x0249, - 0xd98: 0x0f41, 0xd99: 0x0259, 0xd9a: 0x0f51, 0xd9b: 0x0359, 0xd9c: 0x0f61, 0xd9d: 0x0f71, - 0xd9e: 0x00d9, 0xd9f: 0x0f99, 0xda0: 0x2039, 0xda1: 0x0269, 0xda2: 0x01d9, 0xda3: 0x0fa9, - 0xda4: 0x0fb9, 0xda5: 0x1089, 0xda6: 0x0279, 0xda7: 0x0369, 0xda8: 0x0289, 0xda9: 0x13d1, - 0xdaa: 0x1f41, 0xdab: 0x0018, 0xdac: 0x0018, 0xdad: 0x0018, 0xdae: 0x0018, 0xdaf: 0x0018, + 0xd80: 0x0319, 0xd81: 0x0101, 0xd82: 0x0321, 0xd83: 0x0329, 0xd84: 0x0051, 0xd85: 0x0339, + 0xd86: 0x0751, 0xd87: 0x00b9, 0xd88: 0x0089, 0xd89: 0x0341, 0xd8a: 0x0349, 0xd8b: 0x0391, + 0xd8c: 0x00c1, 0xd8d: 0x0109, 0xd8e: 0x00c9, 0xd8f: 0x04b1, 0xd90: 0x0019, 0xd91: 0x02e9, + 0xd92: 0x03d9, 0xd93: 0x02f1, 0xd94: 0x02f9, 0xd95: 0x03f1, 0xd96: 0x0309, 0xd97: 0x00a9, + 0xd98: 0x0311, 0xd99: 0x00b1, 0xd9a: 0x0319, 0xd9b: 0x0101, 0xd9c: 0x0321, 0xd9d: 0x0329, + 0xd9e: 0x0051, 0xd9f: 0x0339, 0xda0: 0x0751, 0xda1: 0x00b9, 0xda2: 0x0089, 0xda3: 0x0341, + 0xda4: 0x0349, 0xda5: 0x0391, 0xda6: 0x00c1, 0xda7: 0x0109, 0xda8: 0x00c9, 0xda9: 0x04b1, + 0xdaa: 0x06e1, 0xdab: 0x0018, 0xdac: 0x0018, 0xdad: 0x0018, 0xdae: 0x0018, 0xdaf: 0x0018, 0xdb0: 0x0018, 0xdb1: 0x0018, 0xdb2: 0x0018, 0xdb3: 0x0018, 0xdb4: 0x0018, 0xdb5: 0x0018, 0xdb6: 0x0018, 0xdb7: 0x0018, 0xdb8: 0x0018, 0xdb9: 0x0018, 0xdba: 0x0018, 0xdbb: 0x0018, 0xdbc: 0x0018, 0xdbd: 0x0018, 0xdbe: 0x0018, 0xdbf: 0x0018, @@ -1223,12 +1366,12 @@ var idnaValues = [8192]uint16{ 0xdcc: 0x0008, 0xdcd: 0x0008, 0xdce: 0x0008, 0xdcf: 0x0008, 0xdd0: 0x0008, 0xdd1: 0x0008, 0xdd2: 0x0008, 0xdd3: 0x0008, 0xdd4: 0x0008, 0xdd5: 0x0008, 0xdd6: 0x0008, 0xdd7: 0x0008, 0xdd8: 0x0008, 0xdd9: 0x0008, 0xdda: 0x0008, 0xddb: 0x0008, 0xddc: 0x0008, 0xddd: 0x0008, - 0xdde: 0x0008, 0xddf: 0x0040, 0xde0: 0xe00d, 0xde1: 0x0008, 0xde2: 0x2971, 0xde3: 0x0ed5, - 0xde4: 0x2989, 0xde5: 0x0008, 0xde6: 0x0008, 0xde7: 0xe07d, 0xde8: 0x0008, 0xde9: 0xe01d, - 0xdea: 0x0008, 0xdeb: 0xe03d, 0xdec: 0x0008, 0xded: 0x0fe1, 0xdee: 0x1281, 0xdef: 0x0fc9, - 0xdf0: 0x1141, 0xdf1: 0x0008, 0xdf2: 0xe00d, 0xdf3: 0x0008, 0xdf4: 0x0008, 0xdf5: 0xe01d, + 0xdde: 0x0008, 0xddf: 0x0040, 0xde0: 0xe00d, 0xde1: 0x0008, 0xde2: 0x0941, 0xde3: 0x0ed5, + 0xde4: 0x0949, 0xde5: 0x0008, 0xde6: 0x0008, 0xde7: 0xe07d, 0xde8: 0x0008, 0xde9: 0xe01d, + 0xdea: 0x0008, 0xdeb: 0xe03d, 0xdec: 0x0008, 0xded: 0x0359, 0xdee: 0x0441, 0xdef: 0x0351, + 0xdf0: 0x03d1, 0xdf1: 0x0008, 0xdf2: 0xe00d, 0xdf3: 0x0008, 0xdf4: 0x0008, 0xdf5: 0xe01d, 0xdf6: 0x0008, 0xdf7: 0x0008, 0xdf8: 0x0008, 0xdf9: 0x0008, 0xdfa: 0x0008, 0xdfb: 0x0008, - 0xdfc: 0x0259, 0xdfd: 0x1089, 0xdfe: 0x29a1, 0xdff: 0x29b9, + 0xdfc: 0x00b1, 0xdfd: 0x0391, 0xdfe: 0x0951, 0xdff: 0x0959, // Block 0x38, offset 0xe00 0xe00: 0xe00d, 0xe01: 0x0008, 0xe02: 0xe00d, 0xe03: 0x0008, 0xe04: 0xe00d, 0xe05: 0x0008, 0xe06: 0xe00d, 0xe07: 0x0008, 0xe08: 0xe00d, 0xe09: 0x0008, 0xe0a: 0xe00d, 0xe0b: 0x0008, @@ -1254,7 +1397,7 @@ var idnaValues = [8192]uint16{ 0xe76: 0x0040, 0xe77: 0x0040, 0xe78: 0x0040, 0xe79: 0x0040, 0xe7a: 0x0040, 0xe7b: 0x0040, 0xe7c: 0x0040, 0xe7d: 0x0040, 0xe7e: 0x0040, 0xe7f: 0x0040, // Block 0x3a, offset 0xe80 - 0xe80: 0x000a, 0xe81: 0x0018, 0xe82: 0x29d1, 0xe83: 0x0018, 0xe84: 0x0018, 0xe85: 0x0008, + 0xe80: 0x000a, 0xe81: 0x0018, 0xe82: 0x0961, 0xe83: 0x0018, 0xe84: 0x0018, 0xe85: 0x0008, 0xe86: 0x0008, 0xe87: 0x0008, 0xe88: 0x0018, 0xe89: 0x0018, 0xe8a: 0x0018, 0xe8b: 0x0018, 0xe8c: 0x0018, 0xe8d: 0x0018, 0xe8e: 0x0018, 0xe8f: 0x0018, 0xe90: 0x0018, 0xe91: 0x0018, 0xe92: 0x0018, 0xe93: 0x0018, 0xe94: 0x0018, 0xe95: 0x0018, 0xe96: 0x0018, 0xe97: 0x0018, @@ -1290,17 +1433,17 @@ var idnaValues = [8192]uint16{ 0xf36: 0x0008, 0xf37: 0x0008, 0xf38: 0x0008, 0xf39: 0x0008, 0xf3a: 0x0008, 0xf3b: 0x0008, 0xf3c: 0x0008, 0xf3d: 0x0008, 0xf3e: 0x0008, 0xf3f: 0x0008, // Block 0x3d, offset 0xf40 - 0xf40: 0x36a2, 0xf41: 0x36d2, 0xf42: 0x3702, 0xf43: 0x3732, 0xf44: 0x32d5, 0xf45: 0x32f5, + 0xf40: 0x0b82, 0xf41: 0x0b8a, 0xf42: 0x0b92, 0xf43: 0x0b9a, 0xf44: 0x32d5, 0xf45: 0x32f5, 0xf46: 0x3315, 0xf47: 0x3335, 0xf48: 0x0018, 0xf49: 0x0018, 0xf4a: 0x0018, 0xf4b: 0x0018, - 0xf4c: 0x0018, 0xf4d: 0x0018, 0xf4e: 0x0018, 0xf4f: 0x0018, 0xf50: 0x3355, 0xf51: 0x3761, - 0xf52: 0x3779, 0xf53: 0x3791, 0xf54: 0x37a9, 0xf55: 0x37c1, 0xf56: 0x37d9, 0xf57: 0x37f1, - 0xf58: 0x3809, 0xf59: 0x3821, 0xf5a: 0x3839, 0xf5b: 0x3851, 0xf5c: 0x3869, 0xf5d: 0x3881, - 0xf5e: 0x3899, 0xf5f: 0x38b1, 0xf60: 0x3375, 0xf61: 0x3395, 0xf62: 0x33b5, 0xf63: 0x33d5, + 0xf4c: 0x0018, 0xf4d: 0x0018, 0xf4e: 0x0018, 0xf4f: 0x0018, 0xf50: 0x3355, 0xf51: 0x0ba1, + 0xf52: 0x0ba9, 0xf53: 0x0bb1, 0xf54: 0x0bb9, 0xf55: 0x0bc1, 0xf56: 0x0bc9, 0xf57: 0x0bd1, + 0xf58: 0x0bd9, 0xf59: 0x0be1, 0xf5a: 0x0be9, 0xf5b: 0x0bf1, 0xf5c: 0x0bf9, 0xf5d: 0x0c01, + 0xf5e: 0x0c09, 0xf5f: 0x0c11, 0xf60: 0x3375, 0xf61: 0x3395, 0xf62: 0x33b5, 0xf63: 0x33d5, 0xf64: 0x33f5, 0xf65: 0x33f5, 0xf66: 0x3415, 0xf67: 0x3435, 0xf68: 0x3455, 0xf69: 0x3475, 0xf6a: 0x3495, 0xf6b: 0x34b5, 0xf6c: 0x34d5, 0xf6d: 0x34f5, 0xf6e: 0x3515, 0xf6f: 0x3535, 0xf70: 0x3555, 0xf71: 0x3575, 0xf72: 0x3595, 0xf73: 0x35b5, 0xf74: 0x35d5, 0xf75: 0x35f5, 0xf76: 0x3615, 0xf77: 0x3635, 0xf78: 0x3655, 0xf79: 0x3675, 0xf7a: 0x3695, 0xf7b: 0x36b5, - 0xf7c: 0x38c9, 0xf7d: 0x3901, 0xf7e: 0x36d5, 0xf7f: 0x0018, + 0xf7c: 0x0c19, 0xf7d: 0x0c21, 0xf7e: 0x36d5, 0xf7f: 0x0018, // Block 0x3e, offset 0xf80 0xf80: 0x36f5, 0xf81: 0x3715, 0xf82: 0x3735, 0xf83: 0x3755, 0xf84: 0x3775, 0xf85: 0x3795, 0xf86: 0x37b5, 0xf87: 0x37d5, 0xf88: 0x37f5, 0xf89: 0x3815, 0xf8a: 0x3835, 0xf8b: 0x3855, @@ -1310,13 +1453,13 @@ var idnaValues = [8192]uint16{ 0xf9e: 0x3ab5, 0xf9f: 0x3ad5, 0xfa0: 0x3af5, 0xfa1: 0x3b15, 0xfa2: 0x3b35, 0xfa3: 0x3b55, 0xfa4: 0x3b75, 0xfa5: 0x3b95, 0xfa6: 0x1295, 0xfa7: 0x3bb5, 0xfa8: 0x3bd5, 0xfa9: 0x3bf5, 0xfaa: 0x3c15, 0xfab: 0x3c35, 0xfac: 0x3c55, 0xfad: 0x3c75, 0xfae: 0x23b5, 0xfaf: 0x3c95, - 0xfb0: 0x3cb5, 0xfb1: 0x3939, 0xfb2: 0x3951, 0xfb3: 0x3969, 0xfb4: 0x3981, 0xfb5: 0x3999, - 0xfb6: 0x39b1, 0xfb7: 0x39c9, 0xfb8: 0x39e1, 0xfb9: 0x39f9, 0xfba: 0x3a11, 0xfbb: 0x3a29, - 0xfbc: 0x3a41, 0xfbd: 0x3a59, 0xfbe: 0x3a71, 0xfbf: 0x3a89, + 0xfb0: 0x3cb5, 0xfb1: 0x0c29, 0xfb2: 0x0c31, 0xfb3: 0x0c39, 0xfb4: 0x0c41, 0xfb5: 0x0c49, + 0xfb6: 0x0c51, 0xfb7: 0x0c59, 0xfb8: 0x0c61, 0xfb9: 0x0c69, 0xfba: 0x0c71, 0xfbb: 0x0c79, + 0xfbc: 0x0c81, 0xfbd: 0x0c89, 0xfbe: 0x0c91, 0xfbf: 0x0c99, // Block 0x3f, offset 0xfc0 - 0xfc0: 0x3aa1, 0xfc1: 0x3ac9, 0xfc2: 0x3af1, 0xfc3: 0x3b19, 0xfc4: 0x3b41, 0xfc5: 0x3b69, - 0xfc6: 0x3b91, 0xfc7: 0x3bb9, 0xfc8: 0x3be1, 0xfc9: 0x3c09, 0xfca: 0x3c39, 0xfcb: 0x3c69, - 0xfcc: 0x3c99, 0xfcd: 0x3cd5, 0xfce: 0x3cb1, 0xfcf: 0x3cf5, 0xfd0: 0x3d15, 0xfd1: 0x3d2d, + 0xfc0: 0x0ca1, 0xfc1: 0x0ca9, 0xfc2: 0x0cb1, 0xfc3: 0x0cb9, 0xfc4: 0x0cc1, 0xfc5: 0x0cc9, + 0xfc6: 0x0cd1, 0xfc7: 0x0cd9, 0xfc8: 0x0ce1, 0xfc9: 0x0ce9, 0xfca: 0x0cf1, 0xfcb: 0x0cf9, + 0xfcc: 0x0d01, 0xfcd: 0x3cd5, 0xfce: 0x0d09, 0xfcf: 0x3cf5, 0xfd0: 0x3d15, 0xfd1: 0x3d2d, 0xfd2: 0x3d45, 0xfd3: 0x3d5d, 0xfd4: 0x3d75, 0xfd5: 0x3d75, 0xfd6: 0x3d5d, 0xfd7: 0x3d8d, 0xfd8: 0x07d5, 0xfd9: 0x3da5, 0xfda: 0x3dbd, 0xfdb: 0x3dd5, 0xfdc: 0x3ded, 0xfdd: 0x3e05, 0xfde: 0x3e1d, 0xfdf: 0x3e35, 0xfe0: 0x3e4d, 0xfe1: 0x3e65, 0xfe2: 0x3e7d, 0xfe3: 0x3e95, @@ -1324,769 +1467,769 @@ var idnaValues = [8192]uint16{ 0xfea: 0x3ef5, 0xfeb: 0x3f0d, 0xfec: 0x3f25, 0xfed: 0x3f3d, 0xfee: 0x3f55, 0xfef: 0x3f55, 0xff0: 0x3f6d, 0xff1: 0x3f6d, 0xff2: 0x3f6d, 0xff3: 0x3f85, 0xff4: 0x3f9d, 0xff5: 0x3fb5, 0xff6: 0x3fcd, 0xff7: 0x3fb5, 0xff8: 0x3fe5, 0xff9: 0x3ffd, 0xffa: 0x3f85, 0xffb: 0x4015, - 0xffc: 0x402d, 0xffd: 0x402d, 0xffe: 0x402d, 0xfff: 0x3cc9, + 0xffc: 0x402d, 0xffd: 0x402d, 0xffe: 0x402d, 0xfff: 0x0d11, // Block 0x40, offset 0x1000 - 0x1000: 0x3d01, 0x1001: 0x3d69, 0x1002: 0x3dd1, 0x1003: 0x3e39, 0x1004: 0x3e89, 0x1005: 0x3ef1, - 0x1006: 0x3f41, 0x1007: 0x3f91, 0x1008: 0x4011, 0x1009: 0x4079, 0x100a: 0x40c9, 0x100b: 0x4119, - 0x100c: 0x4169, 0x100d: 0x41d1, 0x100e: 0x4239, 0x100f: 0x4289, 0x1010: 0x42d9, 0x1011: 0x4311, - 0x1012: 0x4361, 0x1013: 0x43c9, 0x1014: 0x4431, 0x1015: 0x4469, 0x1016: 0x44e9, 0x1017: 0x4581, - 0x1018: 0x4601, 0x1019: 0x4651, 0x101a: 0x46d1, 0x101b: 0x4751, 0x101c: 0x47b9, 0x101d: 0x4809, - 0x101e: 0x4859, 0x101f: 0x48a9, 0x1020: 0x4911, 0x1021: 0x4991, 0x1022: 0x49f9, 0x1023: 0x4a49, - 0x1024: 0x4a99, 0x1025: 0x4ae9, 0x1026: 0x4b21, 0x1027: 0x4b59, 0x1028: 0x4b91, 0x1029: 0x4bc9, - 0x102a: 0x4c19, 0x102b: 0x4c69, 0x102c: 0x4ce9, 0x102d: 0x4d39, 0x102e: 0x4da1, 0x102f: 0x4e21, - 0x1030: 0x4e71, 0x1031: 0x4ea9, 0x1032: 0x4ee1, 0x1033: 0x4f61, 0x1034: 0x4fc9, 0x1035: 0x5049, - 0x1036: 0x5099, 0x1037: 0x5119, 0x1038: 0x5151, 0x1039: 0x51a1, 0x103a: 0x51f1, 0x103b: 0x5241, - 0x103c: 0x5291, 0x103d: 0x52e1, 0x103e: 0x5349, 0x103f: 0x5399, + 0x1000: 0x10f9, 0x1001: 0x1101, 0x1002: 0x40a5, 0x1003: 0x1109, 0x1004: 0x1111, 0x1005: 0x1119, + 0x1006: 0x1121, 0x1007: 0x1129, 0x1008: 0x40c5, 0x1009: 0x1131, 0x100a: 0x1139, 0x100b: 0x1141, + 0x100c: 0x40e5, 0x100d: 0x40e5, 0x100e: 0x1149, 0x100f: 0x1151, 0x1010: 0x1159, 0x1011: 0x4105, + 0x1012: 0x4125, 0x1013: 0x4145, 0x1014: 0x4165, 0x1015: 0x4185, 0x1016: 0x1161, 0x1017: 0x1169, + 0x1018: 0x1171, 0x1019: 0x1179, 0x101a: 0x1181, 0x101b: 0x41a5, 0x101c: 0x1189, 0x101d: 0x1191, + 0x101e: 0x1199, 0x101f: 0x41c5, 0x1020: 0x41e5, 0x1021: 0x11a1, 0x1022: 0x4205, 0x1023: 0x4225, + 0x1024: 0x4245, 0x1025: 0x11a9, 0x1026: 0x4265, 0x1027: 0x11b1, 0x1028: 0x11b9, 0x1029: 0x10f9, + 0x102a: 0x4285, 0x102b: 0x42a5, 0x102c: 0x42c5, 0x102d: 0x42e5, 0x102e: 0x11c1, 0x102f: 0x11c9, + 0x1030: 0x11d1, 0x1031: 0x11d9, 0x1032: 0x4305, 0x1033: 0x11e1, 0x1034: 0x11e9, 0x1035: 0x11f1, + 0x1036: 0x4325, 0x1037: 0x11f9, 0x1038: 0x1201, 0x1039: 0x11f9, 0x103a: 0x1209, 0x103b: 0x1211, + 0x103c: 0x4345, 0x103d: 0x1219, 0x103e: 0x1221, 0x103f: 0x1219, // Block 0x41, offset 0x1040 - 0x1040: 0x53d1, 0x1041: 0x5421, 0x1042: 0x5471, 0x1043: 0x54c1, 0x1044: 0x5529, 0x1045: 0x5579, - 0x1046: 0x55c9, 0x1047: 0x5619, 0x1048: 0x5699, 0x1049: 0x5701, 0x104a: 0x5739, 0x104b: 0x57b9, - 0x104c: 0x57f1, 0x104d: 0x5859, 0x104e: 0x58c1, 0x104f: 0x5911, 0x1050: 0x5961, 0x1051: 0x59b1, - 0x1052: 0x5a19, 0x1053: 0x5a51, 0x1054: 0x5aa1, 0x1055: 0x5b09, 0x1056: 0x5b41, 0x1057: 0x5bc1, - 0x1058: 0x5c11, 0x1059: 0x5c39, 0x105a: 0x5c61, 0x105b: 0x5c89, 0x105c: 0x5cb1, 0x105d: 0x5cd9, - 0x105e: 0x5d01, 0x105f: 0x5d29, 0x1060: 0x5d51, 0x1061: 0x5d79, 0x1062: 0x5da1, 0x1063: 0x5dd1, - 0x1064: 0x5e01, 0x1065: 0x5e31, 0x1066: 0x5e61, 0x1067: 0x5e91, 0x1068: 0x5ec1, 0x1069: 0x5ef1, - 0x106a: 0x5f21, 0x106b: 0x5f51, 0x106c: 0x5f81, 0x106d: 0x5fb1, 0x106e: 0x5fe1, 0x106f: 0x6011, - 0x1070: 0x6041, 0x1071: 0x4045, 0x1072: 0x6071, 0x1073: 0x6089, 0x1074: 0x4065, 0x1075: 0x60a1, - 0x1076: 0x60b9, 0x1077: 0x60d1, 0x1078: 0x4085, 0x1079: 0x4085, 0x107a: 0x60e9, 0x107b: 0x6101, - 0x107c: 0x6139, 0x107d: 0x6171, 0x107e: 0x61a9, 0x107f: 0x61e1, + 0x1040: 0x4365, 0x1041: 0x4385, 0x1042: 0x0040, 0x1043: 0x1229, 0x1044: 0x1231, 0x1045: 0x1239, + 0x1046: 0x1241, 0x1047: 0x0040, 0x1048: 0x1249, 0x1049: 0x1251, 0x104a: 0x1259, 0x104b: 0x1261, + 0x104c: 0x1269, 0x104d: 0x1271, 0x104e: 0x1199, 0x104f: 0x1279, 0x1050: 0x1281, 0x1051: 0x1289, + 0x1052: 0x43a5, 0x1053: 0x1291, 0x1054: 0x1121, 0x1055: 0x43c5, 0x1056: 0x43e5, 0x1057: 0x1299, + 0x1058: 0x0040, 0x1059: 0x4405, 0x105a: 0x12a1, 0x105b: 0x12a9, 0x105c: 0x12b1, 0x105d: 0x12b9, + 0x105e: 0x12c1, 0x105f: 0x12c9, 0x1060: 0x12d1, 0x1061: 0x12d9, 0x1062: 0x12e1, 0x1063: 0x12e9, + 0x1064: 0x12f1, 0x1065: 0x12f9, 0x1066: 0x1301, 0x1067: 0x1309, 0x1068: 0x1311, 0x1069: 0x1319, + 0x106a: 0x1321, 0x106b: 0x1329, 0x106c: 0x1331, 0x106d: 0x1339, 0x106e: 0x1341, 0x106f: 0x1349, + 0x1070: 0x1351, 0x1071: 0x1359, 0x1072: 0x1361, 0x1073: 0x1369, 0x1074: 0x1371, 0x1075: 0x1379, + 0x1076: 0x1381, 0x1077: 0x1389, 0x1078: 0x1391, 0x1079: 0x1399, 0x107a: 0x13a1, 0x107b: 0x13a9, + 0x107c: 0x13b1, 0x107d: 0x13b9, 0x107e: 0x13c1, 0x107f: 0x4425, // Block 0x42, offset 0x1080 - 0x1080: 0x6249, 0x1081: 0x6261, 0x1082: 0x40a5, 0x1083: 0x6279, 0x1084: 0x6291, 0x1085: 0x62a9, - 0x1086: 0x62c1, 0x1087: 0x62d9, 0x1088: 0x40c5, 0x1089: 0x62f1, 0x108a: 0x6319, 0x108b: 0x6331, - 0x108c: 0x40e5, 0x108d: 0x40e5, 0x108e: 0x6349, 0x108f: 0x6361, 0x1090: 0x6379, 0x1091: 0x4105, - 0x1092: 0x4125, 0x1093: 0x4145, 0x1094: 0x4165, 0x1095: 0x4185, 0x1096: 0x6391, 0x1097: 0x63a9, - 0x1098: 0x63c1, 0x1099: 0x63d9, 0x109a: 0x63f1, 0x109b: 0x41a5, 0x109c: 0x6409, 0x109d: 0x6421, - 0x109e: 0x6439, 0x109f: 0x41c5, 0x10a0: 0x41e5, 0x10a1: 0x6451, 0x10a2: 0x4205, 0x10a3: 0x4225, - 0x10a4: 0x4245, 0x10a5: 0x6469, 0x10a6: 0x4265, 0x10a7: 0x6481, 0x10a8: 0x64b1, 0x10a9: 0x6249, - 0x10aa: 0x4285, 0x10ab: 0x42a5, 0x10ac: 0x42c5, 0x10ad: 0x42e5, 0x10ae: 0x64e9, 0x10af: 0x6529, - 0x10b0: 0x6571, 0x10b1: 0x6589, 0x10b2: 0x4305, 0x10b3: 0x65a1, 0x10b4: 0x65b9, 0x10b5: 0x65d1, - 0x10b6: 0x4325, 0x10b7: 0x65e9, 0x10b8: 0x6601, 0x10b9: 0x65e9, 0x10ba: 0x6619, 0x10bb: 0x6631, - 0x10bc: 0x4345, 0x10bd: 0x6649, 0x10be: 0x6661, 0x10bf: 0x6649, + 0x1080: 0xe00d, 0x1081: 0x0008, 0x1082: 0xe00d, 0x1083: 0x0008, 0x1084: 0xe00d, 0x1085: 0x0008, + 0x1086: 0xe00d, 0x1087: 0x0008, 0x1088: 0xe00d, 0x1089: 0x0008, 0x108a: 0xe00d, 0x108b: 0x0008, + 0x108c: 0xe00d, 0x108d: 0x0008, 0x108e: 0xe00d, 0x108f: 0x0008, 0x1090: 0xe00d, 0x1091: 0x0008, + 0x1092: 0xe00d, 0x1093: 0x0008, 0x1094: 0xe00d, 0x1095: 0x0008, 0x1096: 0xe00d, 0x1097: 0x0008, + 0x1098: 0xe00d, 0x1099: 0x0008, 0x109a: 0xe00d, 0x109b: 0x0008, 0x109c: 0xe00d, 0x109d: 0x0008, + 0x109e: 0xe00d, 0x109f: 0x0008, 0x10a0: 0xe00d, 0x10a1: 0x0008, 0x10a2: 0xe00d, 0x10a3: 0x0008, + 0x10a4: 0xe00d, 0x10a5: 0x0008, 0x10a6: 0xe00d, 0x10a7: 0x0008, 0x10a8: 0xe00d, 0x10a9: 0x0008, + 0x10aa: 0xe00d, 0x10ab: 0x0008, 0x10ac: 0xe00d, 0x10ad: 0x0008, 0x10ae: 0x0008, 0x10af: 0x3308, + 0x10b0: 0x3318, 0x10b1: 0x3318, 0x10b2: 0x3318, 0x10b3: 0x0018, 0x10b4: 0x3308, 0x10b5: 0x3308, + 0x10b6: 0x3308, 0x10b7: 0x3308, 0x10b8: 0x3308, 0x10b9: 0x3308, 0x10ba: 0x3308, 0x10bb: 0x3308, + 0x10bc: 0x3308, 0x10bd: 0x3308, 0x10be: 0x0018, 0x10bf: 0x0008, // Block 0x43, offset 0x10c0 - 0x10c0: 0x4365, 0x10c1: 0x4385, 0x10c2: 0x0040, 0x10c3: 0x6679, 0x10c4: 0x6691, 0x10c5: 0x66a9, - 0x10c6: 0x66c1, 0x10c7: 0x0040, 0x10c8: 0x66f9, 0x10c9: 0x6711, 0x10ca: 0x6729, 0x10cb: 0x6741, - 0x10cc: 0x6759, 0x10cd: 0x6771, 0x10ce: 0x6439, 0x10cf: 0x6789, 0x10d0: 0x67a1, 0x10d1: 0x67b9, - 0x10d2: 0x43a5, 0x10d3: 0x67d1, 0x10d4: 0x62c1, 0x10d5: 0x43c5, 0x10d6: 0x43e5, 0x10d7: 0x67e9, - 0x10d8: 0x0040, 0x10d9: 0x4405, 0x10da: 0x6801, 0x10db: 0x6819, 0x10dc: 0x6831, 0x10dd: 0x6849, - 0x10de: 0x6861, 0x10df: 0x6891, 0x10e0: 0x68c1, 0x10e1: 0x68e9, 0x10e2: 0x6911, 0x10e3: 0x6939, - 0x10e4: 0x6961, 0x10e5: 0x6989, 0x10e6: 0x69b1, 0x10e7: 0x69d9, 0x10e8: 0x6a01, 0x10e9: 0x6a29, - 0x10ea: 0x6a59, 0x10eb: 0x6a89, 0x10ec: 0x6ab9, 0x10ed: 0x6ae9, 0x10ee: 0x6b19, 0x10ef: 0x6b49, - 0x10f0: 0x6b79, 0x10f1: 0x6ba9, 0x10f2: 0x6bd9, 0x10f3: 0x6c09, 0x10f4: 0x6c39, 0x10f5: 0x6c69, - 0x10f6: 0x6c99, 0x10f7: 0x6cc9, 0x10f8: 0x6cf9, 0x10f9: 0x6d29, 0x10fa: 0x6d59, 0x10fb: 0x6d89, - 0x10fc: 0x6db9, 0x10fd: 0x6de9, 0x10fe: 0x6e19, 0x10ff: 0x4425, + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0x02d1, 0x10dd: 0x13c9, + 0x10de: 0x3308, 0x10df: 0x3308, 0x10e0: 0x0008, 0x10e1: 0x0008, 0x10e2: 0x0008, 0x10e3: 0x0008, + 0x10e4: 0x0008, 0x10e5: 0x0008, 0x10e6: 0x0008, 0x10e7: 0x0008, 0x10e8: 0x0008, 0x10e9: 0x0008, + 0x10ea: 0x0008, 0x10eb: 0x0008, 0x10ec: 0x0008, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x0008, + 0x10f0: 0x0008, 0x10f1: 0x0008, 0x10f2: 0x0008, 0x10f3: 0x0008, 0x10f4: 0x0008, 0x10f5: 0x0008, + 0x10f6: 0x0008, 0x10f7: 0x0008, 0x10f8: 0x0008, 0x10f9: 0x0008, 0x10fa: 0x0008, 0x10fb: 0x0008, + 0x10fc: 0x0008, 0x10fd: 0x0008, 0x10fe: 0x0008, 0x10ff: 0x0008, // Block 0x44, offset 0x1100 - 0x1100: 0xe00d, 0x1101: 0x0008, 0x1102: 0xe00d, 0x1103: 0x0008, 0x1104: 0xe00d, 0x1105: 0x0008, - 0x1106: 0xe00d, 0x1107: 0x0008, 0x1108: 0xe00d, 0x1109: 0x0008, 0x110a: 0xe00d, 0x110b: 0x0008, - 0x110c: 0xe00d, 0x110d: 0x0008, 0x110e: 0xe00d, 0x110f: 0x0008, 0x1110: 0xe00d, 0x1111: 0x0008, - 0x1112: 0xe00d, 0x1113: 0x0008, 0x1114: 0xe00d, 0x1115: 0x0008, 0x1116: 0xe00d, 0x1117: 0x0008, - 0x1118: 0xe00d, 0x1119: 0x0008, 0x111a: 0xe00d, 0x111b: 0x0008, 0x111c: 0xe00d, 0x111d: 0x0008, - 0x111e: 0xe00d, 0x111f: 0x0008, 0x1120: 0xe00d, 0x1121: 0x0008, 0x1122: 0xe00d, 0x1123: 0x0008, + 0x1100: 0x0018, 0x1101: 0x0018, 0x1102: 0x0018, 0x1103: 0x0018, 0x1104: 0x0018, 0x1105: 0x0018, + 0x1106: 0x0018, 0x1107: 0x0018, 0x1108: 0x0018, 0x1109: 0x0018, 0x110a: 0x0018, 0x110b: 0x0018, + 0x110c: 0x0018, 0x110d: 0x0018, 0x110e: 0x0018, 0x110f: 0x0018, 0x1110: 0x0018, 0x1111: 0x0018, + 0x1112: 0x0018, 0x1113: 0x0018, 0x1114: 0x0018, 0x1115: 0x0018, 0x1116: 0x0018, 0x1117: 0x0008, + 0x1118: 0x0008, 0x1119: 0x0008, 0x111a: 0x0008, 0x111b: 0x0008, 0x111c: 0x0008, 0x111d: 0x0008, + 0x111e: 0x0008, 0x111f: 0x0008, 0x1120: 0x0018, 0x1121: 0x0018, 0x1122: 0xe00d, 0x1123: 0x0008, 0x1124: 0xe00d, 0x1125: 0x0008, 0x1126: 0xe00d, 0x1127: 0x0008, 0x1128: 0xe00d, 0x1129: 0x0008, - 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0x0008, 0x112f: 0x3308, - 0x1130: 0x3318, 0x1131: 0x3318, 0x1132: 0x3318, 0x1133: 0x0018, 0x1134: 0x3308, 0x1135: 0x3308, - 0x1136: 0x3308, 0x1137: 0x3308, 0x1138: 0x3308, 0x1139: 0x3308, 0x113a: 0x3308, 0x113b: 0x3308, - 0x113c: 0x3308, 0x113d: 0x3308, 0x113e: 0x0018, 0x113f: 0x0008, + 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0xe00d, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0xe00d, 0x1133: 0x0008, 0x1134: 0xe00d, 0x1135: 0x0008, + 0x1136: 0xe00d, 0x1137: 0x0008, 0x1138: 0xe00d, 0x1139: 0x0008, 0x113a: 0xe00d, 0x113b: 0x0008, + 0x113c: 0xe00d, 0x113d: 0x0008, 0x113e: 0xe00d, 0x113f: 0x0008, // Block 0x45, offset 0x1140 0x1140: 0xe00d, 0x1141: 0x0008, 0x1142: 0xe00d, 0x1143: 0x0008, 0x1144: 0xe00d, 0x1145: 0x0008, 0x1146: 0xe00d, 0x1147: 0x0008, 0x1148: 0xe00d, 0x1149: 0x0008, 0x114a: 0xe00d, 0x114b: 0x0008, 0x114c: 0xe00d, 0x114d: 0x0008, 0x114e: 0xe00d, 0x114f: 0x0008, 0x1150: 0xe00d, 0x1151: 0x0008, 0x1152: 0xe00d, 0x1153: 0x0008, 0x1154: 0xe00d, 0x1155: 0x0008, 0x1156: 0xe00d, 0x1157: 0x0008, - 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0x0ea1, 0x115d: 0x6e49, - 0x115e: 0x3308, 0x115f: 0x3308, 0x1160: 0x0008, 0x1161: 0x0008, 0x1162: 0x0008, 0x1163: 0x0008, - 0x1164: 0x0008, 0x1165: 0x0008, 0x1166: 0x0008, 0x1167: 0x0008, 0x1168: 0x0008, 0x1169: 0x0008, - 0x116a: 0x0008, 0x116b: 0x0008, 0x116c: 0x0008, 0x116d: 0x0008, 0x116e: 0x0008, 0x116f: 0x0008, - 0x1170: 0x0008, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, - 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0x0008, 0x117a: 0x0008, 0x117b: 0x0008, - 0x117c: 0x0008, 0x117d: 0x0008, 0x117e: 0x0008, 0x117f: 0x0008, + 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0xe00d, 0x115d: 0x0008, + 0x115e: 0xe00d, 0x115f: 0x0008, 0x1160: 0xe00d, 0x1161: 0x0008, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0xe0fd, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, + 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0xe01d, 0x117a: 0x0008, 0x117b: 0xe03d, + 0x117c: 0x0008, 0x117d: 0x4445, 0x117e: 0xe00d, 0x117f: 0x0008, // Block 0x46, offset 0x1180 - 0x1180: 0x0018, 0x1181: 0x0018, 0x1182: 0x0018, 0x1183: 0x0018, 0x1184: 0x0018, 0x1185: 0x0018, - 0x1186: 0x0018, 0x1187: 0x0018, 0x1188: 0x0018, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0x0018, - 0x118c: 0x0018, 0x118d: 0x0018, 0x118e: 0x0018, 0x118f: 0x0018, 0x1190: 0x0018, 0x1191: 0x0018, - 0x1192: 0x0018, 0x1193: 0x0018, 0x1194: 0x0018, 0x1195: 0x0018, 0x1196: 0x0018, 0x1197: 0x0008, - 0x1198: 0x0008, 0x1199: 0x0008, 0x119a: 0x0008, 0x119b: 0x0008, 0x119c: 0x0008, 0x119d: 0x0008, - 0x119e: 0x0008, 0x119f: 0x0008, 0x11a0: 0x0018, 0x11a1: 0x0018, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0x0008, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0xe03d, + 0x118c: 0x0008, 0x118d: 0x0409, 0x118e: 0x0008, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0x0008, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, - 0x11aa: 0xe00d, 0x11ab: 0x0008, 0x11ac: 0xe00d, 0x11ad: 0x0008, 0x11ae: 0xe00d, 0x11af: 0x0008, - 0x11b0: 0x0008, 0x11b1: 0x0008, 0x11b2: 0xe00d, 0x11b3: 0x0008, 0x11b4: 0xe00d, 0x11b5: 0x0008, + 0x11aa: 0x13d1, 0x11ab: 0x0371, 0x11ac: 0x0401, 0x11ad: 0x13d9, 0x11ae: 0x0421, 0x11af: 0x0008, + 0x11b0: 0x13e1, 0x11b1: 0x13e9, 0x11b2: 0x0429, 0x11b3: 0x4465, 0x11b4: 0xe00d, 0x11b5: 0x0008, 0x11b6: 0xe00d, 0x11b7: 0x0008, 0x11b8: 0xe00d, 0x11b9: 0x0008, 0x11ba: 0xe00d, 0x11bb: 0x0008, 0x11bc: 0xe00d, 0x11bd: 0x0008, 0x11be: 0xe00d, 0x11bf: 0x0008, // Block 0x47, offset 0x11c0 - 0x11c0: 0xe00d, 0x11c1: 0x0008, 0x11c2: 0xe00d, 0x11c3: 0x0008, 0x11c4: 0xe00d, 0x11c5: 0x0008, - 0x11c6: 0xe00d, 0x11c7: 0x0008, 0x11c8: 0xe00d, 0x11c9: 0x0008, 0x11ca: 0xe00d, 0x11cb: 0x0008, - 0x11cc: 0xe00d, 0x11cd: 0x0008, 0x11ce: 0xe00d, 0x11cf: 0x0008, 0x11d0: 0xe00d, 0x11d1: 0x0008, - 0x11d2: 0xe00d, 0x11d3: 0x0008, 0x11d4: 0xe00d, 0x11d5: 0x0008, 0x11d6: 0xe00d, 0x11d7: 0x0008, - 0x11d8: 0xe00d, 0x11d9: 0x0008, 0x11da: 0xe00d, 0x11db: 0x0008, 0x11dc: 0xe00d, 0x11dd: 0x0008, - 0x11de: 0xe00d, 0x11df: 0x0008, 0x11e0: 0xe00d, 0x11e1: 0x0008, 0x11e2: 0xe00d, 0x11e3: 0x0008, - 0x11e4: 0xe00d, 0x11e5: 0x0008, 0x11e6: 0xe00d, 0x11e7: 0x0008, 0x11e8: 0xe00d, 0x11e9: 0x0008, - 0x11ea: 0xe00d, 0x11eb: 0x0008, 0x11ec: 0xe00d, 0x11ed: 0x0008, 0x11ee: 0xe00d, 0x11ef: 0x0008, - 0x11f0: 0xe0fd, 0x11f1: 0x0008, 0x11f2: 0x0008, 0x11f3: 0x0008, 0x11f4: 0x0008, 0x11f5: 0x0008, - 0x11f6: 0x0008, 0x11f7: 0x0008, 0x11f8: 0x0008, 0x11f9: 0xe01d, 0x11fa: 0x0008, 0x11fb: 0xe03d, - 0x11fc: 0x0008, 0x11fd: 0x4445, 0x11fe: 0xe00d, 0x11ff: 0x0008, + 0x11c0: 0x650d, 0x11c1: 0x652d, 0x11c2: 0x654d, 0x11c3: 0x656d, 0x11c4: 0x658d, 0x11c5: 0x65ad, + 0x11c6: 0x65cd, 0x11c7: 0x65ed, 0x11c8: 0x660d, 0x11c9: 0x662d, 0x11ca: 0x664d, 0x11cb: 0x666d, + 0x11cc: 0x668d, 0x11cd: 0x66ad, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0x66cd, 0x11d1: 0x0008, + 0x11d2: 0x66ed, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x670d, 0x11d6: 0x672d, 0x11d7: 0x674d, + 0x11d8: 0x676d, 0x11d9: 0x678d, 0x11da: 0x67ad, 0x11db: 0x67cd, 0x11dc: 0x67ed, 0x11dd: 0x680d, + 0x11de: 0x682d, 0x11df: 0x0008, 0x11e0: 0x684d, 0x11e1: 0x0008, 0x11e2: 0x686d, 0x11e3: 0x0008, + 0x11e4: 0x0008, 0x11e5: 0x688d, 0x11e6: 0x68ad, 0x11e7: 0x0008, 0x11e8: 0x0008, 0x11e9: 0x0008, + 0x11ea: 0x68cd, 0x11eb: 0x68ed, 0x11ec: 0x690d, 0x11ed: 0x692d, 0x11ee: 0x694d, 0x11ef: 0x696d, + 0x11f0: 0x698d, 0x11f1: 0x69ad, 0x11f2: 0x69cd, 0x11f3: 0x69ed, 0x11f4: 0x6a0d, 0x11f5: 0x6a2d, + 0x11f6: 0x6a4d, 0x11f7: 0x6a6d, 0x11f8: 0x6a8d, 0x11f9: 0x6aad, 0x11fa: 0x6acd, 0x11fb: 0x6aed, + 0x11fc: 0x6b0d, 0x11fd: 0x6b2d, 0x11fe: 0x6b4d, 0x11ff: 0x6b6d, // Block 0x48, offset 0x1200 - 0x1200: 0xe00d, 0x1201: 0x0008, 0x1202: 0xe00d, 0x1203: 0x0008, 0x1204: 0xe00d, 0x1205: 0x0008, - 0x1206: 0xe00d, 0x1207: 0x0008, 0x1208: 0x0008, 0x1209: 0x0018, 0x120a: 0x0018, 0x120b: 0xe03d, - 0x120c: 0x0008, 0x120d: 0x11d9, 0x120e: 0x0008, 0x120f: 0x0008, 0x1210: 0xe00d, 0x1211: 0x0008, - 0x1212: 0xe00d, 0x1213: 0x0008, 0x1214: 0x0008, 0x1215: 0x0008, 0x1216: 0xe00d, 0x1217: 0x0008, - 0x1218: 0xe00d, 0x1219: 0x0008, 0x121a: 0xe00d, 0x121b: 0x0008, 0x121c: 0xe00d, 0x121d: 0x0008, - 0x121e: 0xe00d, 0x121f: 0x0008, 0x1220: 0xe00d, 0x1221: 0x0008, 0x1222: 0xe00d, 0x1223: 0x0008, - 0x1224: 0xe00d, 0x1225: 0x0008, 0x1226: 0xe00d, 0x1227: 0x0008, 0x1228: 0xe00d, 0x1229: 0x0008, - 0x122a: 0x6e61, 0x122b: 0x1029, 0x122c: 0x11c1, 0x122d: 0x6e79, 0x122e: 0x1221, 0x122f: 0x0008, - 0x1230: 0x6e91, 0x1231: 0x6ea9, 0x1232: 0x1239, 0x1233: 0x4465, 0x1234: 0xe00d, 0x1235: 0x0008, - 0x1236: 0xe00d, 0x1237: 0x0008, 0x1238: 0xe00d, 0x1239: 0x0008, 0x123a: 0xe00d, 0x123b: 0x0008, - 0x123c: 0xe00d, 0x123d: 0x0008, 0x123e: 0xe00d, 0x123f: 0x0008, + 0x1200: 0x7acd, 0x1201: 0x7aed, 0x1202: 0x7b0d, 0x1203: 0x7b2d, 0x1204: 0x7b4d, 0x1205: 0x7b6d, + 0x1206: 0x7b8d, 0x1207: 0x7bad, 0x1208: 0x7bcd, 0x1209: 0x7bed, 0x120a: 0x7c0d, 0x120b: 0x7c2d, + 0x120c: 0x7c4d, 0x120d: 0x7c6d, 0x120e: 0x7c8d, 0x120f: 0x1409, 0x1210: 0x1411, 0x1211: 0x1419, + 0x1212: 0x7cad, 0x1213: 0x7ccd, 0x1214: 0x7ced, 0x1215: 0x1421, 0x1216: 0x1429, 0x1217: 0x1431, + 0x1218: 0x7d0d, 0x1219: 0x7d2d, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x0040, 0x1233: 0x0040, 0x1234: 0x0040, 0x1235: 0x0040, + 0x1236: 0x0040, 0x1237: 0x0040, 0x1238: 0x0040, 0x1239: 0x0040, 0x123a: 0x0040, 0x123b: 0x0040, + 0x123c: 0x0040, 0x123d: 0x0040, 0x123e: 0x0040, 0x123f: 0x0040, // Block 0x49, offset 0x1240 - 0x1240: 0x650d, 0x1241: 0x652d, 0x1242: 0x654d, 0x1243: 0x656d, 0x1244: 0x658d, 0x1245: 0x65ad, - 0x1246: 0x65cd, 0x1247: 0x65ed, 0x1248: 0x660d, 0x1249: 0x662d, 0x124a: 0x664d, 0x124b: 0x666d, - 0x124c: 0x668d, 0x124d: 0x66ad, 0x124e: 0x0008, 0x124f: 0x0008, 0x1250: 0x66cd, 0x1251: 0x0008, - 0x1252: 0x66ed, 0x1253: 0x0008, 0x1254: 0x0008, 0x1255: 0x670d, 0x1256: 0x672d, 0x1257: 0x674d, - 0x1258: 0x676d, 0x1259: 0x678d, 0x125a: 0x67ad, 0x125b: 0x67cd, 0x125c: 0x67ed, 0x125d: 0x680d, - 0x125e: 0x682d, 0x125f: 0x0008, 0x1260: 0x684d, 0x1261: 0x0008, 0x1262: 0x686d, 0x1263: 0x0008, - 0x1264: 0x0008, 0x1265: 0x688d, 0x1266: 0x68ad, 0x1267: 0x0008, 0x1268: 0x0008, 0x1269: 0x0008, - 0x126a: 0x68cd, 0x126b: 0x68ed, 0x126c: 0x690d, 0x126d: 0x692d, 0x126e: 0x694d, 0x126f: 0x696d, - 0x1270: 0x698d, 0x1271: 0x69ad, 0x1272: 0x69cd, 0x1273: 0x69ed, 0x1274: 0x6a0d, 0x1275: 0x6a2d, - 0x1276: 0x6a4d, 0x1277: 0x6a6d, 0x1278: 0x6a8d, 0x1279: 0x6aad, 0x127a: 0x6acd, 0x127b: 0x6aed, - 0x127c: 0x6b0d, 0x127d: 0x6b2d, 0x127e: 0x6b4d, 0x127f: 0x6b6d, + 0x1240: 0x1439, 0x1241: 0x1441, 0x1242: 0x1449, 0x1243: 0x7d4d, 0x1244: 0x7d6d, 0x1245: 0x1451, + 0x1246: 0x1451, 0x1247: 0x0040, 0x1248: 0x0040, 0x1249: 0x0040, 0x124a: 0x0040, 0x124b: 0x0040, + 0x124c: 0x0040, 0x124d: 0x0040, 0x124e: 0x0040, 0x124f: 0x0040, 0x1250: 0x0040, 0x1251: 0x0040, + 0x1252: 0x0040, 0x1253: 0x1459, 0x1254: 0x1461, 0x1255: 0x1469, 0x1256: 0x1471, 0x1257: 0x1479, + 0x1258: 0x0040, 0x1259: 0x0040, 0x125a: 0x0040, 0x125b: 0x0040, 0x125c: 0x0040, 0x125d: 0x1481, + 0x125e: 0x3308, 0x125f: 0x1489, 0x1260: 0x1491, 0x1261: 0x0779, 0x1262: 0x0791, 0x1263: 0x1499, + 0x1264: 0x14a1, 0x1265: 0x14a9, 0x1266: 0x14b1, 0x1267: 0x14b9, 0x1268: 0x14c1, 0x1269: 0x071a, + 0x126a: 0x14c9, 0x126b: 0x14d1, 0x126c: 0x14d9, 0x126d: 0x14e1, 0x126e: 0x14e9, 0x126f: 0x14f1, + 0x1270: 0x14f9, 0x1271: 0x1501, 0x1272: 0x1509, 0x1273: 0x1511, 0x1274: 0x1519, 0x1275: 0x1521, + 0x1276: 0x1529, 0x1277: 0x0040, 0x1278: 0x1531, 0x1279: 0x1539, 0x127a: 0x1541, 0x127b: 0x1549, + 0x127c: 0x1551, 0x127d: 0x0040, 0x127e: 0x1559, 0x127f: 0x0040, // Block 0x4a, offset 0x1280 - 0x1280: 0x7acd, 0x1281: 0x7aed, 0x1282: 0x7b0d, 0x1283: 0x7b2d, 0x1284: 0x7b4d, 0x1285: 0x7b6d, - 0x1286: 0x7b8d, 0x1287: 0x7bad, 0x1288: 0x7bcd, 0x1289: 0x7bed, 0x128a: 0x7c0d, 0x128b: 0x7c2d, - 0x128c: 0x7c4d, 0x128d: 0x7c6d, 0x128e: 0x7c8d, 0x128f: 0x6f19, 0x1290: 0x6f41, 0x1291: 0x6f69, - 0x1292: 0x7cad, 0x1293: 0x7ccd, 0x1294: 0x7ced, 0x1295: 0x6f91, 0x1296: 0x6fb9, 0x1297: 0x6fe1, - 0x1298: 0x7d0d, 0x1299: 0x7d2d, 0x129a: 0x0040, 0x129b: 0x0040, 0x129c: 0x0040, 0x129d: 0x0040, - 0x129e: 0x0040, 0x129f: 0x0040, 0x12a0: 0x0040, 0x12a1: 0x0040, 0x12a2: 0x0040, 0x12a3: 0x0040, - 0x12a4: 0x0040, 0x12a5: 0x0040, 0x12a6: 0x0040, 0x12a7: 0x0040, 0x12a8: 0x0040, 0x12a9: 0x0040, - 0x12aa: 0x0040, 0x12ab: 0x0040, 0x12ac: 0x0040, 0x12ad: 0x0040, 0x12ae: 0x0040, 0x12af: 0x0040, - 0x12b0: 0x0040, 0x12b1: 0x0040, 0x12b2: 0x0040, 0x12b3: 0x0040, 0x12b4: 0x0040, 0x12b5: 0x0040, - 0x12b6: 0x0040, 0x12b7: 0x0040, 0x12b8: 0x0040, 0x12b9: 0x0040, 0x12ba: 0x0040, 0x12bb: 0x0040, - 0x12bc: 0x0040, 0x12bd: 0x0040, 0x12be: 0x0040, 0x12bf: 0x0040, + 0x1280: 0x1561, 0x1281: 0x1569, 0x1282: 0x0040, 0x1283: 0x1571, 0x1284: 0x1579, 0x1285: 0x0040, + 0x1286: 0x1581, 0x1287: 0x1589, 0x1288: 0x1591, 0x1289: 0x1599, 0x128a: 0x15a1, 0x128b: 0x15a9, + 0x128c: 0x15b1, 0x128d: 0x15b9, 0x128e: 0x15c1, 0x128f: 0x15c9, 0x1290: 0x15d1, 0x1291: 0x15d1, + 0x1292: 0x15d9, 0x1293: 0x15d9, 0x1294: 0x15d9, 0x1295: 0x15d9, 0x1296: 0x15e1, 0x1297: 0x15e1, + 0x1298: 0x15e1, 0x1299: 0x15e1, 0x129a: 0x15e9, 0x129b: 0x15e9, 0x129c: 0x15e9, 0x129d: 0x15e9, + 0x129e: 0x15f1, 0x129f: 0x15f1, 0x12a0: 0x15f1, 0x12a1: 0x15f1, 0x12a2: 0x15f9, 0x12a3: 0x15f9, + 0x12a4: 0x15f9, 0x12a5: 0x15f9, 0x12a6: 0x1601, 0x12a7: 0x1601, 0x12a8: 0x1601, 0x12a9: 0x1601, + 0x12aa: 0x1609, 0x12ab: 0x1609, 0x12ac: 0x1609, 0x12ad: 0x1609, 0x12ae: 0x1611, 0x12af: 0x1611, + 0x12b0: 0x1611, 0x12b1: 0x1611, 0x12b2: 0x1619, 0x12b3: 0x1619, 0x12b4: 0x1619, 0x12b5: 0x1619, + 0x12b6: 0x1621, 0x12b7: 0x1621, 0x12b8: 0x1621, 0x12b9: 0x1621, 0x12ba: 0x1629, 0x12bb: 0x1629, + 0x12bc: 0x1629, 0x12bd: 0x1629, 0x12be: 0x1631, 0x12bf: 0x1631, // Block 0x4b, offset 0x12c0 - 0x12c0: 0x7009, 0x12c1: 0x7021, 0x12c2: 0x7039, 0x12c3: 0x7d4d, 0x12c4: 0x7d6d, 0x12c5: 0x7051, - 0x12c6: 0x7051, 0x12c7: 0x0040, 0x12c8: 0x0040, 0x12c9: 0x0040, 0x12ca: 0x0040, 0x12cb: 0x0040, - 0x12cc: 0x0040, 0x12cd: 0x0040, 0x12ce: 0x0040, 0x12cf: 0x0040, 0x12d0: 0x0040, 0x12d1: 0x0040, - 0x12d2: 0x0040, 0x12d3: 0x7069, 0x12d4: 0x7091, 0x12d5: 0x70b9, 0x12d6: 0x70e1, 0x12d7: 0x7109, - 0x12d8: 0x0040, 0x12d9: 0x0040, 0x12da: 0x0040, 0x12db: 0x0040, 0x12dc: 0x0040, 0x12dd: 0x7131, - 0x12de: 0x3308, 0x12df: 0x7159, 0x12e0: 0x7181, 0x12e1: 0x20a9, 0x12e2: 0x20f1, 0x12e3: 0x7199, - 0x12e4: 0x71b1, 0x12e5: 0x71c9, 0x12e6: 0x71e1, 0x12e7: 0x71f9, 0x12e8: 0x7211, 0x12e9: 0x1fb2, - 0x12ea: 0x7229, 0x12eb: 0x7251, 0x12ec: 0x7279, 0x12ed: 0x72b1, 0x12ee: 0x72e9, 0x12ef: 0x7311, - 0x12f0: 0x7339, 0x12f1: 0x7361, 0x12f2: 0x7389, 0x12f3: 0x73b1, 0x12f4: 0x73d9, 0x12f5: 0x7401, - 0x12f6: 0x7429, 0x12f7: 0x0040, 0x12f8: 0x7451, 0x12f9: 0x7479, 0x12fa: 0x74a1, 0x12fb: 0x74c9, - 0x12fc: 0x74f1, 0x12fd: 0x0040, 0x12fe: 0x7519, 0x12ff: 0x0040, + 0x12c0: 0x1631, 0x12c1: 0x1631, 0x12c2: 0x1639, 0x12c3: 0x1639, 0x12c4: 0x1641, 0x12c5: 0x1641, + 0x12c6: 0x1649, 0x12c7: 0x1649, 0x12c8: 0x1651, 0x12c9: 0x1651, 0x12ca: 0x1659, 0x12cb: 0x1659, + 0x12cc: 0x1661, 0x12cd: 0x1661, 0x12ce: 0x1669, 0x12cf: 0x1669, 0x12d0: 0x1669, 0x12d1: 0x1669, + 0x12d2: 0x1671, 0x12d3: 0x1671, 0x12d4: 0x1671, 0x12d5: 0x1671, 0x12d6: 0x1679, 0x12d7: 0x1679, + 0x12d8: 0x1679, 0x12d9: 0x1679, 0x12da: 0x1681, 0x12db: 0x1681, 0x12dc: 0x1681, 0x12dd: 0x1681, + 0x12de: 0x1689, 0x12df: 0x1689, 0x12e0: 0x1691, 0x12e1: 0x1691, 0x12e2: 0x1691, 0x12e3: 0x1691, + 0x12e4: 0x1699, 0x12e5: 0x1699, 0x12e6: 0x16a1, 0x12e7: 0x16a1, 0x12e8: 0x16a1, 0x12e9: 0x16a1, + 0x12ea: 0x16a9, 0x12eb: 0x16a9, 0x12ec: 0x16a9, 0x12ed: 0x16a9, 0x12ee: 0x16b1, 0x12ef: 0x16b1, + 0x12f0: 0x16b9, 0x12f1: 0x16b9, 0x12f2: 0x0818, 0x12f3: 0x0818, 0x12f4: 0x0818, 0x12f5: 0x0818, + 0x12f6: 0x0818, 0x12f7: 0x0818, 0x12f8: 0x0818, 0x12f9: 0x0818, 0x12fa: 0x0818, 0x12fb: 0x0818, + 0x12fc: 0x0818, 0x12fd: 0x0818, 0x12fe: 0x0818, 0x12ff: 0x0818, // Block 0x4c, offset 0x1300 - 0x1300: 0x7541, 0x1301: 0x7569, 0x1302: 0x0040, 0x1303: 0x7591, 0x1304: 0x75b9, 0x1305: 0x0040, - 0x1306: 0x75e1, 0x1307: 0x7609, 0x1308: 0x7631, 0x1309: 0x7659, 0x130a: 0x7681, 0x130b: 0x76a9, - 0x130c: 0x76d1, 0x130d: 0x76f9, 0x130e: 0x7721, 0x130f: 0x7749, 0x1310: 0x7771, 0x1311: 0x7771, - 0x1312: 0x7789, 0x1313: 0x7789, 0x1314: 0x7789, 0x1315: 0x7789, 0x1316: 0x77a1, 0x1317: 0x77a1, - 0x1318: 0x77a1, 0x1319: 0x77a1, 0x131a: 0x77b9, 0x131b: 0x77b9, 0x131c: 0x77b9, 0x131d: 0x77b9, - 0x131e: 0x77d1, 0x131f: 0x77d1, 0x1320: 0x77d1, 0x1321: 0x77d1, 0x1322: 0x77e9, 0x1323: 0x77e9, - 0x1324: 0x77e9, 0x1325: 0x77e9, 0x1326: 0x7801, 0x1327: 0x7801, 0x1328: 0x7801, 0x1329: 0x7801, - 0x132a: 0x7819, 0x132b: 0x7819, 0x132c: 0x7819, 0x132d: 0x7819, 0x132e: 0x7831, 0x132f: 0x7831, - 0x1330: 0x7831, 0x1331: 0x7831, 0x1332: 0x7849, 0x1333: 0x7849, 0x1334: 0x7849, 0x1335: 0x7849, - 0x1336: 0x7861, 0x1337: 0x7861, 0x1338: 0x7861, 0x1339: 0x7861, 0x133a: 0x7879, 0x133b: 0x7879, - 0x133c: 0x7879, 0x133d: 0x7879, 0x133e: 0x7891, 0x133f: 0x7891, + 0x1300: 0x0818, 0x1301: 0x0818, 0x1302: 0x0040, 0x1303: 0x0040, 0x1304: 0x0040, 0x1305: 0x0040, + 0x1306: 0x0040, 0x1307: 0x0040, 0x1308: 0x0040, 0x1309: 0x0040, 0x130a: 0x0040, 0x130b: 0x0040, + 0x130c: 0x0040, 0x130d: 0x0040, 0x130e: 0x0040, 0x130f: 0x0040, 0x1310: 0x0040, 0x1311: 0x0040, + 0x1312: 0x0040, 0x1313: 0x16c1, 0x1314: 0x16c1, 0x1315: 0x16c1, 0x1316: 0x16c1, 0x1317: 0x16c9, + 0x1318: 0x16c9, 0x1319: 0x16d1, 0x131a: 0x16d1, 0x131b: 0x16d9, 0x131c: 0x16d9, 0x131d: 0x0149, + 0x131e: 0x16e1, 0x131f: 0x16e1, 0x1320: 0x16e9, 0x1321: 0x16e9, 0x1322: 0x16f1, 0x1323: 0x16f1, + 0x1324: 0x16f9, 0x1325: 0x16f9, 0x1326: 0x16f9, 0x1327: 0x16f9, 0x1328: 0x1701, 0x1329: 0x1701, + 0x132a: 0x1709, 0x132b: 0x1709, 0x132c: 0x1711, 0x132d: 0x1711, 0x132e: 0x1719, 0x132f: 0x1719, + 0x1330: 0x1721, 0x1331: 0x1721, 0x1332: 0x1729, 0x1333: 0x1729, 0x1334: 0x1731, 0x1335: 0x1731, + 0x1336: 0x1739, 0x1337: 0x1739, 0x1338: 0x1739, 0x1339: 0x1741, 0x133a: 0x1741, 0x133b: 0x1741, + 0x133c: 0x1749, 0x133d: 0x1749, 0x133e: 0x1749, 0x133f: 0x1749, // Block 0x4d, offset 0x1340 - 0x1340: 0x7891, 0x1341: 0x7891, 0x1342: 0x78a9, 0x1343: 0x78a9, 0x1344: 0x78c1, 0x1345: 0x78c1, - 0x1346: 0x78d9, 0x1347: 0x78d9, 0x1348: 0x78f1, 0x1349: 0x78f1, 0x134a: 0x7909, 0x134b: 0x7909, - 0x134c: 0x7921, 0x134d: 0x7921, 0x134e: 0x7939, 0x134f: 0x7939, 0x1350: 0x7939, 0x1351: 0x7939, - 0x1352: 0x7951, 0x1353: 0x7951, 0x1354: 0x7951, 0x1355: 0x7951, 0x1356: 0x7969, 0x1357: 0x7969, - 0x1358: 0x7969, 0x1359: 0x7969, 0x135a: 0x7981, 0x135b: 0x7981, 0x135c: 0x7981, 0x135d: 0x7981, - 0x135e: 0x7999, 0x135f: 0x7999, 0x1360: 0x79b1, 0x1361: 0x79b1, 0x1362: 0x79b1, 0x1363: 0x79b1, - 0x1364: 0x79c9, 0x1365: 0x79c9, 0x1366: 0x79e1, 0x1367: 0x79e1, 0x1368: 0x79e1, 0x1369: 0x79e1, - 0x136a: 0x79f9, 0x136b: 0x79f9, 0x136c: 0x79f9, 0x136d: 0x79f9, 0x136e: 0x7a11, 0x136f: 0x7a11, - 0x1370: 0x7a29, 0x1371: 0x7a29, 0x1372: 0x0818, 0x1373: 0x0818, 0x1374: 0x0818, 0x1375: 0x0818, - 0x1376: 0x0818, 0x1377: 0x0818, 0x1378: 0x0818, 0x1379: 0x0818, 0x137a: 0x0818, 0x137b: 0x0818, - 0x137c: 0x0818, 0x137d: 0x0818, 0x137e: 0x0818, 0x137f: 0x0818, + 0x1340: 0x1949, 0x1341: 0x1951, 0x1342: 0x1959, 0x1343: 0x1961, 0x1344: 0x1969, 0x1345: 0x1971, + 0x1346: 0x1979, 0x1347: 0x1981, 0x1348: 0x1989, 0x1349: 0x1991, 0x134a: 0x1999, 0x134b: 0x19a1, + 0x134c: 0x19a9, 0x134d: 0x19b1, 0x134e: 0x19b9, 0x134f: 0x19c1, 0x1350: 0x19c9, 0x1351: 0x19d1, + 0x1352: 0x19d9, 0x1353: 0x19e1, 0x1354: 0x19e9, 0x1355: 0x19f1, 0x1356: 0x19f9, 0x1357: 0x1a01, + 0x1358: 0x1a09, 0x1359: 0x1a11, 0x135a: 0x1a19, 0x135b: 0x1a21, 0x135c: 0x1a29, 0x135d: 0x1a31, + 0x135e: 0x1a3a, 0x135f: 0x1a42, 0x1360: 0x1a4a, 0x1361: 0x1a52, 0x1362: 0x1a5a, 0x1363: 0x1a62, + 0x1364: 0x1a69, 0x1365: 0x1a71, 0x1366: 0x1761, 0x1367: 0x1a79, 0x1368: 0x1741, 0x1369: 0x1769, + 0x136a: 0x1a81, 0x136b: 0x1a89, 0x136c: 0x1789, 0x136d: 0x1a91, 0x136e: 0x1791, 0x136f: 0x1799, + 0x1370: 0x1a99, 0x1371: 0x1aa1, 0x1372: 0x17b9, 0x1373: 0x1aa9, 0x1374: 0x17c1, 0x1375: 0x17c9, + 0x1376: 0x1ab1, 0x1377: 0x1ab9, 0x1378: 0x17d9, 0x1379: 0x1ac1, 0x137a: 0x17e1, 0x137b: 0x17e9, + 0x137c: 0x18d1, 0x137d: 0x18d9, 0x137e: 0x18f1, 0x137f: 0x18f9, // Block 0x4e, offset 0x1380 - 0x1380: 0x0818, 0x1381: 0x0818, 0x1382: 0x0040, 0x1383: 0x0040, 0x1384: 0x0040, 0x1385: 0x0040, - 0x1386: 0x0040, 0x1387: 0x0040, 0x1388: 0x0040, 0x1389: 0x0040, 0x138a: 0x0040, 0x138b: 0x0040, - 0x138c: 0x0040, 0x138d: 0x0040, 0x138e: 0x0040, 0x138f: 0x0040, 0x1390: 0x0040, 0x1391: 0x0040, - 0x1392: 0x0040, 0x1393: 0x7a41, 0x1394: 0x7a41, 0x1395: 0x7a41, 0x1396: 0x7a41, 0x1397: 0x7a59, - 0x1398: 0x7a59, 0x1399: 0x7a71, 0x139a: 0x7a71, 0x139b: 0x7a89, 0x139c: 0x7a89, 0x139d: 0x0479, - 0x139e: 0x7aa1, 0x139f: 0x7aa1, 0x13a0: 0x7ab9, 0x13a1: 0x7ab9, 0x13a2: 0x7ad1, 0x13a3: 0x7ad1, - 0x13a4: 0x7ae9, 0x13a5: 0x7ae9, 0x13a6: 0x7ae9, 0x13a7: 0x7ae9, 0x13a8: 0x7b01, 0x13a9: 0x7b01, - 0x13aa: 0x7b19, 0x13ab: 0x7b19, 0x13ac: 0x7b41, 0x13ad: 0x7b41, 0x13ae: 0x7b69, 0x13af: 0x7b69, - 0x13b0: 0x7b91, 0x13b1: 0x7b91, 0x13b2: 0x7bb9, 0x13b3: 0x7bb9, 0x13b4: 0x7be1, 0x13b5: 0x7be1, - 0x13b6: 0x7c09, 0x13b7: 0x7c09, 0x13b8: 0x7c09, 0x13b9: 0x7c31, 0x13ba: 0x7c31, 0x13bb: 0x7c31, - 0x13bc: 0x7c59, 0x13bd: 0x7c59, 0x13be: 0x7c59, 0x13bf: 0x7c59, + 0x1380: 0x1901, 0x1381: 0x1921, 0x1382: 0x1929, 0x1383: 0x1931, 0x1384: 0x1939, 0x1385: 0x1959, + 0x1386: 0x1961, 0x1387: 0x1969, 0x1388: 0x1ac9, 0x1389: 0x1989, 0x138a: 0x1ad1, 0x138b: 0x1ad9, + 0x138c: 0x19b9, 0x138d: 0x1ae1, 0x138e: 0x19c1, 0x138f: 0x19c9, 0x1390: 0x1a31, 0x1391: 0x1ae9, + 0x1392: 0x1af1, 0x1393: 0x1a09, 0x1394: 0x1af9, 0x1395: 0x1a11, 0x1396: 0x1a19, 0x1397: 0x1751, + 0x1398: 0x1759, 0x1399: 0x1b01, 0x139a: 0x1761, 0x139b: 0x1b09, 0x139c: 0x1771, 0x139d: 0x1779, + 0x139e: 0x1781, 0x139f: 0x1789, 0x13a0: 0x1b11, 0x13a1: 0x17a1, 0x13a2: 0x17a9, 0x13a3: 0x17b1, + 0x13a4: 0x17b9, 0x13a5: 0x1b19, 0x13a6: 0x17d9, 0x13a7: 0x17f1, 0x13a8: 0x17f9, 0x13a9: 0x1801, + 0x13aa: 0x1809, 0x13ab: 0x1811, 0x13ac: 0x1821, 0x13ad: 0x1829, 0x13ae: 0x1831, 0x13af: 0x1839, + 0x13b0: 0x1841, 0x13b1: 0x1849, 0x13b2: 0x1b21, 0x13b3: 0x1851, 0x13b4: 0x1859, 0x13b5: 0x1861, + 0x13b6: 0x1869, 0x13b7: 0x1871, 0x13b8: 0x1879, 0x13b9: 0x1889, 0x13ba: 0x1891, 0x13bb: 0x1899, + 0x13bc: 0x18a1, 0x13bd: 0x18a9, 0x13be: 0x18b1, 0x13bf: 0x18b9, // Block 0x4f, offset 0x13c0 - 0x13c0: 0x8649, 0x13c1: 0x8671, 0x13c2: 0x8699, 0x13c3: 0x86c1, 0x13c4: 0x86e9, 0x13c5: 0x8711, - 0x13c6: 0x8739, 0x13c7: 0x8761, 0x13c8: 0x8789, 0x13c9: 0x87b1, 0x13ca: 0x87d9, 0x13cb: 0x8801, - 0x13cc: 0x8829, 0x13cd: 0x8851, 0x13ce: 0x8879, 0x13cf: 0x88a1, 0x13d0: 0x88c9, 0x13d1: 0x88f1, - 0x13d2: 0x8919, 0x13d3: 0x8941, 0x13d4: 0x8969, 0x13d5: 0x8991, 0x13d6: 0x89b9, 0x13d7: 0x89e1, - 0x13d8: 0x8a09, 0x13d9: 0x8a31, 0x13da: 0x8a59, 0x13db: 0x8a81, 0x13dc: 0x8aa9, 0x13dd: 0x8ad1, - 0x13de: 0x8afa, 0x13df: 0x8b2a, 0x13e0: 0x8b5a, 0x13e1: 0x8b8a, 0x13e2: 0x8bba, 0x13e3: 0x8bea, - 0x13e4: 0x8c19, 0x13e5: 0x8c41, 0x13e6: 0x7cc1, 0x13e7: 0x8c69, 0x13e8: 0x7c31, 0x13e9: 0x7ce9, - 0x13ea: 0x8c91, 0x13eb: 0x8cb9, 0x13ec: 0x7d89, 0x13ed: 0x8ce1, 0x13ee: 0x7db1, 0x13ef: 0x7dd9, - 0x13f0: 0x8d09, 0x13f1: 0x8d31, 0x13f2: 0x7e79, 0x13f3: 0x8d59, 0x13f4: 0x7ea1, 0x13f5: 0x7ec9, - 0x13f6: 0x8d81, 0x13f7: 0x8da9, 0x13f8: 0x7f19, 0x13f9: 0x8dd1, 0x13fa: 0x7f41, 0x13fb: 0x7f69, - 0x13fc: 0x83f1, 0x13fd: 0x8419, 0x13fe: 0x8491, 0x13ff: 0x84b9, + 0x13c0: 0x18c1, 0x13c1: 0x18c9, 0x13c2: 0x18e1, 0x13c3: 0x18e9, 0x13c4: 0x1909, 0x13c5: 0x1911, + 0x13c6: 0x1919, 0x13c7: 0x1921, 0x13c8: 0x1929, 0x13c9: 0x1941, 0x13ca: 0x1949, 0x13cb: 0x1951, + 0x13cc: 0x1959, 0x13cd: 0x1b29, 0x13ce: 0x1971, 0x13cf: 0x1979, 0x13d0: 0x1981, 0x13d1: 0x1989, + 0x13d2: 0x19a1, 0x13d3: 0x19a9, 0x13d4: 0x19b1, 0x13d5: 0x19b9, 0x13d6: 0x1b31, 0x13d7: 0x19d1, + 0x13d8: 0x19d9, 0x13d9: 0x1b39, 0x13da: 0x19f1, 0x13db: 0x19f9, 0x13dc: 0x1a01, 0x13dd: 0x1a09, + 0x13de: 0x1b41, 0x13df: 0x1761, 0x13e0: 0x1b09, 0x13e1: 0x1789, 0x13e2: 0x1b11, 0x13e3: 0x17b9, + 0x13e4: 0x1b19, 0x13e5: 0x17d9, 0x13e6: 0x1b49, 0x13e7: 0x1841, 0x13e8: 0x1b51, 0x13e9: 0x1b59, + 0x13ea: 0x1b61, 0x13eb: 0x1921, 0x13ec: 0x1929, 0x13ed: 0x1959, 0x13ee: 0x19b9, 0x13ef: 0x1b31, + 0x13f0: 0x1a09, 0x13f1: 0x1b41, 0x13f2: 0x1b69, 0x13f3: 0x1b71, 0x13f4: 0x1b79, 0x13f5: 0x1b81, + 0x13f6: 0x1b89, 0x13f7: 0x1b91, 0x13f8: 0x1b99, 0x13f9: 0x1ba1, 0x13fa: 0x1ba9, 0x13fb: 0x1bb1, + 0x13fc: 0x1bb9, 0x13fd: 0x1bc1, 0x13fe: 0x1bc9, 0x13ff: 0x1bd1, // Block 0x50, offset 0x1400 - 0x1400: 0x84e1, 0x1401: 0x8581, 0x1402: 0x85a9, 0x1403: 0x85d1, 0x1404: 0x85f9, 0x1405: 0x8699, - 0x1406: 0x86c1, 0x1407: 0x86e9, 0x1408: 0x8df9, 0x1409: 0x8789, 0x140a: 0x8e21, 0x140b: 0x8e49, - 0x140c: 0x8879, 0x140d: 0x8e71, 0x140e: 0x88a1, 0x140f: 0x88c9, 0x1410: 0x8ad1, 0x1411: 0x8e99, - 0x1412: 0x8ec1, 0x1413: 0x8a09, 0x1414: 0x8ee9, 0x1415: 0x8a31, 0x1416: 0x8a59, 0x1417: 0x7c71, - 0x1418: 0x7c99, 0x1419: 0x8f11, 0x141a: 0x7cc1, 0x141b: 0x8f39, 0x141c: 0x7d11, 0x141d: 0x7d39, - 0x141e: 0x7d61, 0x141f: 0x7d89, 0x1420: 0x8f61, 0x1421: 0x7e01, 0x1422: 0x7e29, 0x1423: 0x7e51, - 0x1424: 0x7e79, 0x1425: 0x8f89, 0x1426: 0x7f19, 0x1427: 0x7f91, 0x1428: 0x7fb9, 0x1429: 0x7fe1, - 0x142a: 0x8009, 0x142b: 0x8031, 0x142c: 0x8081, 0x142d: 0x80a9, 0x142e: 0x80d1, 0x142f: 0x80f9, - 0x1430: 0x8121, 0x1431: 0x8149, 0x1432: 0x8fb1, 0x1433: 0x8171, 0x1434: 0x8199, 0x1435: 0x81c1, - 0x1436: 0x81e9, 0x1437: 0x8211, 0x1438: 0x8239, 0x1439: 0x8289, 0x143a: 0x82b1, 0x143b: 0x82d9, - 0x143c: 0x8301, 0x143d: 0x8329, 0x143e: 0x8351, 0x143f: 0x8379, + 0x1400: 0x1bd9, 0x1401: 0x1be1, 0x1402: 0x1be9, 0x1403: 0x1bf1, 0x1404: 0x1bf9, 0x1405: 0x1c01, + 0x1406: 0x1c09, 0x1407: 0x1c11, 0x1408: 0x1c19, 0x1409: 0x1c21, 0x140a: 0x1c29, 0x140b: 0x1c31, + 0x140c: 0x1b59, 0x140d: 0x1c39, 0x140e: 0x1c41, 0x140f: 0x1c49, 0x1410: 0x1c51, 0x1411: 0x1b81, + 0x1412: 0x1b89, 0x1413: 0x1b91, 0x1414: 0x1b99, 0x1415: 0x1ba1, 0x1416: 0x1ba9, 0x1417: 0x1bb1, + 0x1418: 0x1bb9, 0x1419: 0x1bc1, 0x141a: 0x1bc9, 0x141b: 0x1bd1, 0x141c: 0x1bd9, 0x141d: 0x1be1, + 0x141e: 0x1be9, 0x141f: 0x1bf1, 0x1420: 0x1bf9, 0x1421: 0x1c01, 0x1422: 0x1c09, 0x1423: 0x1c11, + 0x1424: 0x1c19, 0x1425: 0x1c21, 0x1426: 0x1c29, 0x1427: 0x1c31, 0x1428: 0x1b59, 0x1429: 0x1c39, + 0x142a: 0x1c41, 0x142b: 0x1c49, 0x142c: 0x1c51, 0x142d: 0x1c21, 0x142e: 0x1c29, 0x142f: 0x1c31, + 0x1430: 0x1b59, 0x1431: 0x1b51, 0x1432: 0x1b61, 0x1433: 0x1881, 0x1434: 0x1829, 0x1435: 0x1831, + 0x1436: 0x1839, 0x1437: 0x1c21, 0x1438: 0x1c29, 0x1439: 0x1c31, 0x143a: 0x1881, 0x143b: 0x1889, + 0x143c: 0x1c59, 0x143d: 0x1c59, 0x143e: 0x0018, 0x143f: 0x0018, // Block 0x51, offset 0x1440 - 0x1440: 0x83a1, 0x1441: 0x83c9, 0x1442: 0x8441, 0x1443: 0x8469, 0x1444: 0x8509, 0x1445: 0x8531, - 0x1446: 0x8559, 0x1447: 0x8581, 0x1448: 0x85a9, 0x1449: 0x8621, 0x144a: 0x8649, 0x144b: 0x8671, - 0x144c: 0x8699, 0x144d: 0x8fd9, 0x144e: 0x8711, 0x144f: 0x8739, 0x1450: 0x8761, 0x1451: 0x8789, - 0x1452: 0x8801, 0x1453: 0x8829, 0x1454: 0x8851, 0x1455: 0x8879, 0x1456: 0x9001, 0x1457: 0x88f1, - 0x1458: 0x8919, 0x1459: 0x9029, 0x145a: 0x8991, 0x145b: 0x89b9, 0x145c: 0x89e1, 0x145d: 0x8a09, - 0x145e: 0x9051, 0x145f: 0x7cc1, 0x1460: 0x8f39, 0x1461: 0x7d89, 0x1462: 0x8f61, 0x1463: 0x7e79, - 0x1464: 0x8f89, 0x1465: 0x7f19, 0x1466: 0x9079, 0x1467: 0x8121, 0x1468: 0x90a1, 0x1469: 0x90c9, - 0x146a: 0x90f1, 0x146b: 0x8581, 0x146c: 0x85a9, 0x146d: 0x8699, 0x146e: 0x8879, 0x146f: 0x9001, - 0x1470: 0x8a09, 0x1471: 0x9051, 0x1472: 0x9119, 0x1473: 0x9151, 0x1474: 0x9189, 0x1475: 0x91c1, - 0x1476: 0x91e9, 0x1477: 0x9211, 0x1478: 0x9239, 0x1479: 0x9261, 0x147a: 0x9289, 0x147b: 0x92b1, - 0x147c: 0x92d9, 0x147d: 0x9301, 0x147e: 0x9329, 0x147f: 0x9351, + 0x1440: 0x0040, 0x1441: 0x0040, 0x1442: 0x0040, 0x1443: 0x0040, 0x1444: 0x0040, 0x1445: 0x0040, + 0x1446: 0x0040, 0x1447: 0x0040, 0x1448: 0x0040, 0x1449: 0x0040, 0x144a: 0x0040, 0x144b: 0x0040, + 0x144c: 0x0040, 0x144d: 0x0040, 0x144e: 0x0040, 0x144f: 0x0040, 0x1450: 0x1c61, 0x1451: 0x1c69, + 0x1452: 0x1c69, 0x1453: 0x1c71, 0x1454: 0x1c79, 0x1455: 0x1c81, 0x1456: 0x1c89, 0x1457: 0x1c91, + 0x1458: 0x1c99, 0x1459: 0x1c99, 0x145a: 0x1ca1, 0x145b: 0x1ca9, 0x145c: 0x1cb1, 0x145d: 0x1cb9, + 0x145e: 0x1cc1, 0x145f: 0x1cc9, 0x1460: 0x1cc9, 0x1461: 0x1cd1, 0x1462: 0x1cd9, 0x1463: 0x1cd9, + 0x1464: 0x1ce1, 0x1465: 0x1ce1, 0x1466: 0x1ce9, 0x1467: 0x1cf1, 0x1468: 0x1cf1, 0x1469: 0x1cf9, + 0x146a: 0x1d01, 0x146b: 0x1d01, 0x146c: 0x1d09, 0x146d: 0x1d09, 0x146e: 0x1d11, 0x146f: 0x1d19, + 0x1470: 0x1d19, 0x1471: 0x1d21, 0x1472: 0x1d21, 0x1473: 0x1d29, 0x1474: 0x1d31, 0x1475: 0x1d39, + 0x1476: 0x1d41, 0x1477: 0x1d41, 0x1478: 0x1d49, 0x1479: 0x1d51, 0x147a: 0x1d59, 0x147b: 0x1d61, + 0x147c: 0x1d69, 0x147d: 0x1d69, 0x147e: 0x1d71, 0x147f: 0x1d79, // Block 0x52, offset 0x1480 - 0x1480: 0x9379, 0x1481: 0x93a1, 0x1482: 0x93c9, 0x1483: 0x93f1, 0x1484: 0x9419, 0x1485: 0x9441, - 0x1486: 0x9469, 0x1487: 0x9491, 0x1488: 0x94b9, 0x1489: 0x94e1, 0x148a: 0x9509, 0x148b: 0x9531, - 0x148c: 0x90c9, 0x148d: 0x9559, 0x148e: 0x9581, 0x148f: 0x95a9, 0x1490: 0x95d1, 0x1491: 0x91c1, - 0x1492: 0x91e9, 0x1493: 0x9211, 0x1494: 0x9239, 0x1495: 0x9261, 0x1496: 0x9289, 0x1497: 0x92b1, - 0x1498: 0x92d9, 0x1499: 0x9301, 0x149a: 0x9329, 0x149b: 0x9351, 0x149c: 0x9379, 0x149d: 0x93a1, - 0x149e: 0x93c9, 0x149f: 0x93f1, 0x14a0: 0x9419, 0x14a1: 0x9441, 0x14a2: 0x9469, 0x14a3: 0x9491, - 0x14a4: 0x94b9, 0x14a5: 0x94e1, 0x14a6: 0x9509, 0x14a7: 0x9531, 0x14a8: 0x90c9, 0x14a9: 0x9559, - 0x14aa: 0x9581, 0x14ab: 0x95a9, 0x14ac: 0x95d1, 0x14ad: 0x94e1, 0x14ae: 0x9509, 0x14af: 0x9531, - 0x14b0: 0x90c9, 0x14b1: 0x90a1, 0x14b2: 0x90f1, 0x14b3: 0x8261, 0x14b4: 0x80a9, 0x14b5: 0x80d1, - 0x14b6: 0x80f9, 0x14b7: 0x94e1, 0x14b8: 0x9509, 0x14b9: 0x9531, 0x14ba: 0x8261, 0x14bb: 0x8289, - 0x14bc: 0x95f9, 0x14bd: 0x95f9, 0x14be: 0x0018, 0x14bf: 0x0018, + 0x1480: 0x1f29, 0x1481: 0x1f31, 0x1482: 0x1f39, 0x1483: 0x1f11, 0x1484: 0x1d39, 0x1485: 0x1ce9, + 0x1486: 0x1f41, 0x1487: 0x1f49, 0x1488: 0x0040, 0x1489: 0x0040, 0x148a: 0x0040, 0x148b: 0x0040, + 0x148c: 0x0040, 0x148d: 0x0040, 0x148e: 0x0040, 0x148f: 0x0040, 0x1490: 0x0040, 0x1491: 0x0040, + 0x1492: 0x0040, 0x1493: 0x0040, 0x1494: 0x0040, 0x1495: 0x0040, 0x1496: 0x0040, 0x1497: 0x0040, + 0x1498: 0x0040, 0x1499: 0x0040, 0x149a: 0x0040, 0x149b: 0x0040, 0x149c: 0x0040, 0x149d: 0x0040, + 0x149e: 0x0040, 0x149f: 0x0040, 0x14a0: 0x0040, 0x14a1: 0x0040, 0x14a2: 0x0040, 0x14a3: 0x0040, + 0x14a4: 0x0040, 0x14a5: 0x0040, 0x14a6: 0x0040, 0x14a7: 0x0040, 0x14a8: 0x0040, 0x14a9: 0x0040, + 0x14aa: 0x0040, 0x14ab: 0x0040, 0x14ac: 0x0040, 0x14ad: 0x0040, 0x14ae: 0x0040, 0x14af: 0x0040, + 0x14b0: 0x1f51, 0x14b1: 0x1f59, 0x14b2: 0x1f61, 0x14b3: 0x1f69, 0x14b4: 0x1f71, 0x14b5: 0x1f79, + 0x14b6: 0x1f81, 0x14b7: 0x1f89, 0x14b8: 0x1f91, 0x14b9: 0x1f99, 0x14ba: 0x1fa2, 0x14bb: 0x1faa, + 0x14bc: 0x1fb1, 0x14bd: 0x0018, 0x14be: 0x0040, 0x14bf: 0x0040, // Block 0x53, offset 0x14c0 - 0x14c0: 0x0040, 0x14c1: 0x0040, 0x14c2: 0x0040, 0x14c3: 0x0040, 0x14c4: 0x0040, 0x14c5: 0x0040, - 0x14c6: 0x0040, 0x14c7: 0x0040, 0x14c8: 0x0040, 0x14c9: 0x0040, 0x14ca: 0x0040, 0x14cb: 0x0040, - 0x14cc: 0x0040, 0x14cd: 0x0040, 0x14ce: 0x0040, 0x14cf: 0x0040, 0x14d0: 0x9621, 0x14d1: 0x9659, - 0x14d2: 0x9659, 0x14d3: 0x9691, 0x14d4: 0x96c9, 0x14d5: 0x9701, 0x14d6: 0x9739, 0x14d7: 0x9771, - 0x14d8: 0x97a9, 0x14d9: 0x97a9, 0x14da: 0x97e1, 0x14db: 0x9819, 0x14dc: 0x9851, 0x14dd: 0x9889, - 0x14de: 0x98c1, 0x14df: 0x98f9, 0x14e0: 0x98f9, 0x14e1: 0x9931, 0x14e2: 0x9969, 0x14e3: 0x9969, - 0x14e4: 0x99a1, 0x14e5: 0x99a1, 0x14e6: 0x99d9, 0x14e7: 0x9a11, 0x14e8: 0x9a11, 0x14e9: 0x9a49, - 0x14ea: 0x9a81, 0x14eb: 0x9a81, 0x14ec: 0x9ab9, 0x14ed: 0x9ab9, 0x14ee: 0x9af1, 0x14ef: 0x9b29, - 0x14f0: 0x9b29, 0x14f1: 0x9b61, 0x14f2: 0x9b61, 0x14f3: 0x9b99, 0x14f4: 0x9bd1, 0x14f5: 0x9c09, - 0x14f6: 0x9c41, 0x14f7: 0x9c41, 0x14f8: 0x9c79, 0x14f9: 0x9cb1, 0x14fa: 0x9ce9, 0x14fb: 0x9d21, - 0x14fc: 0x9d59, 0x14fd: 0x9d59, 0x14fe: 0x9d91, 0x14ff: 0x9dc9, + 0x14c0: 0x33c0, 0x14c1: 0x33c0, 0x14c2: 0x33c0, 0x14c3: 0x33c0, 0x14c4: 0x33c0, 0x14c5: 0x33c0, + 0x14c6: 0x33c0, 0x14c7: 0x33c0, 0x14c8: 0x33c0, 0x14c9: 0x33c0, 0x14ca: 0x33c0, 0x14cb: 0x33c0, + 0x14cc: 0x33c0, 0x14cd: 0x33c0, 0x14ce: 0x33c0, 0x14cf: 0x33c0, 0x14d0: 0x1fba, 0x14d1: 0x7d8d, + 0x14d2: 0x0040, 0x14d3: 0x1fc2, 0x14d4: 0x0122, 0x14d5: 0x1fca, 0x14d6: 0x1fd2, 0x14d7: 0x7dad, + 0x14d8: 0x7dcd, 0x14d9: 0x0040, 0x14da: 0x0040, 0x14db: 0x0040, 0x14dc: 0x0040, 0x14dd: 0x0040, + 0x14de: 0x0040, 0x14df: 0x0040, 0x14e0: 0x3308, 0x14e1: 0x3308, 0x14e2: 0x3308, 0x14e3: 0x3308, + 0x14e4: 0x3308, 0x14e5: 0x3308, 0x14e6: 0x3308, 0x14e7: 0x3308, 0x14e8: 0x3308, 0x14e9: 0x3308, + 0x14ea: 0x3308, 0x14eb: 0x3308, 0x14ec: 0x3308, 0x14ed: 0x3308, 0x14ee: 0x3308, 0x14ef: 0x3308, + 0x14f0: 0x0040, 0x14f1: 0x7ded, 0x14f2: 0x7e0d, 0x14f3: 0x1fda, 0x14f4: 0x1fda, 0x14f5: 0x072a, + 0x14f6: 0x0732, 0x14f7: 0x1fe2, 0x14f8: 0x1fea, 0x14f9: 0x7e2d, 0x14fa: 0x7e4d, 0x14fb: 0x7e6d, + 0x14fc: 0x7e2d, 0x14fd: 0x7e8d, 0x14fe: 0x7ead, 0x14ff: 0x7e8d, // Block 0x54, offset 0x1500 - 0x1500: 0xa999, 0x1501: 0xa9d1, 0x1502: 0xaa09, 0x1503: 0xa8f1, 0x1504: 0x9c09, 0x1505: 0x99d9, - 0x1506: 0xaa41, 0x1507: 0xaa79, 0x1508: 0x0040, 0x1509: 0x0040, 0x150a: 0x0040, 0x150b: 0x0040, - 0x150c: 0x0040, 0x150d: 0x0040, 0x150e: 0x0040, 0x150f: 0x0040, 0x1510: 0x0040, 0x1511: 0x0040, - 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0040, 0x1515: 0x0040, 0x1516: 0x0040, 0x1517: 0x0040, - 0x1518: 0x0040, 0x1519: 0x0040, 0x151a: 0x0040, 0x151b: 0x0040, 0x151c: 0x0040, 0x151d: 0x0040, - 0x151e: 0x0040, 0x151f: 0x0040, 0x1520: 0x0040, 0x1521: 0x0040, 0x1522: 0x0040, 0x1523: 0x0040, - 0x1524: 0x0040, 0x1525: 0x0040, 0x1526: 0x0040, 0x1527: 0x0040, 0x1528: 0x0040, 0x1529: 0x0040, - 0x152a: 0x0040, 0x152b: 0x0040, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, - 0x1530: 0xaab1, 0x1531: 0xaae9, 0x1532: 0xab21, 0x1533: 0xab69, 0x1534: 0xabb1, 0x1535: 0xabf9, - 0x1536: 0xac41, 0x1537: 0xac89, 0x1538: 0xacd1, 0x1539: 0xad19, 0x153a: 0xad52, 0x153b: 0xae62, - 0x153c: 0xaee1, 0x153d: 0x0018, 0x153e: 0x0040, 0x153f: 0x0040, + 0x1500: 0x7ecd, 0x1501: 0x7eed, 0x1502: 0x7f0d, 0x1503: 0x7eed, 0x1504: 0x7f2d, 0x1505: 0x0018, + 0x1506: 0x0018, 0x1507: 0x1ff2, 0x1508: 0x1ffa, 0x1509: 0x7f4e, 0x150a: 0x7f6e, 0x150b: 0x7f8e, + 0x150c: 0x7fae, 0x150d: 0x1fda, 0x150e: 0x1fda, 0x150f: 0x1fda, 0x1510: 0x1fba, 0x1511: 0x7fcd, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0122, 0x1515: 0x1fc2, 0x1516: 0x1fd2, 0x1517: 0x1fca, + 0x1518: 0x7fed, 0x1519: 0x072a, 0x151a: 0x0732, 0x151b: 0x1fe2, 0x151c: 0x1fea, 0x151d: 0x7ecd, + 0x151e: 0x7f2d, 0x151f: 0x2002, 0x1520: 0x200a, 0x1521: 0x2012, 0x1522: 0x071a, 0x1523: 0x2019, + 0x1524: 0x2022, 0x1525: 0x202a, 0x1526: 0x0722, 0x1527: 0x0040, 0x1528: 0x2032, 0x1529: 0x203a, + 0x152a: 0x2042, 0x152b: 0x204a, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x800e, 0x1531: 0x2051, 0x1532: 0x802e, 0x1533: 0x0808, 0x1534: 0x804e, 0x1535: 0x0040, + 0x1536: 0x806e, 0x1537: 0x2059, 0x1538: 0x808e, 0x1539: 0x2061, 0x153a: 0x80ae, 0x153b: 0x2069, + 0x153c: 0x80ce, 0x153d: 0x2071, 0x153e: 0x80ee, 0x153f: 0x2079, // Block 0x55, offset 0x1540 - 0x1540: 0x33c0, 0x1541: 0x33c0, 0x1542: 0x33c0, 0x1543: 0x33c0, 0x1544: 0x33c0, 0x1545: 0x33c0, - 0x1546: 0x33c0, 0x1547: 0x33c0, 0x1548: 0x33c0, 0x1549: 0x33c0, 0x154a: 0x33c0, 0x154b: 0x33c0, - 0x154c: 0x33c0, 0x154d: 0x33c0, 0x154e: 0x33c0, 0x154f: 0x33c0, 0x1550: 0xaf2a, 0x1551: 0x7d8d, - 0x1552: 0x0040, 0x1553: 0xaf3a, 0x1554: 0x03c2, 0x1555: 0xaf4a, 0x1556: 0xaf5a, 0x1557: 0x7dad, - 0x1558: 0x7dcd, 0x1559: 0x0040, 0x155a: 0x0040, 0x155b: 0x0040, 0x155c: 0x0040, 0x155d: 0x0040, - 0x155e: 0x0040, 0x155f: 0x0040, 0x1560: 0x3308, 0x1561: 0x3308, 0x1562: 0x3308, 0x1563: 0x3308, - 0x1564: 0x3308, 0x1565: 0x3308, 0x1566: 0x3308, 0x1567: 0x3308, 0x1568: 0x3308, 0x1569: 0x3308, - 0x156a: 0x3308, 0x156b: 0x3308, 0x156c: 0x3308, 0x156d: 0x3308, 0x156e: 0x3308, 0x156f: 0x3308, - 0x1570: 0x0040, 0x1571: 0x7ded, 0x1572: 0x7e0d, 0x1573: 0xaf6a, 0x1574: 0xaf6a, 0x1575: 0x1fd2, - 0x1576: 0x1fe2, 0x1577: 0xaf7a, 0x1578: 0xaf8a, 0x1579: 0x7e2d, 0x157a: 0x7e4d, 0x157b: 0x7e6d, - 0x157c: 0x7e2d, 0x157d: 0x7e8d, 0x157e: 0x7ead, 0x157f: 0x7e8d, + 0x1540: 0x2081, 0x1541: 0x2089, 0x1542: 0x2089, 0x1543: 0x2091, 0x1544: 0x2091, 0x1545: 0x2099, + 0x1546: 0x2099, 0x1547: 0x20a1, 0x1548: 0x20a1, 0x1549: 0x20a9, 0x154a: 0x20a9, 0x154b: 0x20a9, + 0x154c: 0x20a9, 0x154d: 0x20b1, 0x154e: 0x20b1, 0x154f: 0x20b9, 0x1550: 0x20b9, 0x1551: 0x20b9, + 0x1552: 0x20b9, 0x1553: 0x20c1, 0x1554: 0x20c1, 0x1555: 0x20c9, 0x1556: 0x20c9, 0x1557: 0x20c9, + 0x1558: 0x20c9, 0x1559: 0x20d1, 0x155a: 0x20d1, 0x155b: 0x20d1, 0x155c: 0x20d1, 0x155d: 0x20d9, + 0x155e: 0x20d9, 0x155f: 0x20d9, 0x1560: 0x20d9, 0x1561: 0x20e1, 0x1562: 0x20e1, 0x1563: 0x20e1, + 0x1564: 0x20e1, 0x1565: 0x20e9, 0x1566: 0x20e9, 0x1567: 0x20e9, 0x1568: 0x20e9, 0x1569: 0x20f1, + 0x156a: 0x20f1, 0x156b: 0x20f9, 0x156c: 0x20f9, 0x156d: 0x2101, 0x156e: 0x2101, 0x156f: 0x2109, + 0x1570: 0x2109, 0x1571: 0x2111, 0x1572: 0x2111, 0x1573: 0x2111, 0x1574: 0x2111, 0x1575: 0x2119, + 0x1576: 0x2119, 0x1577: 0x2119, 0x1578: 0x2119, 0x1579: 0x2121, 0x157a: 0x2121, 0x157b: 0x2121, + 0x157c: 0x2121, 0x157d: 0x2129, 0x157e: 0x2129, 0x157f: 0x2129, // Block 0x56, offset 0x1580 - 0x1580: 0x7ecd, 0x1581: 0x7eed, 0x1582: 0x7f0d, 0x1583: 0x7eed, 0x1584: 0x7f2d, 0x1585: 0x0018, - 0x1586: 0x0018, 0x1587: 0xaf9a, 0x1588: 0xafaa, 0x1589: 0x7f4e, 0x158a: 0x7f6e, 0x158b: 0x7f8e, - 0x158c: 0x7fae, 0x158d: 0xaf6a, 0x158e: 0xaf6a, 0x158f: 0xaf6a, 0x1590: 0xaf2a, 0x1591: 0x7fcd, - 0x1592: 0x0040, 0x1593: 0x0040, 0x1594: 0x03c2, 0x1595: 0xaf3a, 0x1596: 0xaf5a, 0x1597: 0xaf4a, - 0x1598: 0x7fed, 0x1599: 0x1fd2, 0x159a: 0x1fe2, 0x159b: 0xaf7a, 0x159c: 0xaf8a, 0x159d: 0x7ecd, - 0x159e: 0x7f2d, 0x159f: 0xafba, 0x15a0: 0xafca, 0x15a1: 0xafda, 0x15a2: 0x1fb2, 0x15a3: 0xafe9, - 0x15a4: 0xaffa, 0x15a5: 0xb00a, 0x15a6: 0x1fc2, 0x15a7: 0x0040, 0x15a8: 0xb01a, 0x15a9: 0xb02a, - 0x15aa: 0xb03a, 0x15ab: 0xb04a, 0x15ac: 0x0040, 0x15ad: 0x0040, 0x15ae: 0x0040, 0x15af: 0x0040, - 0x15b0: 0x800e, 0x15b1: 0xb059, 0x15b2: 0x802e, 0x15b3: 0x0808, 0x15b4: 0x804e, 0x15b5: 0x0040, - 0x15b6: 0x806e, 0x15b7: 0xb081, 0x15b8: 0x808e, 0x15b9: 0xb0a9, 0x15ba: 0x80ae, 0x15bb: 0xb0d1, - 0x15bc: 0x80ce, 0x15bd: 0xb0f9, 0x15be: 0x80ee, 0x15bf: 0xb121, + 0x1580: 0x2129, 0x1581: 0x2131, 0x1582: 0x2131, 0x1583: 0x2131, 0x1584: 0x2131, 0x1585: 0x2139, + 0x1586: 0x2139, 0x1587: 0x2139, 0x1588: 0x2139, 0x1589: 0x2141, 0x158a: 0x2141, 0x158b: 0x2141, + 0x158c: 0x2141, 0x158d: 0x2149, 0x158e: 0x2149, 0x158f: 0x2149, 0x1590: 0x2149, 0x1591: 0x2151, + 0x1592: 0x2151, 0x1593: 0x2151, 0x1594: 0x2151, 0x1595: 0x2159, 0x1596: 0x2159, 0x1597: 0x2159, + 0x1598: 0x2159, 0x1599: 0x2161, 0x159a: 0x2161, 0x159b: 0x2161, 0x159c: 0x2161, 0x159d: 0x2169, + 0x159e: 0x2169, 0x159f: 0x2169, 0x15a0: 0x2169, 0x15a1: 0x2171, 0x15a2: 0x2171, 0x15a3: 0x2171, + 0x15a4: 0x2171, 0x15a5: 0x2179, 0x15a6: 0x2179, 0x15a7: 0x2179, 0x15a8: 0x2179, 0x15a9: 0x2181, + 0x15aa: 0x2181, 0x15ab: 0x2181, 0x15ac: 0x2181, 0x15ad: 0x2189, 0x15ae: 0x2189, 0x15af: 0x1701, + 0x15b0: 0x1701, 0x15b1: 0x2191, 0x15b2: 0x2191, 0x15b3: 0x2191, 0x15b4: 0x2191, 0x15b5: 0x2199, + 0x15b6: 0x2199, 0x15b7: 0x21a1, 0x15b8: 0x21a1, 0x15b9: 0x21a9, 0x15ba: 0x21a9, 0x15bb: 0x21b1, + 0x15bc: 0x21b1, 0x15bd: 0x0040, 0x15be: 0x0040, 0x15bf: 0x03c0, // Block 0x57, offset 0x15c0 - 0x15c0: 0xb149, 0x15c1: 0xb161, 0x15c2: 0xb161, 0x15c3: 0xb179, 0x15c4: 0xb179, 0x15c5: 0xb191, - 0x15c6: 0xb191, 0x15c7: 0xb1a9, 0x15c8: 0xb1a9, 0x15c9: 0xb1c1, 0x15ca: 0xb1c1, 0x15cb: 0xb1c1, - 0x15cc: 0xb1c1, 0x15cd: 0xb1d9, 0x15ce: 0xb1d9, 0x15cf: 0xb1f1, 0x15d0: 0xb1f1, 0x15d1: 0xb1f1, - 0x15d2: 0xb1f1, 0x15d3: 0xb209, 0x15d4: 0xb209, 0x15d5: 0xb221, 0x15d6: 0xb221, 0x15d7: 0xb221, - 0x15d8: 0xb221, 0x15d9: 0xb239, 0x15da: 0xb239, 0x15db: 0xb239, 0x15dc: 0xb239, 0x15dd: 0xb251, - 0x15de: 0xb251, 0x15df: 0xb251, 0x15e0: 0xb251, 0x15e1: 0xb269, 0x15e2: 0xb269, 0x15e3: 0xb269, - 0x15e4: 0xb269, 0x15e5: 0xb281, 0x15e6: 0xb281, 0x15e7: 0xb281, 0x15e8: 0xb281, 0x15e9: 0xb299, - 0x15ea: 0xb299, 0x15eb: 0xb2b1, 0x15ec: 0xb2b1, 0x15ed: 0xb2c9, 0x15ee: 0xb2c9, 0x15ef: 0xb2e1, - 0x15f0: 0xb2e1, 0x15f1: 0xb2f9, 0x15f2: 0xb2f9, 0x15f3: 0xb2f9, 0x15f4: 0xb2f9, 0x15f5: 0xb311, - 0x15f6: 0xb311, 0x15f7: 0xb311, 0x15f8: 0xb311, 0x15f9: 0xb329, 0x15fa: 0xb329, 0x15fb: 0xb329, - 0x15fc: 0xb329, 0x15fd: 0xb341, 0x15fe: 0xb341, 0x15ff: 0xb341, + 0x15c0: 0x0040, 0x15c1: 0x1fca, 0x15c2: 0x21ba, 0x15c3: 0x2002, 0x15c4: 0x203a, 0x15c5: 0x2042, + 0x15c6: 0x200a, 0x15c7: 0x21c2, 0x15c8: 0x072a, 0x15c9: 0x0732, 0x15ca: 0x2012, 0x15cb: 0x071a, + 0x15cc: 0x1fba, 0x15cd: 0x2019, 0x15ce: 0x0961, 0x15cf: 0x21ca, 0x15d0: 0x06e1, 0x15d1: 0x0049, + 0x15d2: 0x0029, 0x15d3: 0x0031, 0x15d4: 0x06e9, 0x15d5: 0x06f1, 0x15d6: 0x06f9, 0x15d7: 0x0701, + 0x15d8: 0x0709, 0x15d9: 0x0711, 0x15da: 0x1fc2, 0x15db: 0x0122, 0x15dc: 0x2022, 0x15dd: 0x0722, + 0x15de: 0x202a, 0x15df: 0x1fd2, 0x15e0: 0x204a, 0x15e1: 0x0019, 0x15e2: 0x02e9, 0x15e3: 0x03d9, + 0x15e4: 0x02f1, 0x15e5: 0x02f9, 0x15e6: 0x03f1, 0x15e7: 0x0309, 0x15e8: 0x00a9, 0x15e9: 0x0311, + 0x15ea: 0x00b1, 0x15eb: 0x0319, 0x15ec: 0x0101, 0x15ed: 0x0321, 0x15ee: 0x0329, 0x15ef: 0x0051, + 0x15f0: 0x0339, 0x15f1: 0x0751, 0x15f2: 0x00b9, 0x15f3: 0x0089, 0x15f4: 0x0341, 0x15f5: 0x0349, + 0x15f6: 0x0391, 0x15f7: 0x00c1, 0x15f8: 0x0109, 0x15f9: 0x00c9, 0x15fa: 0x04b1, 0x15fb: 0x1ff2, + 0x15fc: 0x2032, 0x15fd: 0x1ffa, 0x15fe: 0x21d2, 0x15ff: 0x1fda, // Block 0x58, offset 0x1600 - 0x1600: 0xb341, 0x1601: 0xb359, 0x1602: 0xb359, 0x1603: 0xb359, 0x1604: 0xb359, 0x1605: 0xb371, - 0x1606: 0xb371, 0x1607: 0xb371, 0x1608: 0xb371, 0x1609: 0xb389, 0x160a: 0xb389, 0x160b: 0xb389, - 0x160c: 0xb389, 0x160d: 0xb3a1, 0x160e: 0xb3a1, 0x160f: 0xb3a1, 0x1610: 0xb3a1, 0x1611: 0xb3b9, - 0x1612: 0xb3b9, 0x1613: 0xb3b9, 0x1614: 0xb3b9, 0x1615: 0xb3d1, 0x1616: 0xb3d1, 0x1617: 0xb3d1, - 0x1618: 0xb3d1, 0x1619: 0xb3e9, 0x161a: 0xb3e9, 0x161b: 0xb3e9, 0x161c: 0xb3e9, 0x161d: 0xb401, - 0x161e: 0xb401, 0x161f: 0xb401, 0x1620: 0xb401, 0x1621: 0xb419, 0x1622: 0xb419, 0x1623: 0xb419, - 0x1624: 0xb419, 0x1625: 0xb431, 0x1626: 0xb431, 0x1627: 0xb431, 0x1628: 0xb431, 0x1629: 0xb449, - 0x162a: 0xb449, 0x162b: 0xb449, 0x162c: 0xb449, 0x162d: 0xb461, 0x162e: 0xb461, 0x162f: 0x7b01, - 0x1630: 0x7b01, 0x1631: 0xb479, 0x1632: 0xb479, 0x1633: 0xb479, 0x1634: 0xb479, 0x1635: 0xb491, - 0x1636: 0xb491, 0x1637: 0xb4b9, 0x1638: 0xb4b9, 0x1639: 0xb4e1, 0x163a: 0xb4e1, 0x163b: 0xb509, - 0x163c: 0xb509, 0x163d: 0x0040, 0x163e: 0x0040, 0x163f: 0x03c0, + 0x1600: 0x0672, 0x1601: 0x0019, 0x1602: 0x02e9, 0x1603: 0x03d9, 0x1604: 0x02f1, 0x1605: 0x02f9, + 0x1606: 0x03f1, 0x1607: 0x0309, 0x1608: 0x00a9, 0x1609: 0x0311, 0x160a: 0x00b1, 0x160b: 0x0319, + 0x160c: 0x0101, 0x160d: 0x0321, 0x160e: 0x0329, 0x160f: 0x0051, 0x1610: 0x0339, 0x1611: 0x0751, + 0x1612: 0x00b9, 0x1613: 0x0089, 0x1614: 0x0341, 0x1615: 0x0349, 0x1616: 0x0391, 0x1617: 0x00c1, + 0x1618: 0x0109, 0x1619: 0x00c9, 0x161a: 0x04b1, 0x161b: 0x1fe2, 0x161c: 0x21da, 0x161d: 0x1fea, + 0x161e: 0x21e2, 0x161f: 0x810d, 0x1620: 0x812d, 0x1621: 0x0961, 0x1622: 0x814d, 0x1623: 0x814d, + 0x1624: 0x816d, 0x1625: 0x818d, 0x1626: 0x81ad, 0x1627: 0x81cd, 0x1628: 0x81ed, 0x1629: 0x820d, + 0x162a: 0x822d, 0x162b: 0x824d, 0x162c: 0x826d, 0x162d: 0x828d, 0x162e: 0x82ad, 0x162f: 0x82cd, + 0x1630: 0x82ed, 0x1631: 0x830d, 0x1632: 0x832d, 0x1633: 0x834d, 0x1634: 0x836d, 0x1635: 0x838d, + 0x1636: 0x83ad, 0x1637: 0x83cd, 0x1638: 0x83ed, 0x1639: 0x840d, 0x163a: 0x842d, 0x163b: 0x844d, + 0x163c: 0x81ed, 0x163d: 0x846d, 0x163e: 0x848d, 0x163f: 0x824d, // Block 0x59, offset 0x1640 - 0x1640: 0x0040, 0x1641: 0xaf4a, 0x1642: 0xb532, 0x1643: 0xafba, 0x1644: 0xb02a, 0x1645: 0xb03a, - 0x1646: 0xafca, 0x1647: 0xb542, 0x1648: 0x1fd2, 0x1649: 0x1fe2, 0x164a: 0xafda, 0x164b: 0x1fb2, - 0x164c: 0xaf2a, 0x164d: 0xafe9, 0x164e: 0x29d1, 0x164f: 0xb552, 0x1650: 0x1f41, 0x1651: 0x00c9, - 0x1652: 0x0069, 0x1653: 0x0079, 0x1654: 0x1f51, 0x1655: 0x1f61, 0x1656: 0x1f71, 0x1657: 0x1f81, - 0x1658: 0x1f91, 0x1659: 0x1fa1, 0x165a: 0xaf3a, 0x165b: 0x03c2, 0x165c: 0xaffa, 0x165d: 0x1fc2, - 0x165e: 0xb00a, 0x165f: 0xaf5a, 0x1660: 0xb04a, 0x1661: 0x0039, 0x1662: 0x0ee9, 0x1663: 0x1159, - 0x1664: 0x0ef9, 0x1665: 0x0f09, 0x1666: 0x1199, 0x1667: 0x0f31, 0x1668: 0x0249, 0x1669: 0x0f41, - 0x166a: 0x0259, 0x166b: 0x0f51, 0x166c: 0x0359, 0x166d: 0x0f61, 0x166e: 0x0f71, 0x166f: 0x00d9, - 0x1670: 0x0f99, 0x1671: 0x2039, 0x1672: 0x0269, 0x1673: 0x01d9, 0x1674: 0x0fa9, 0x1675: 0x0fb9, - 0x1676: 0x1089, 0x1677: 0x0279, 0x1678: 0x0369, 0x1679: 0x0289, 0x167a: 0x13d1, 0x167b: 0xaf9a, - 0x167c: 0xb01a, 0x167d: 0xafaa, 0x167e: 0xb562, 0x167f: 0xaf6a, + 0x1640: 0x84ad, 0x1641: 0x84cd, 0x1642: 0x84ed, 0x1643: 0x850d, 0x1644: 0x852d, 0x1645: 0x854d, + 0x1646: 0x856d, 0x1647: 0x858d, 0x1648: 0x850d, 0x1649: 0x85ad, 0x164a: 0x850d, 0x164b: 0x85cd, + 0x164c: 0x85cd, 0x164d: 0x85ed, 0x164e: 0x85ed, 0x164f: 0x860d, 0x1650: 0x854d, 0x1651: 0x862d, + 0x1652: 0x864d, 0x1653: 0x862d, 0x1654: 0x866d, 0x1655: 0x864d, 0x1656: 0x868d, 0x1657: 0x868d, + 0x1658: 0x86ad, 0x1659: 0x86ad, 0x165a: 0x86cd, 0x165b: 0x86cd, 0x165c: 0x864d, 0x165d: 0x814d, + 0x165e: 0x86ed, 0x165f: 0x870d, 0x1660: 0x0040, 0x1661: 0x872d, 0x1662: 0x874d, 0x1663: 0x876d, + 0x1664: 0x878d, 0x1665: 0x876d, 0x1666: 0x87ad, 0x1667: 0x87cd, 0x1668: 0x87ed, 0x1669: 0x87ed, + 0x166a: 0x880d, 0x166b: 0x880d, 0x166c: 0x882d, 0x166d: 0x882d, 0x166e: 0x880d, 0x166f: 0x880d, + 0x1670: 0x884d, 0x1671: 0x886d, 0x1672: 0x888d, 0x1673: 0x88ad, 0x1674: 0x88cd, 0x1675: 0x88ed, + 0x1676: 0x88ed, 0x1677: 0x88ed, 0x1678: 0x890d, 0x1679: 0x890d, 0x167a: 0x890d, 0x167b: 0x890d, + 0x167c: 0x87ed, 0x167d: 0x87ed, 0x167e: 0x87ed, 0x167f: 0x0040, // Block 0x5a, offset 0x1680 - 0x1680: 0x1caa, 0x1681: 0x0039, 0x1682: 0x0ee9, 0x1683: 0x1159, 0x1684: 0x0ef9, 0x1685: 0x0f09, - 0x1686: 0x1199, 0x1687: 0x0f31, 0x1688: 0x0249, 0x1689: 0x0f41, 0x168a: 0x0259, 0x168b: 0x0f51, - 0x168c: 0x0359, 0x168d: 0x0f61, 0x168e: 0x0f71, 0x168f: 0x00d9, 0x1690: 0x0f99, 0x1691: 0x2039, - 0x1692: 0x0269, 0x1693: 0x01d9, 0x1694: 0x0fa9, 0x1695: 0x0fb9, 0x1696: 0x1089, 0x1697: 0x0279, - 0x1698: 0x0369, 0x1699: 0x0289, 0x169a: 0x13d1, 0x169b: 0xaf7a, 0x169c: 0xb572, 0x169d: 0xaf8a, - 0x169e: 0xb582, 0x169f: 0x810d, 0x16a0: 0x812d, 0x16a1: 0x29d1, 0x16a2: 0x814d, 0x16a3: 0x814d, - 0x16a4: 0x816d, 0x16a5: 0x818d, 0x16a6: 0x81ad, 0x16a7: 0x81cd, 0x16a8: 0x81ed, 0x16a9: 0x820d, - 0x16aa: 0x822d, 0x16ab: 0x824d, 0x16ac: 0x826d, 0x16ad: 0x828d, 0x16ae: 0x82ad, 0x16af: 0x82cd, - 0x16b0: 0x82ed, 0x16b1: 0x830d, 0x16b2: 0x832d, 0x16b3: 0x834d, 0x16b4: 0x836d, 0x16b5: 0x838d, - 0x16b6: 0x83ad, 0x16b7: 0x83cd, 0x16b8: 0x83ed, 0x16b9: 0x840d, 0x16ba: 0x842d, 0x16bb: 0x844d, - 0x16bc: 0x81ed, 0x16bd: 0x846d, 0x16be: 0x848d, 0x16bf: 0x824d, + 0x1680: 0x0040, 0x1681: 0x0040, 0x1682: 0x874d, 0x1683: 0x872d, 0x1684: 0x892d, 0x1685: 0x872d, + 0x1686: 0x874d, 0x1687: 0x872d, 0x1688: 0x0040, 0x1689: 0x0040, 0x168a: 0x894d, 0x168b: 0x874d, + 0x168c: 0x896d, 0x168d: 0x892d, 0x168e: 0x896d, 0x168f: 0x874d, 0x1690: 0x0040, 0x1691: 0x0040, + 0x1692: 0x898d, 0x1693: 0x89ad, 0x1694: 0x88ad, 0x1695: 0x896d, 0x1696: 0x892d, 0x1697: 0x896d, + 0x1698: 0x0040, 0x1699: 0x0040, 0x169a: 0x89cd, 0x169b: 0x89ed, 0x169c: 0x89cd, 0x169d: 0x0040, + 0x169e: 0x0040, 0x169f: 0x0040, 0x16a0: 0x21e9, 0x16a1: 0x21f1, 0x16a2: 0x21f9, 0x16a3: 0x8a0e, + 0x16a4: 0x2201, 0x16a5: 0x2209, 0x16a6: 0x8a2d, 0x16a7: 0x0040, 0x16a8: 0x8a4d, 0x16a9: 0x8a6d, + 0x16aa: 0x8a8d, 0x16ab: 0x8a6d, 0x16ac: 0x8aad, 0x16ad: 0x8acd, 0x16ae: 0x8aed, 0x16af: 0x0040, + 0x16b0: 0x0040, 0x16b1: 0x0040, 0x16b2: 0x0040, 0x16b3: 0x0040, 0x16b4: 0x0040, 0x16b5: 0x0040, + 0x16b6: 0x0040, 0x16b7: 0x0040, 0x16b8: 0x0040, 0x16b9: 0x0340, 0x16ba: 0x0340, 0x16bb: 0x0340, + 0x16bc: 0x0040, 0x16bd: 0x0040, 0x16be: 0x0040, 0x16bf: 0x0040, // Block 0x5b, offset 0x16c0 - 0x16c0: 0x84ad, 0x16c1: 0x84cd, 0x16c2: 0x84ed, 0x16c3: 0x850d, 0x16c4: 0x852d, 0x16c5: 0x854d, - 0x16c6: 0x856d, 0x16c7: 0x858d, 0x16c8: 0x850d, 0x16c9: 0x85ad, 0x16ca: 0x850d, 0x16cb: 0x85cd, - 0x16cc: 0x85cd, 0x16cd: 0x85ed, 0x16ce: 0x85ed, 0x16cf: 0x860d, 0x16d0: 0x854d, 0x16d1: 0x862d, - 0x16d2: 0x864d, 0x16d3: 0x862d, 0x16d4: 0x866d, 0x16d5: 0x864d, 0x16d6: 0x868d, 0x16d7: 0x868d, - 0x16d8: 0x86ad, 0x16d9: 0x86ad, 0x16da: 0x86cd, 0x16db: 0x86cd, 0x16dc: 0x864d, 0x16dd: 0x814d, - 0x16de: 0x86ed, 0x16df: 0x870d, 0x16e0: 0x0040, 0x16e1: 0x872d, 0x16e2: 0x874d, 0x16e3: 0x876d, - 0x16e4: 0x878d, 0x16e5: 0x876d, 0x16e6: 0x87ad, 0x16e7: 0x87cd, 0x16e8: 0x87ed, 0x16e9: 0x87ed, - 0x16ea: 0x880d, 0x16eb: 0x880d, 0x16ec: 0x882d, 0x16ed: 0x882d, 0x16ee: 0x880d, 0x16ef: 0x880d, - 0x16f0: 0x884d, 0x16f1: 0x886d, 0x16f2: 0x888d, 0x16f3: 0x88ad, 0x16f4: 0x88cd, 0x16f5: 0x88ed, - 0x16f6: 0x88ed, 0x16f7: 0x88ed, 0x16f8: 0x890d, 0x16f9: 0x890d, 0x16fa: 0x890d, 0x16fb: 0x890d, - 0x16fc: 0x87ed, 0x16fd: 0x87ed, 0x16fe: 0x87ed, 0x16ff: 0x0040, + 0x16c0: 0x0a08, 0x16c1: 0x0a08, 0x16c2: 0x0a08, 0x16c3: 0x0a08, 0x16c4: 0x0a08, 0x16c5: 0x0c08, + 0x16c6: 0x0808, 0x16c7: 0x0c08, 0x16c8: 0x0818, 0x16c9: 0x0c08, 0x16ca: 0x0c08, 0x16cb: 0x0808, + 0x16cc: 0x0808, 0x16cd: 0x0908, 0x16ce: 0x0c08, 0x16cf: 0x0c08, 0x16d0: 0x0c08, 0x16d1: 0x0c08, + 0x16d2: 0x0c08, 0x16d3: 0x0a08, 0x16d4: 0x0a08, 0x16d5: 0x0a08, 0x16d6: 0x0a08, 0x16d7: 0x0908, + 0x16d8: 0x0a08, 0x16d9: 0x0a08, 0x16da: 0x0a08, 0x16db: 0x0a08, 0x16dc: 0x0a08, 0x16dd: 0x0c08, + 0x16de: 0x0a08, 0x16df: 0x0a08, 0x16e0: 0x0a08, 0x16e1: 0x0c08, 0x16e2: 0x0808, 0x16e3: 0x0808, + 0x16e4: 0x0c08, 0x16e5: 0x3308, 0x16e6: 0x3308, 0x16e7: 0x0040, 0x16e8: 0x0040, 0x16e9: 0x0040, + 0x16ea: 0x0040, 0x16eb: 0x0a18, 0x16ec: 0x0a18, 0x16ed: 0x0a18, 0x16ee: 0x0a18, 0x16ef: 0x0c18, + 0x16f0: 0x0818, 0x16f1: 0x0818, 0x16f2: 0x0818, 0x16f3: 0x0818, 0x16f4: 0x0818, 0x16f5: 0x0818, + 0x16f6: 0x0818, 0x16f7: 0x0040, 0x16f8: 0x0040, 0x16f9: 0x0040, 0x16fa: 0x0040, 0x16fb: 0x0040, + 0x16fc: 0x0040, 0x16fd: 0x0040, 0x16fe: 0x0040, 0x16ff: 0x0040, // Block 0x5c, offset 0x1700 - 0x1700: 0x0040, 0x1701: 0x0040, 0x1702: 0x874d, 0x1703: 0x872d, 0x1704: 0x892d, 0x1705: 0x872d, - 0x1706: 0x874d, 0x1707: 0x872d, 0x1708: 0x0040, 0x1709: 0x0040, 0x170a: 0x894d, 0x170b: 0x874d, - 0x170c: 0x896d, 0x170d: 0x892d, 0x170e: 0x896d, 0x170f: 0x874d, 0x1710: 0x0040, 0x1711: 0x0040, - 0x1712: 0x898d, 0x1713: 0x89ad, 0x1714: 0x88ad, 0x1715: 0x896d, 0x1716: 0x892d, 0x1717: 0x896d, - 0x1718: 0x0040, 0x1719: 0x0040, 0x171a: 0x89cd, 0x171b: 0x89ed, 0x171c: 0x89cd, 0x171d: 0x0040, - 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0xb591, 0x1721: 0xb5a9, 0x1722: 0xb5c1, 0x1723: 0x8a0e, - 0x1724: 0xb5d9, 0x1725: 0xb5f1, 0x1726: 0x8a2d, 0x1727: 0x0040, 0x1728: 0x8a4d, 0x1729: 0x8a6d, - 0x172a: 0x8a8d, 0x172b: 0x8a6d, 0x172c: 0x8aad, 0x172d: 0x8acd, 0x172e: 0x8aed, 0x172f: 0x0040, + 0x1700: 0x0a08, 0x1701: 0x0c08, 0x1702: 0x0a08, 0x1703: 0x0c08, 0x1704: 0x0c08, 0x1705: 0x0c08, + 0x1706: 0x0a08, 0x1707: 0x0a08, 0x1708: 0x0a08, 0x1709: 0x0c08, 0x170a: 0x0a08, 0x170b: 0x0a08, + 0x170c: 0x0c08, 0x170d: 0x0a08, 0x170e: 0x0c08, 0x170f: 0x0c08, 0x1710: 0x0a08, 0x1711: 0x0c08, + 0x1712: 0x0040, 0x1713: 0x0040, 0x1714: 0x0040, 0x1715: 0x0040, 0x1716: 0x0040, 0x1717: 0x0040, + 0x1718: 0x0040, 0x1719: 0x0818, 0x171a: 0x0818, 0x171b: 0x0818, 0x171c: 0x0818, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x0040, 0x1721: 0x0040, 0x1722: 0x0040, 0x1723: 0x0040, + 0x1724: 0x0040, 0x1725: 0x0040, 0x1726: 0x0040, 0x1727: 0x0040, 0x1728: 0x0040, 0x1729: 0x0c18, + 0x172a: 0x0c18, 0x172b: 0x0c18, 0x172c: 0x0c18, 0x172d: 0x0a18, 0x172e: 0x0a18, 0x172f: 0x0818, 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, - 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0340, 0x173a: 0x0340, 0x173b: 0x0340, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0040, 0x173a: 0x0040, 0x173b: 0x0040, 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, // Block 0x5d, offset 0x1740 - 0x1740: 0x0a08, 0x1741: 0x0a08, 0x1742: 0x0a08, 0x1743: 0x0a08, 0x1744: 0x0a08, 0x1745: 0x0c08, - 0x1746: 0x0808, 0x1747: 0x0c08, 0x1748: 0x0818, 0x1749: 0x0c08, 0x174a: 0x0c08, 0x174b: 0x0808, - 0x174c: 0x0808, 0x174d: 0x0908, 0x174e: 0x0c08, 0x174f: 0x0c08, 0x1750: 0x0c08, 0x1751: 0x0c08, - 0x1752: 0x0c08, 0x1753: 0x0a08, 0x1754: 0x0a08, 0x1755: 0x0a08, 0x1756: 0x0a08, 0x1757: 0x0908, - 0x1758: 0x0a08, 0x1759: 0x0a08, 0x175a: 0x0a08, 0x175b: 0x0a08, 0x175c: 0x0a08, 0x175d: 0x0c08, - 0x175e: 0x0a08, 0x175f: 0x0a08, 0x1760: 0x0a08, 0x1761: 0x0c08, 0x1762: 0x0808, 0x1763: 0x0808, - 0x1764: 0x0c08, 0x1765: 0x3308, 0x1766: 0x3308, 0x1767: 0x0040, 0x1768: 0x0040, 0x1769: 0x0040, - 0x176a: 0x0040, 0x176b: 0x0a18, 0x176c: 0x0a18, 0x176d: 0x0a18, 0x176e: 0x0a18, 0x176f: 0x0c18, - 0x1770: 0x0818, 0x1771: 0x0818, 0x1772: 0x0818, 0x1773: 0x0818, 0x1774: 0x0818, 0x1775: 0x0818, - 0x1776: 0x0818, 0x1777: 0x0040, 0x1778: 0x0040, 0x1779: 0x0040, 0x177a: 0x0040, 0x177b: 0x0040, - 0x177c: 0x0040, 0x177d: 0x0040, 0x177e: 0x0040, 0x177f: 0x0040, + 0x1740: 0x3308, 0x1741: 0x3308, 0x1742: 0x3008, 0x1743: 0x3008, 0x1744: 0x0040, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0040, 0x174e: 0x0040, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0040, + 0x1752: 0x0040, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0008, 0x1765: 0x0008, 0x1766: 0x0008, 0x1767: 0x0008, 0x1768: 0x0008, 0x1769: 0x0040, + 0x176a: 0x0008, 0x176b: 0x0008, 0x176c: 0x0008, 0x176d: 0x0008, 0x176e: 0x0008, 0x176f: 0x0008, + 0x1770: 0x0008, 0x1771: 0x0040, 0x1772: 0x0008, 0x1773: 0x0008, 0x1774: 0x0040, 0x1775: 0x0008, + 0x1776: 0x0008, 0x1777: 0x0008, 0x1778: 0x0008, 0x1779: 0x0008, 0x177a: 0x0040, 0x177b: 0x3308, + 0x177c: 0x3308, 0x177d: 0x0008, 0x177e: 0x3008, 0x177f: 0x3008, // Block 0x5e, offset 0x1780 - 0x1780: 0x0a08, 0x1781: 0x0c08, 0x1782: 0x0a08, 0x1783: 0x0c08, 0x1784: 0x0c08, 0x1785: 0x0c08, - 0x1786: 0x0a08, 0x1787: 0x0a08, 0x1788: 0x0a08, 0x1789: 0x0c08, 0x178a: 0x0a08, 0x178b: 0x0a08, - 0x178c: 0x0c08, 0x178d: 0x0a08, 0x178e: 0x0c08, 0x178f: 0x0c08, 0x1790: 0x0a08, 0x1791: 0x0c08, - 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x0040, - 0x1798: 0x0040, 0x1799: 0x0818, 0x179a: 0x0818, 0x179b: 0x0818, 0x179c: 0x0818, 0x179d: 0x0040, - 0x179e: 0x0040, 0x179f: 0x0040, 0x17a0: 0x0040, 0x17a1: 0x0040, 0x17a2: 0x0040, 0x17a3: 0x0040, - 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x0040, 0x17a7: 0x0040, 0x17a8: 0x0040, 0x17a9: 0x0c18, - 0x17aa: 0x0c18, 0x17ab: 0x0c18, 0x17ac: 0x0c18, 0x17ad: 0x0a18, 0x17ae: 0x0a18, 0x17af: 0x0818, - 0x17b0: 0x0040, 0x17b1: 0x0040, 0x17b2: 0x0040, 0x17b3: 0x0040, 0x17b4: 0x0040, 0x17b5: 0x0040, + 0x1780: 0x3308, 0x1781: 0x3008, 0x1782: 0x3008, 0x1783: 0x3008, 0x1784: 0x3008, 0x1785: 0x0040, + 0x1786: 0x0040, 0x1787: 0x3008, 0x1788: 0x3008, 0x1789: 0x0040, 0x178a: 0x0040, 0x178b: 0x3008, + 0x178c: 0x3008, 0x178d: 0x3808, 0x178e: 0x0040, 0x178f: 0x0040, 0x1790: 0x0008, 0x1791: 0x0040, + 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x3008, + 0x1798: 0x0040, 0x1799: 0x0040, 0x179a: 0x0040, 0x179b: 0x0040, 0x179c: 0x0040, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x3008, 0x17a3: 0x3008, + 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x3308, 0x17a7: 0x3308, 0x17a8: 0x3308, 0x17a9: 0x3308, + 0x17aa: 0x3308, 0x17ab: 0x3308, 0x17ac: 0x3308, 0x17ad: 0x0040, 0x17ae: 0x0040, 0x17af: 0x0040, + 0x17b0: 0x3308, 0x17b1: 0x3308, 0x17b2: 0x3308, 0x17b3: 0x3308, 0x17b4: 0x3308, 0x17b5: 0x0040, 0x17b6: 0x0040, 0x17b7: 0x0040, 0x17b8: 0x0040, 0x17b9: 0x0040, 0x17ba: 0x0040, 0x17bb: 0x0040, 0x17bc: 0x0040, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, // Block 0x5f, offset 0x17c0 - 0x17c0: 0x3308, 0x17c1: 0x3308, 0x17c2: 0x3008, 0x17c3: 0x3008, 0x17c4: 0x0040, 0x17c5: 0x0008, - 0x17c6: 0x0008, 0x17c7: 0x0008, 0x17c8: 0x0008, 0x17c9: 0x0008, 0x17ca: 0x0008, 0x17cb: 0x0008, - 0x17cc: 0x0008, 0x17cd: 0x0040, 0x17ce: 0x0040, 0x17cf: 0x0008, 0x17d0: 0x0008, 0x17d1: 0x0040, - 0x17d2: 0x0040, 0x17d3: 0x0008, 0x17d4: 0x0008, 0x17d5: 0x0008, 0x17d6: 0x0008, 0x17d7: 0x0008, + 0x17c0: 0x0008, 0x17c1: 0x0008, 0x17c2: 0x0008, 0x17c3: 0x0008, 0x17c4: 0x0008, 0x17c5: 0x0008, + 0x17c6: 0x0008, 0x17c7: 0x0040, 0x17c8: 0x0040, 0x17c9: 0x0008, 0x17ca: 0x0040, 0x17cb: 0x0040, + 0x17cc: 0x0008, 0x17cd: 0x0008, 0x17ce: 0x0008, 0x17cf: 0x0008, 0x17d0: 0x0008, 0x17d1: 0x0008, + 0x17d2: 0x0008, 0x17d3: 0x0008, 0x17d4: 0x0040, 0x17d5: 0x0008, 0x17d6: 0x0008, 0x17d7: 0x0040, 0x17d8: 0x0008, 0x17d9: 0x0008, 0x17da: 0x0008, 0x17db: 0x0008, 0x17dc: 0x0008, 0x17dd: 0x0008, 0x17de: 0x0008, 0x17df: 0x0008, 0x17e0: 0x0008, 0x17e1: 0x0008, 0x17e2: 0x0008, 0x17e3: 0x0008, - 0x17e4: 0x0008, 0x17e5: 0x0008, 0x17e6: 0x0008, 0x17e7: 0x0008, 0x17e8: 0x0008, 0x17e9: 0x0040, + 0x17e4: 0x0008, 0x17e5: 0x0008, 0x17e6: 0x0008, 0x17e7: 0x0008, 0x17e8: 0x0008, 0x17e9: 0x0008, 0x17ea: 0x0008, 0x17eb: 0x0008, 0x17ec: 0x0008, 0x17ed: 0x0008, 0x17ee: 0x0008, 0x17ef: 0x0008, - 0x17f0: 0x0008, 0x17f1: 0x0040, 0x17f2: 0x0008, 0x17f3: 0x0008, 0x17f4: 0x0040, 0x17f5: 0x0008, - 0x17f6: 0x0008, 0x17f7: 0x0008, 0x17f8: 0x0008, 0x17f9: 0x0008, 0x17fa: 0x0040, 0x17fb: 0x3308, - 0x17fc: 0x3308, 0x17fd: 0x0008, 0x17fe: 0x3008, 0x17ff: 0x3008, + 0x17f0: 0x3008, 0x17f1: 0x3008, 0x17f2: 0x3008, 0x17f3: 0x3008, 0x17f4: 0x3008, 0x17f5: 0x3008, + 0x17f6: 0x0040, 0x17f7: 0x3008, 0x17f8: 0x3008, 0x17f9: 0x0040, 0x17fa: 0x0040, 0x17fb: 0x3308, + 0x17fc: 0x3308, 0x17fd: 0x3808, 0x17fe: 0x3b08, 0x17ff: 0x0008, // Block 0x60, offset 0x1800 - 0x1800: 0x3308, 0x1801: 0x3008, 0x1802: 0x3008, 0x1803: 0x3008, 0x1804: 0x3008, 0x1805: 0x0040, - 0x1806: 0x0040, 0x1807: 0x3008, 0x1808: 0x3008, 0x1809: 0x0040, 0x180a: 0x0040, 0x180b: 0x3008, - 0x180c: 0x3008, 0x180d: 0x3808, 0x180e: 0x0040, 0x180f: 0x0040, 0x1810: 0x0008, 0x1811: 0x0040, - 0x1812: 0x0040, 0x1813: 0x0040, 0x1814: 0x0040, 0x1815: 0x0040, 0x1816: 0x0040, 0x1817: 0x3008, - 0x1818: 0x0040, 0x1819: 0x0040, 0x181a: 0x0040, 0x181b: 0x0040, 0x181c: 0x0040, 0x181d: 0x0008, - 0x181e: 0x0008, 0x181f: 0x0008, 0x1820: 0x0008, 0x1821: 0x0008, 0x1822: 0x3008, 0x1823: 0x3008, - 0x1824: 0x0040, 0x1825: 0x0040, 0x1826: 0x3308, 0x1827: 0x3308, 0x1828: 0x3308, 0x1829: 0x3308, - 0x182a: 0x3308, 0x182b: 0x3308, 0x182c: 0x3308, 0x182d: 0x0040, 0x182e: 0x0040, 0x182f: 0x0040, - 0x1830: 0x3308, 0x1831: 0x3308, 0x1832: 0x3308, 0x1833: 0x3308, 0x1834: 0x3308, 0x1835: 0x0040, - 0x1836: 0x0040, 0x1837: 0x0040, 0x1838: 0x0040, 0x1839: 0x0040, 0x183a: 0x0040, 0x183b: 0x0040, - 0x183c: 0x0040, 0x183d: 0x0040, 0x183e: 0x0040, 0x183f: 0x0040, + 0x1800: 0x0019, 0x1801: 0x02e9, 0x1802: 0x03d9, 0x1803: 0x02f1, 0x1804: 0x02f9, 0x1805: 0x03f1, + 0x1806: 0x0309, 0x1807: 0x00a9, 0x1808: 0x0311, 0x1809: 0x00b1, 0x180a: 0x0319, 0x180b: 0x0101, + 0x180c: 0x0321, 0x180d: 0x0329, 0x180e: 0x0051, 0x180f: 0x0339, 0x1810: 0x0751, 0x1811: 0x00b9, + 0x1812: 0x0089, 0x1813: 0x0341, 0x1814: 0x0349, 0x1815: 0x0391, 0x1816: 0x00c1, 0x1817: 0x0109, + 0x1818: 0x00c9, 0x1819: 0x04b1, 0x181a: 0x0019, 0x181b: 0x02e9, 0x181c: 0x03d9, 0x181d: 0x02f1, + 0x181e: 0x02f9, 0x181f: 0x03f1, 0x1820: 0x0309, 0x1821: 0x00a9, 0x1822: 0x0311, 0x1823: 0x00b1, + 0x1824: 0x0319, 0x1825: 0x0101, 0x1826: 0x0321, 0x1827: 0x0329, 0x1828: 0x0051, 0x1829: 0x0339, + 0x182a: 0x0751, 0x182b: 0x00b9, 0x182c: 0x0089, 0x182d: 0x0341, 0x182e: 0x0349, 0x182f: 0x0391, + 0x1830: 0x00c1, 0x1831: 0x0109, 0x1832: 0x00c9, 0x1833: 0x04b1, 0x1834: 0x0019, 0x1835: 0x02e9, + 0x1836: 0x03d9, 0x1837: 0x02f1, 0x1838: 0x02f9, 0x1839: 0x03f1, 0x183a: 0x0309, 0x183b: 0x00a9, + 0x183c: 0x0311, 0x183d: 0x00b1, 0x183e: 0x0319, 0x183f: 0x0101, // Block 0x61, offset 0x1840 - 0x1840: 0x0008, 0x1841: 0x0008, 0x1842: 0x0008, 0x1843: 0x0008, 0x1844: 0x0008, 0x1845: 0x0008, - 0x1846: 0x0008, 0x1847: 0x0040, 0x1848: 0x0040, 0x1849: 0x0008, 0x184a: 0x0040, 0x184b: 0x0040, - 0x184c: 0x0008, 0x184d: 0x0008, 0x184e: 0x0008, 0x184f: 0x0008, 0x1850: 0x0008, 0x1851: 0x0008, - 0x1852: 0x0008, 0x1853: 0x0008, 0x1854: 0x0040, 0x1855: 0x0008, 0x1856: 0x0008, 0x1857: 0x0040, - 0x1858: 0x0008, 0x1859: 0x0008, 0x185a: 0x0008, 0x185b: 0x0008, 0x185c: 0x0008, 0x185d: 0x0008, - 0x185e: 0x0008, 0x185f: 0x0008, 0x1860: 0x0008, 0x1861: 0x0008, 0x1862: 0x0008, 0x1863: 0x0008, - 0x1864: 0x0008, 0x1865: 0x0008, 0x1866: 0x0008, 0x1867: 0x0008, 0x1868: 0x0008, 0x1869: 0x0008, - 0x186a: 0x0008, 0x186b: 0x0008, 0x186c: 0x0008, 0x186d: 0x0008, 0x186e: 0x0008, 0x186f: 0x0008, - 0x1870: 0x3008, 0x1871: 0x3008, 0x1872: 0x3008, 0x1873: 0x3008, 0x1874: 0x3008, 0x1875: 0x3008, - 0x1876: 0x0040, 0x1877: 0x3008, 0x1878: 0x3008, 0x1879: 0x0040, 0x187a: 0x0040, 0x187b: 0x3308, - 0x187c: 0x3308, 0x187d: 0x3808, 0x187e: 0x3b08, 0x187f: 0x0008, + 0x1840: 0x0321, 0x1841: 0x0329, 0x1842: 0x0051, 0x1843: 0x0339, 0x1844: 0x0751, 0x1845: 0x00b9, + 0x1846: 0x0089, 0x1847: 0x0341, 0x1848: 0x0349, 0x1849: 0x0391, 0x184a: 0x00c1, 0x184b: 0x0109, + 0x184c: 0x00c9, 0x184d: 0x04b1, 0x184e: 0x0019, 0x184f: 0x02e9, 0x1850: 0x03d9, 0x1851: 0x02f1, + 0x1852: 0x02f9, 0x1853: 0x03f1, 0x1854: 0x0309, 0x1855: 0x0040, 0x1856: 0x0311, 0x1857: 0x00b1, + 0x1858: 0x0319, 0x1859: 0x0101, 0x185a: 0x0321, 0x185b: 0x0329, 0x185c: 0x0051, 0x185d: 0x0339, + 0x185e: 0x0751, 0x185f: 0x00b9, 0x1860: 0x0089, 0x1861: 0x0341, 0x1862: 0x0349, 0x1863: 0x0391, + 0x1864: 0x00c1, 0x1865: 0x0109, 0x1866: 0x00c9, 0x1867: 0x04b1, 0x1868: 0x0019, 0x1869: 0x02e9, + 0x186a: 0x03d9, 0x186b: 0x02f1, 0x186c: 0x02f9, 0x186d: 0x03f1, 0x186e: 0x0309, 0x186f: 0x00a9, + 0x1870: 0x0311, 0x1871: 0x00b1, 0x1872: 0x0319, 0x1873: 0x0101, 0x1874: 0x0321, 0x1875: 0x0329, + 0x1876: 0x0051, 0x1877: 0x0339, 0x1878: 0x0751, 0x1879: 0x00b9, 0x187a: 0x0089, 0x187b: 0x0341, + 0x187c: 0x0349, 0x187d: 0x0391, 0x187e: 0x00c1, 0x187f: 0x0109, // Block 0x62, offset 0x1880 - 0x1880: 0x0039, 0x1881: 0x0ee9, 0x1882: 0x1159, 0x1883: 0x0ef9, 0x1884: 0x0f09, 0x1885: 0x1199, - 0x1886: 0x0f31, 0x1887: 0x0249, 0x1888: 0x0f41, 0x1889: 0x0259, 0x188a: 0x0f51, 0x188b: 0x0359, - 0x188c: 0x0f61, 0x188d: 0x0f71, 0x188e: 0x00d9, 0x188f: 0x0f99, 0x1890: 0x2039, 0x1891: 0x0269, - 0x1892: 0x01d9, 0x1893: 0x0fa9, 0x1894: 0x0fb9, 0x1895: 0x1089, 0x1896: 0x0279, 0x1897: 0x0369, - 0x1898: 0x0289, 0x1899: 0x13d1, 0x189a: 0x0039, 0x189b: 0x0ee9, 0x189c: 0x1159, 0x189d: 0x0ef9, - 0x189e: 0x0f09, 0x189f: 0x1199, 0x18a0: 0x0f31, 0x18a1: 0x0249, 0x18a2: 0x0f41, 0x18a3: 0x0259, - 0x18a4: 0x0f51, 0x18a5: 0x0359, 0x18a6: 0x0f61, 0x18a7: 0x0f71, 0x18a8: 0x00d9, 0x18a9: 0x0f99, - 0x18aa: 0x2039, 0x18ab: 0x0269, 0x18ac: 0x01d9, 0x18ad: 0x0fa9, 0x18ae: 0x0fb9, 0x18af: 0x1089, - 0x18b0: 0x0279, 0x18b1: 0x0369, 0x18b2: 0x0289, 0x18b3: 0x13d1, 0x18b4: 0x0039, 0x18b5: 0x0ee9, - 0x18b6: 0x1159, 0x18b7: 0x0ef9, 0x18b8: 0x0f09, 0x18b9: 0x1199, 0x18ba: 0x0f31, 0x18bb: 0x0249, - 0x18bc: 0x0f41, 0x18bd: 0x0259, 0x18be: 0x0f51, 0x18bf: 0x0359, + 0x1880: 0x00c9, 0x1881: 0x04b1, 0x1882: 0x0019, 0x1883: 0x02e9, 0x1884: 0x03d9, 0x1885: 0x02f1, + 0x1886: 0x02f9, 0x1887: 0x03f1, 0x1888: 0x0309, 0x1889: 0x00a9, 0x188a: 0x0311, 0x188b: 0x00b1, + 0x188c: 0x0319, 0x188d: 0x0101, 0x188e: 0x0321, 0x188f: 0x0329, 0x1890: 0x0051, 0x1891: 0x0339, + 0x1892: 0x0751, 0x1893: 0x00b9, 0x1894: 0x0089, 0x1895: 0x0341, 0x1896: 0x0349, 0x1897: 0x0391, + 0x1898: 0x00c1, 0x1899: 0x0109, 0x189a: 0x00c9, 0x189b: 0x04b1, 0x189c: 0x0019, 0x189d: 0x0040, + 0x189e: 0x03d9, 0x189f: 0x02f1, 0x18a0: 0x0040, 0x18a1: 0x0040, 0x18a2: 0x0309, 0x18a3: 0x0040, + 0x18a4: 0x0040, 0x18a5: 0x00b1, 0x18a6: 0x0319, 0x18a7: 0x0040, 0x18a8: 0x0040, 0x18a9: 0x0329, + 0x18aa: 0x0051, 0x18ab: 0x0339, 0x18ac: 0x0751, 0x18ad: 0x0040, 0x18ae: 0x0089, 0x18af: 0x0341, + 0x18b0: 0x0349, 0x18b1: 0x0391, 0x18b2: 0x00c1, 0x18b3: 0x0109, 0x18b4: 0x00c9, 0x18b5: 0x04b1, + 0x18b6: 0x0019, 0x18b7: 0x02e9, 0x18b8: 0x03d9, 0x18b9: 0x02f1, 0x18ba: 0x0040, 0x18bb: 0x03f1, + 0x18bc: 0x0040, 0x18bd: 0x00a9, 0x18be: 0x0311, 0x18bf: 0x00b1, // Block 0x63, offset 0x18c0 - 0x18c0: 0x0f61, 0x18c1: 0x0f71, 0x18c2: 0x00d9, 0x18c3: 0x0f99, 0x18c4: 0x2039, 0x18c5: 0x0269, - 0x18c6: 0x01d9, 0x18c7: 0x0fa9, 0x18c8: 0x0fb9, 0x18c9: 0x1089, 0x18ca: 0x0279, 0x18cb: 0x0369, - 0x18cc: 0x0289, 0x18cd: 0x13d1, 0x18ce: 0x0039, 0x18cf: 0x0ee9, 0x18d0: 0x1159, 0x18d1: 0x0ef9, - 0x18d2: 0x0f09, 0x18d3: 0x1199, 0x18d4: 0x0f31, 0x18d5: 0x0040, 0x18d6: 0x0f41, 0x18d7: 0x0259, - 0x18d8: 0x0f51, 0x18d9: 0x0359, 0x18da: 0x0f61, 0x18db: 0x0f71, 0x18dc: 0x00d9, 0x18dd: 0x0f99, - 0x18de: 0x2039, 0x18df: 0x0269, 0x18e0: 0x01d9, 0x18e1: 0x0fa9, 0x18e2: 0x0fb9, 0x18e3: 0x1089, - 0x18e4: 0x0279, 0x18e5: 0x0369, 0x18e6: 0x0289, 0x18e7: 0x13d1, 0x18e8: 0x0039, 0x18e9: 0x0ee9, - 0x18ea: 0x1159, 0x18eb: 0x0ef9, 0x18ec: 0x0f09, 0x18ed: 0x1199, 0x18ee: 0x0f31, 0x18ef: 0x0249, - 0x18f0: 0x0f41, 0x18f1: 0x0259, 0x18f2: 0x0f51, 0x18f3: 0x0359, 0x18f4: 0x0f61, 0x18f5: 0x0f71, - 0x18f6: 0x00d9, 0x18f7: 0x0f99, 0x18f8: 0x2039, 0x18f9: 0x0269, 0x18fa: 0x01d9, 0x18fb: 0x0fa9, - 0x18fc: 0x0fb9, 0x18fd: 0x1089, 0x18fe: 0x0279, 0x18ff: 0x0369, + 0x18c0: 0x0319, 0x18c1: 0x0101, 0x18c2: 0x0321, 0x18c3: 0x0329, 0x18c4: 0x0040, 0x18c5: 0x0339, + 0x18c6: 0x0751, 0x18c7: 0x00b9, 0x18c8: 0x0089, 0x18c9: 0x0341, 0x18ca: 0x0349, 0x18cb: 0x0391, + 0x18cc: 0x00c1, 0x18cd: 0x0109, 0x18ce: 0x00c9, 0x18cf: 0x04b1, 0x18d0: 0x0019, 0x18d1: 0x02e9, + 0x18d2: 0x03d9, 0x18d3: 0x02f1, 0x18d4: 0x02f9, 0x18d5: 0x03f1, 0x18d6: 0x0309, 0x18d7: 0x00a9, + 0x18d8: 0x0311, 0x18d9: 0x00b1, 0x18da: 0x0319, 0x18db: 0x0101, 0x18dc: 0x0321, 0x18dd: 0x0329, + 0x18de: 0x0051, 0x18df: 0x0339, 0x18e0: 0x0751, 0x18e1: 0x00b9, 0x18e2: 0x0089, 0x18e3: 0x0341, + 0x18e4: 0x0349, 0x18e5: 0x0391, 0x18e6: 0x00c1, 0x18e7: 0x0109, 0x18e8: 0x00c9, 0x18e9: 0x04b1, + 0x18ea: 0x0019, 0x18eb: 0x02e9, 0x18ec: 0x03d9, 0x18ed: 0x02f1, 0x18ee: 0x02f9, 0x18ef: 0x03f1, + 0x18f0: 0x0309, 0x18f1: 0x00a9, 0x18f2: 0x0311, 0x18f3: 0x00b1, 0x18f4: 0x0319, 0x18f5: 0x0101, + 0x18f6: 0x0321, 0x18f7: 0x0329, 0x18f8: 0x0051, 0x18f9: 0x0339, 0x18fa: 0x0751, 0x18fb: 0x00b9, + 0x18fc: 0x0089, 0x18fd: 0x0341, 0x18fe: 0x0349, 0x18ff: 0x0391, // Block 0x64, offset 0x1900 - 0x1900: 0x0289, 0x1901: 0x13d1, 0x1902: 0x0039, 0x1903: 0x0ee9, 0x1904: 0x1159, 0x1905: 0x0ef9, - 0x1906: 0x0f09, 0x1907: 0x1199, 0x1908: 0x0f31, 0x1909: 0x0249, 0x190a: 0x0f41, 0x190b: 0x0259, - 0x190c: 0x0f51, 0x190d: 0x0359, 0x190e: 0x0f61, 0x190f: 0x0f71, 0x1910: 0x00d9, 0x1911: 0x0f99, - 0x1912: 0x2039, 0x1913: 0x0269, 0x1914: 0x01d9, 0x1915: 0x0fa9, 0x1916: 0x0fb9, 0x1917: 0x1089, - 0x1918: 0x0279, 0x1919: 0x0369, 0x191a: 0x0289, 0x191b: 0x13d1, 0x191c: 0x0039, 0x191d: 0x0040, - 0x191e: 0x1159, 0x191f: 0x0ef9, 0x1920: 0x0040, 0x1921: 0x0040, 0x1922: 0x0f31, 0x1923: 0x0040, - 0x1924: 0x0040, 0x1925: 0x0259, 0x1926: 0x0f51, 0x1927: 0x0040, 0x1928: 0x0040, 0x1929: 0x0f71, - 0x192a: 0x00d9, 0x192b: 0x0f99, 0x192c: 0x2039, 0x192d: 0x0040, 0x192e: 0x01d9, 0x192f: 0x0fa9, - 0x1930: 0x0fb9, 0x1931: 0x1089, 0x1932: 0x0279, 0x1933: 0x0369, 0x1934: 0x0289, 0x1935: 0x13d1, - 0x1936: 0x0039, 0x1937: 0x0ee9, 0x1938: 0x1159, 0x1939: 0x0ef9, 0x193a: 0x0040, 0x193b: 0x1199, - 0x193c: 0x0040, 0x193d: 0x0249, 0x193e: 0x0f41, 0x193f: 0x0259, + 0x1900: 0x00c1, 0x1901: 0x0109, 0x1902: 0x00c9, 0x1903: 0x04b1, 0x1904: 0x0019, 0x1905: 0x02e9, + 0x1906: 0x0040, 0x1907: 0x02f1, 0x1908: 0x02f9, 0x1909: 0x03f1, 0x190a: 0x0309, 0x190b: 0x0040, + 0x190c: 0x0040, 0x190d: 0x00b1, 0x190e: 0x0319, 0x190f: 0x0101, 0x1910: 0x0321, 0x1911: 0x0329, + 0x1912: 0x0051, 0x1913: 0x0339, 0x1914: 0x0751, 0x1915: 0x0040, 0x1916: 0x0089, 0x1917: 0x0341, + 0x1918: 0x0349, 0x1919: 0x0391, 0x191a: 0x00c1, 0x191b: 0x0109, 0x191c: 0x00c9, 0x191d: 0x0040, + 0x191e: 0x0019, 0x191f: 0x02e9, 0x1920: 0x03d9, 0x1921: 0x02f1, 0x1922: 0x02f9, 0x1923: 0x03f1, + 0x1924: 0x0309, 0x1925: 0x00a9, 0x1926: 0x0311, 0x1927: 0x00b1, 0x1928: 0x0319, 0x1929: 0x0101, + 0x192a: 0x0321, 0x192b: 0x0329, 0x192c: 0x0051, 0x192d: 0x0339, 0x192e: 0x0751, 0x192f: 0x00b9, + 0x1930: 0x0089, 0x1931: 0x0341, 0x1932: 0x0349, 0x1933: 0x0391, 0x1934: 0x00c1, 0x1935: 0x0109, + 0x1936: 0x00c9, 0x1937: 0x04b1, 0x1938: 0x0019, 0x1939: 0x02e9, 0x193a: 0x0040, 0x193b: 0x02f1, + 0x193c: 0x02f9, 0x193d: 0x03f1, 0x193e: 0x0309, 0x193f: 0x0040, // Block 0x65, offset 0x1940 - 0x1940: 0x0f51, 0x1941: 0x0359, 0x1942: 0x0f61, 0x1943: 0x0f71, 0x1944: 0x0040, 0x1945: 0x0f99, - 0x1946: 0x2039, 0x1947: 0x0269, 0x1948: 0x01d9, 0x1949: 0x0fa9, 0x194a: 0x0fb9, 0x194b: 0x1089, - 0x194c: 0x0279, 0x194d: 0x0369, 0x194e: 0x0289, 0x194f: 0x13d1, 0x1950: 0x0039, 0x1951: 0x0ee9, - 0x1952: 0x1159, 0x1953: 0x0ef9, 0x1954: 0x0f09, 0x1955: 0x1199, 0x1956: 0x0f31, 0x1957: 0x0249, - 0x1958: 0x0f41, 0x1959: 0x0259, 0x195a: 0x0f51, 0x195b: 0x0359, 0x195c: 0x0f61, 0x195d: 0x0f71, - 0x195e: 0x00d9, 0x195f: 0x0f99, 0x1960: 0x2039, 0x1961: 0x0269, 0x1962: 0x01d9, 0x1963: 0x0fa9, - 0x1964: 0x0fb9, 0x1965: 0x1089, 0x1966: 0x0279, 0x1967: 0x0369, 0x1968: 0x0289, 0x1969: 0x13d1, - 0x196a: 0x0039, 0x196b: 0x0ee9, 0x196c: 0x1159, 0x196d: 0x0ef9, 0x196e: 0x0f09, 0x196f: 0x1199, - 0x1970: 0x0f31, 0x1971: 0x0249, 0x1972: 0x0f41, 0x1973: 0x0259, 0x1974: 0x0f51, 0x1975: 0x0359, - 0x1976: 0x0f61, 0x1977: 0x0f71, 0x1978: 0x00d9, 0x1979: 0x0f99, 0x197a: 0x2039, 0x197b: 0x0269, - 0x197c: 0x01d9, 0x197d: 0x0fa9, 0x197e: 0x0fb9, 0x197f: 0x1089, + 0x1940: 0x0311, 0x1941: 0x00b1, 0x1942: 0x0319, 0x1943: 0x0101, 0x1944: 0x0321, 0x1945: 0x0040, + 0x1946: 0x0051, 0x1947: 0x0040, 0x1948: 0x0040, 0x1949: 0x0040, 0x194a: 0x0089, 0x194b: 0x0341, + 0x194c: 0x0349, 0x194d: 0x0391, 0x194e: 0x00c1, 0x194f: 0x0109, 0x1950: 0x00c9, 0x1951: 0x0040, + 0x1952: 0x0019, 0x1953: 0x02e9, 0x1954: 0x03d9, 0x1955: 0x02f1, 0x1956: 0x02f9, 0x1957: 0x03f1, + 0x1958: 0x0309, 0x1959: 0x00a9, 0x195a: 0x0311, 0x195b: 0x00b1, 0x195c: 0x0319, 0x195d: 0x0101, + 0x195e: 0x0321, 0x195f: 0x0329, 0x1960: 0x0051, 0x1961: 0x0339, 0x1962: 0x0751, 0x1963: 0x00b9, + 0x1964: 0x0089, 0x1965: 0x0341, 0x1966: 0x0349, 0x1967: 0x0391, 0x1968: 0x00c1, 0x1969: 0x0109, + 0x196a: 0x00c9, 0x196b: 0x04b1, 0x196c: 0x0019, 0x196d: 0x02e9, 0x196e: 0x03d9, 0x196f: 0x02f1, + 0x1970: 0x02f9, 0x1971: 0x03f1, 0x1972: 0x0309, 0x1973: 0x00a9, 0x1974: 0x0311, 0x1975: 0x00b1, + 0x1976: 0x0319, 0x1977: 0x0101, 0x1978: 0x0321, 0x1979: 0x0329, 0x197a: 0x0051, 0x197b: 0x0339, + 0x197c: 0x0751, 0x197d: 0x00b9, 0x197e: 0x0089, 0x197f: 0x0341, // Block 0x66, offset 0x1980 - 0x1980: 0x0279, 0x1981: 0x0369, 0x1982: 0x0289, 0x1983: 0x13d1, 0x1984: 0x0039, 0x1985: 0x0ee9, - 0x1986: 0x0040, 0x1987: 0x0ef9, 0x1988: 0x0f09, 0x1989: 0x1199, 0x198a: 0x0f31, 0x198b: 0x0040, - 0x198c: 0x0040, 0x198d: 0x0259, 0x198e: 0x0f51, 0x198f: 0x0359, 0x1990: 0x0f61, 0x1991: 0x0f71, - 0x1992: 0x00d9, 0x1993: 0x0f99, 0x1994: 0x2039, 0x1995: 0x0040, 0x1996: 0x01d9, 0x1997: 0x0fa9, - 0x1998: 0x0fb9, 0x1999: 0x1089, 0x199a: 0x0279, 0x199b: 0x0369, 0x199c: 0x0289, 0x199d: 0x0040, - 0x199e: 0x0039, 0x199f: 0x0ee9, 0x19a0: 0x1159, 0x19a1: 0x0ef9, 0x19a2: 0x0f09, 0x19a3: 0x1199, - 0x19a4: 0x0f31, 0x19a5: 0x0249, 0x19a6: 0x0f41, 0x19a7: 0x0259, 0x19a8: 0x0f51, 0x19a9: 0x0359, - 0x19aa: 0x0f61, 0x19ab: 0x0f71, 0x19ac: 0x00d9, 0x19ad: 0x0f99, 0x19ae: 0x2039, 0x19af: 0x0269, - 0x19b0: 0x01d9, 0x19b1: 0x0fa9, 0x19b2: 0x0fb9, 0x19b3: 0x1089, 0x19b4: 0x0279, 0x19b5: 0x0369, - 0x19b6: 0x0289, 0x19b7: 0x13d1, 0x19b8: 0x0039, 0x19b9: 0x0ee9, 0x19ba: 0x0040, 0x19bb: 0x0ef9, - 0x19bc: 0x0f09, 0x19bd: 0x1199, 0x19be: 0x0f31, 0x19bf: 0x0040, + 0x1980: 0x0349, 0x1981: 0x0391, 0x1982: 0x00c1, 0x1983: 0x0109, 0x1984: 0x00c9, 0x1985: 0x04b1, + 0x1986: 0x0019, 0x1987: 0x02e9, 0x1988: 0x03d9, 0x1989: 0x02f1, 0x198a: 0x02f9, 0x198b: 0x03f1, + 0x198c: 0x0309, 0x198d: 0x00a9, 0x198e: 0x0311, 0x198f: 0x00b1, 0x1990: 0x0319, 0x1991: 0x0101, + 0x1992: 0x0321, 0x1993: 0x0329, 0x1994: 0x0051, 0x1995: 0x0339, 0x1996: 0x0751, 0x1997: 0x00b9, + 0x1998: 0x0089, 0x1999: 0x0341, 0x199a: 0x0349, 0x199b: 0x0391, 0x199c: 0x00c1, 0x199d: 0x0109, + 0x199e: 0x00c9, 0x199f: 0x04b1, 0x19a0: 0x0019, 0x19a1: 0x02e9, 0x19a2: 0x03d9, 0x19a3: 0x02f1, + 0x19a4: 0x02f9, 0x19a5: 0x03f1, 0x19a6: 0x0309, 0x19a7: 0x00a9, 0x19a8: 0x0311, 0x19a9: 0x00b1, + 0x19aa: 0x0319, 0x19ab: 0x0101, 0x19ac: 0x0321, 0x19ad: 0x0329, 0x19ae: 0x0051, 0x19af: 0x0339, + 0x19b0: 0x0751, 0x19b1: 0x00b9, 0x19b2: 0x0089, 0x19b3: 0x0341, 0x19b4: 0x0349, 0x19b5: 0x0391, + 0x19b6: 0x00c1, 0x19b7: 0x0109, 0x19b8: 0x00c9, 0x19b9: 0x04b1, 0x19ba: 0x0019, 0x19bb: 0x02e9, + 0x19bc: 0x03d9, 0x19bd: 0x02f1, 0x19be: 0x02f9, 0x19bf: 0x03f1, // Block 0x67, offset 0x19c0 - 0x19c0: 0x0f41, 0x19c1: 0x0259, 0x19c2: 0x0f51, 0x19c3: 0x0359, 0x19c4: 0x0f61, 0x19c5: 0x0040, - 0x19c6: 0x00d9, 0x19c7: 0x0040, 0x19c8: 0x0040, 0x19c9: 0x0040, 0x19ca: 0x01d9, 0x19cb: 0x0fa9, - 0x19cc: 0x0fb9, 0x19cd: 0x1089, 0x19ce: 0x0279, 0x19cf: 0x0369, 0x19d0: 0x0289, 0x19d1: 0x0040, - 0x19d2: 0x0039, 0x19d3: 0x0ee9, 0x19d4: 0x1159, 0x19d5: 0x0ef9, 0x19d6: 0x0f09, 0x19d7: 0x1199, - 0x19d8: 0x0f31, 0x19d9: 0x0249, 0x19da: 0x0f41, 0x19db: 0x0259, 0x19dc: 0x0f51, 0x19dd: 0x0359, - 0x19de: 0x0f61, 0x19df: 0x0f71, 0x19e0: 0x00d9, 0x19e1: 0x0f99, 0x19e2: 0x2039, 0x19e3: 0x0269, - 0x19e4: 0x01d9, 0x19e5: 0x0fa9, 0x19e6: 0x0fb9, 0x19e7: 0x1089, 0x19e8: 0x0279, 0x19e9: 0x0369, - 0x19ea: 0x0289, 0x19eb: 0x13d1, 0x19ec: 0x0039, 0x19ed: 0x0ee9, 0x19ee: 0x1159, 0x19ef: 0x0ef9, - 0x19f0: 0x0f09, 0x19f1: 0x1199, 0x19f2: 0x0f31, 0x19f3: 0x0249, 0x19f4: 0x0f41, 0x19f5: 0x0259, - 0x19f6: 0x0f51, 0x19f7: 0x0359, 0x19f8: 0x0f61, 0x19f9: 0x0f71, 0x19fa: 0x00d9, 0x19fb: 0x0f99, - 0x19fc: 0x2039, 0x19fd: 0x0269, 0x19fe: 0x01d9, 0x19ff: 0x0fa9, + 0x19c0: 0x0309, 0x19c1: 0x00a9, 0x19c2: 0x0311, 0x19c3: 0x00b1, 0x19c4: 0x0319, 0x19c5: 0x0101, + 0x19c6: 0x0321, 0x19c7: 0x0329, 0x19c8: 0x0051, 0x19c9: 0x0339, 0x19ca: 0x0751, 0x19cb: 0x00b9, + 0x19cc: 0x0089, 0x19cd: 0x0341, 0x19ce: 0x0349, 0x19cf: 0x0391, 0x19d0: 0x00c1, 0x19d1: 0x0109, + 0x19d2: 0x00c9, 0x19d3: 0x04b1, 0x19d4: 0x0019, 0x19d5: 0x02e9, 0x19d6: 0x03d9, 0x19d7: 0x02f1, + 0x19d8: 0x02f9, 0x19d9: 0x03f1, 0x19da: 0x0309, 0x19db: 0x00a9, 0x19dc: 0x0311, 0x19dd: 0x00b1, + 0x19de: 0x0319, 0x19df: 0x0101, 0x19e0: 0x0321, 0x19e1: 0x0329, 0x19e2: 0x0051, 0x19e3: 0x0339, + 0x19e4: 0x0751, 0x19e5: 0x00b9, 0x19e6: 0x0089, 0x19e7: 0x0341, 0x19e8: 0x0349, 0x19e9: 0x0391, + 0x19ea: 0x00c1, 0x19eb: 0x0109, 0x19ec: 0x00c9, 0x19ed: 0x04b1, 0x19ee: 0x0019, 0x19ef: 0x02e9, + 0x19f0: 0x03d9, 0x19f1: 0x02f1, 0x19f2: 0x02f9, 0x19f3: 0x03f1, 0x19f4: 0x0309, 0x19f5: 0x00a9, + 0x19f6: 0x0311, 0x19f7: 0x00b1, 0x19f8: 0x0319, 0x19f9: 0x0101, 0x19fa: 0x0321, 0x19fb: 0x0329, + 0x19fc: 0x0051, 0x19fd: 0x0339, 0x19fe: 0x0751, 0x19ff: 0x00b9, // Block 0x68, offset 0x1a00 - 0x1a00: 0x0fb9, 0x1a01: 0x1089, 0x1a02: 0x0279, 0x1a03: 0x0369, 0x1a04: 0x0289, 0x1a05: 0x13d1, - 0x1a06: 0x0039, 0x1a07: 0x0ee9, 0x1a08: 0x1159, 0x1a09: 0x0ef9, 0x1a0a: 0x0f09, 0x1a0b: 0x1199, - 0x1a0c: 0x0f31, 0x1a0d: 0x0249, 0x1a0e: 0x0f41, 0x1a0f: 0x0259, 0x1a10: 0x0f51, 0x1a11: 0x0359, - 0x1a12: 0x0f61, 0x1a13: 0x0f71, 0x1a14: 0x00d9, 0x1a15: 0x0f99, 0x1a16: 0x2039, 0x1a17: 0x0269, - 0x1a18: 0x01d9, 0x1a19: 0x0fa9, 0x1a1a: 0x0fb9, 0x1a1b: 0x1089, 0x1a1c: 0x0279, 0x1a1d: 0x0369, - 0x1a1e: 0x0289, 0x1a1f: 0x13d1, 0x1a20: 0x0039, 0x1a21: 0x0ee9, 0x1a22: 0x1159, 0x1a23: 0x0ef9, - 0x1a24: 0x0f09, 0x1a25: 0x1199, 0x1a26: 0x0f31, 0x1a27: 0x0249, 0x1a28: 0x0f41, 0x1a29: 0x0259, - 0x1a2a: 0x0f51, 0x1a2b: 0x0359, 0x1a2c: 0x0f61, 0x1a2d: 0x0f71, 0x1a2e: 0x00d9, 0x1a2f: 0x0f99, - 0x1a30: 0x2039, 0x1a31: 0x0269, 0x1a32: 0x01d9, 0x1a33: 0x0fa9, 0x1a34: 0x0fb9, 0x1a35: 0x1089, - 0x1a36: 0x0279, 0x1a37: 0x0369, 0x1a38: 0x0289, 0x1a39: 0x13d1, 0x1a3a: 0x0039, 0x1a3b: 0x0ee9, - 0x1a3c: 0x1159, 0x1a3d: 0x0ef9, 0x1a3e: 0x0f09, 0x1a3f: 0x1199, + 0x1a00: 0x0089, 0x1a01: 0x0341, 0x1a02: 0x0349, 0x1a03: 0x0391, 0x1a04: 0x00c1, 0x1a05: 0x0109, + 0x1a06: 0x00c9, 0x1a07: 0x04b1, 0x1a08: 0x0019, 0x1a09: 0x02e9, 0x1a0a: 0x03d9, 0x1a0b: 0x02f1, + 0x1a0c: 0x02f9, 0x1a0d: 0x03f1, 0x1a0e: 0x0309, 0x1a0f: 0x00a9, 0x1a10: 0x0311, 0x1a11: 0x00b1, + 0x1a12: 0x0319, 0x1a13: 0x0101, 0x1a14: 0x0321, 0x1a15: 0x0329, 0x1a16: 0x0051, 0x1a17: 0x0339, + 0x1a18: 0x0751, 0x1a19: 0x00b9, 0x1a1a: 0x0089, 0x1a1b: 0x0341, 0x1a1c: 0x0349, 0x1a1d: 0x0391, + 0x1a1e: 0x00c1, 0x1a1f: 0x0109, 0x1a20: 0x00c9, 0x1a21: 0x04b1, 0x1a22: 0x0019, 0x1a23: 0x02e9, + 0x1a24: 0x03d9, 0x1a25: 0x02f1, 0x1a26: 0x02f9, 0x1a27: 0x03f1, 0x1a28: 0x0309, 0x1a29: 0x00a9, + 0x1a2a: 0x0311, 0x1a2b: 0x00b1, 0x1a2c: 0x0319, 0x1a2d: 0x0101, 0x1a2e: 0x0321, 0x1a2f: 0x0329, + 0x1a30: 0x0051, 0x1a31: 0x0339, 0x1a32: 0x0751, 0x1a33: 0x00b9, 0x1a34: 0x0089, 0x1a35: 0x0341, + 0x1a36: 0x0349, 0x1a37: 0x0391, 0x1a38: 0x00c1, 0x1a39: 0x0109, 0x1a3a: 0x00c9, 0x1a3b: 0x04b1, + 0x1a3c: 0x0019, 0x1a3d: 0x02e9, 0x1a3e: 0x03d9, 0x1a3f: 0x02f1, // Block 0x69, offset 0x1a40 - 0x1a40: 0x0f31, 0x1a41: 0x0249, 0x1a42: 0x0f41, 0x1a43: 0x0259, 0x1a44: 0x0f51, 0x1a45: 0x0359, - 0x1a46: 0x0f61, 0x1a47: 0x0f71, 0x1a48: 0x00d9, 0x1a49: 0x0f99, 0x1a4a: 0x2039, 0x1a4b: 0x0269, - 0x1a4c: 0x01d9, 0x1a4d: 0x0fa9, 0x1a4e: 0x0fb9, 0x1a4f: 0x1089, 0x1a50: 0x0279, 0x1a51: 0x0369, - 0x1a52: 0x0289, 0x1a53: 0x13d1, 0x1a54: 0x0039, 0x1a55: 0x0ee9, 0x1a56: 0x1159, 0x1a57: 0x0ef9, - 0x1a58: 0x0f09, 0x1a59: 0x1199, 0x1a5a: 0x0f31, 0x1a5b: 0x0249, 0x1a5c: 0x0f41, 0x1a5d: 0x0259, - 0x1a5e: 0x0f51, 0x1a5f: 0x0359, 0x1a60: 0x0f61, 0x1a61: 0x0f71, 0x1a62: 0x00d9, 0x1a63: 0x0f99, - 0x1a64: 0x2039, 0x1a65: 0x0269, 0x1a66: 0x01d9, 0x1a67: 0x0fa9, 0x1a68: 0x0fb9, 0x1a69: 0x1089, - 0x1a6a: 0x0279, 0x1a6b: 0x0369, 0x1a6c: 0x0289, 0x1a6d: 0x13d1, 0x1a6e: 0x0039, 0x1a6f: 0x0ee9, - 0x1a70: 0x1159, 0x1a71: 0x0ef9, 0x1a72: 0x0f09, 0x1a73: 0x1199, 0x1a74: 0x0f31, 0x1a75: 0x0249, - 0x1a76: 0x0f41, 0x1a77: 0x0259, 0x1a78: 0x0f51, 0x1a79: 0x0359, 0x1a7a: 0x0f61, 0x1a7b: 0x0f71, - 0x1a7c: 0x00d9, 0x1a7d: 0x0f99, 0x1a7e: 0x2039, 0x1a7f: 0x0269, + 0x1a40: 0x02f9, 0x1a41: 0x03f1, 0x1a42: 0x0309, 0x1a43: 0x00a9, 0x1a44: 0x0311, 0x1a45: 0x00b1, + 0x1a46: 0x0319, 0x1a47: 0x0101, 0x1a48: 0x0321, 0x1a49: 0x0329, 0x1a4a: 0x0051, 0x1a4b: 0x0339, + 0x1a4c: 0x0751, 0x1a4d: 0x00b9, 0x1a4e: 0x0089, 0x1a4f: 0x0341, 0x1a50: 0x0349, 0x1a51: 0x0391, + 0x1a52: 0x00c1, 0x1a53: 0x0109, 0x1a54: 0x00c9, 0x1a55: 0x04b1, 0x1a56: 0x0019, 0x1a57: 0x02e9, + 0x1a58: 0x03d9, 0x1a59: 0x02f1, 0x1a5a: 0x02f9, 0x1a5b: 0x03f1, 0x1a5c: 0x0309, 0x1a5d: 0x00a9, + 0x1a5e: 0x0311, 0x1a5f: 0x00b1, 0x1a60: 0x0319, 0x1a61: 0x0101, 0x1a62: 0x0321, 0x1a63: 0x0329, + 0x1a64: 0x0051, 0x1a65: 0x0339, 0x1a66: 0x0751, 0x1a67: 0x00b9, 0x1a68: 0x0089, 0x1a69: 0x0341, + 0x1a6a: 0x0349, 0x1a6b: 0x0391, 0x1a6c: 0x00c1, 0x1a6d: 0x0109, 0x1a6e: 0x00c9, 0x1a6f: 0x04b1, + 0x1a70: 0x0019, 0x1a71: 0x02e9, 0x1a72: 0x03d9, 0x1a73: 0x02f1, 0x1a74: 0x02f9, 0x1a75: 0x03f1, + 0x1a76: 0x0309, 0x1a77: 0x00a9, 0x1a78: 0x0311, 0x1a79: 0x00b1, 0x1a7a: 0x0319, 0x1a7b: 0x0101, + 0x1a7c: 0x0321, 0x1a7d: 0x0329, 0x1a7e: 0x0051, 0x1a7f: 0x0339, // Block 0x6a, offset 0x1a80 - 0x1a80: 0x01d9, 0x1a81: 0x0fa9, 0x1a82: 0x0fb9, 0x1a83: 0x1089, 0x1a84: 0x0279, 0x1a85: 0x0369, - 0x1a86: 0x0289, 0x1a87: 0x13d1, 0x1a88: 0x0039, 0x1a89: 0x0ee9, 0x1a8a: 0x1159, 0x1a8b: 0x0ef9, - 0x1a8c: 0x0f09, 0x1a8d: 0x1199, 0x1a8e: 0x0f31, 0x1a8f: 0x0249, 0x1a90: 0x0f41, 0x1a91: 0x0259, - 0x1a92: 0x0f51, 0x1a93: 0x0359, 0x1a94: 0x0f61, 0x1a95: 0x0f71, 0x1a96: 0x00d9, 0x1a97: 0x0f99, - 0x1a98: 0x2039, 0x1a99: 0x0269, 0x1a9a: 0x01d9, 0x1a9b: 0x0fa9, 0x1a9c: 0x0fb9, 0x1a9d: 0x1089, - 0x1a9e: 0x0279, 0x1a9f: 0x0369, 0x1aa0: 0x0289, 0x1aa1: 0x13d1, 0x1aa2: 0x0039, 0x1aa3: 0x0ee9, - 0x1aa4: 0x1159, 0x1aa5: 0x0ef9, 0x1aa6: 0x0f09, 0x1aa7: 0x1199, 0x1aa8: 0x0f31, 0x1aa9: 0x0249, - 0x1aaa: 0x0f41, 0x1aab: 0x0259, 0x1aac: 0x0f51, 0x1aad: 0x0359, 0x1aae: 0x0f61, 0x1aaf: 0x0f71, - 0x1ab0: 0x00d9, 0x1ab1: 0x0f99, 0x1ab2: 0x2039, 0x1ab3: 0x0269, 0x1ab4: 0x01d9, 0x1ab5: 0x0fa9, - 0x1ab6: 0x0fb9, 0x1ab7: 0x1089, 0x1ab8: 0x0279, 0x1ab9: 0x0369, 0x1aba: 0x0289, 0x1abb: 0x13d1, - 0x1abc: 0x0039, 0x1abd: 0x0ee9, 0x1abe: 0x1159, 0x1abf: 0x0ef9, + 0x1a80: 0x0751, 0x1a81: 0x00b9, 0x1a82: 0x0089, 0x1a83: 0x0341, 0x1a84: 0x0349, 0x1a85: 0x0391, + 0x1a86: 0x00c1, 0x1a87: 0x0109, 0x1a88: 0x00c9, 0x1a89: 0x04b1, 0x1a8a: 0x0019, 0x1a8b: 0x02e9, + 0x1a8c: 0x03d9, 0x1a8d: 0x02f1, 0x1a8e: 0x02f9, 0x1a8f: 0x03f1, 0x1a90: 0x0309, 0x1a91: 0x00a9, + 0x1a92: 0x0311, 0x1a93: 0x00b1, 0x1a94: 0x0319, 0x1a95: 0x0101, 0x1a96: 0x0321, 0x1a97: 0x0329, + 0x1a98: 0x0051, 0x1a99: 0x0339, 0x1a9a: 0x0751, 0x1a9b: 0x00b9, 0x1a9c: 0x0089, 0x1a9d: 0x0341, + 0x1a9e: 0x0349, 0x1a9f: 0x0391, 0x1aa0: 0x00c1, 0x1aa1: 0x0109, 0x1aa2: 0x00c9, 0x1aa3: 0x04b1, + 0x1aa4: 0x2279, 0x1aa5: 0x2281, 0x1aa6: 0x0040, 0x1aa7: 0x0040, 0x1aa8: 0x2289, 0x1aa9: 0x0399, + 0x1aaa: 0x03a1, 0x1aab: 0x03a9, 0x1aac: 0x2291, 0x1aad: 0x2299, 0x1aae: 0x22a1, 0x1aaf: 0x04d1, + 0x1ab0: 0x05f9, 0x1ab1: 0x22a9, 0x1ab2: 0x22b1, 0x1ab3: 0x22b9, 0x1ab4: 0x22c1, 0x1ab5: 0x22c9, + 0x1ab6: 0x22d1, 0x1ab7: 0x0799, 0x1ab8: 0x03c1, 0x1ab9: 0x04d1, 0x1aba: 0x22d9, 0x1abb: 0x22e1, + 0x1abc: 0x22e9, 0x1abd: 0x03b1, 0x1abe: 0x03b9, 0x1abf: 0x22f1, // Block 0x6b, offset 0x1ac0 - 0x1ac0: 0x0f09, 0x1ac1: 0x1199, 0x1ac2: 0x0f31, 0x1ac3: 0x0249, 0x1ac4: 0x0f41, 0x1ac5: 0x0259, - 0x1ac6: 0x0f51, 0x1ac7: 0x0359, 0x1ac8: 0x0f61, 0x1ac9: 0x0f71, 0x1aca: 0x00d9, 0x1acb: 0x0f99, - 0x1acc: 0x2039, 0x1acd: 0x0269, 0x1ace: 0x01d9, 0x1acf: 0x0fa9, 0x1ad0: 0x0fb9, 0x1ad1: 0x1089, - 0x1ad2: 0x0279, 0x1ad3: 0x0369, 0x1ad4: 0x0289, 0x1ad5: 0x13d1, 0x1ad6: 0x0039, 0x1ad7: 0x0ee9, - 0x1ad8: 0x1159, 0x1ad9: 0x0ef9, 0x1ada: 0x0f09, 0x1adb: 0x1199, 0x1adc: 0x0f31, 0x1add: 0x0249, - 0x1ade: 0x0f41, 0x1adf: 0x0259, 0x1ae0: 0x0f51, 0x1ae1: 0x0359, 0x1ae2: 0x0f61, 0x1ae3: 0x0f71, - 0x1ae4: 0x00d9, 0x1ae5: 0x0f99, 0x1ae6: 0x2039, 0x1ae7: 0x0269, 0x1ae8: 0x01d9, 0x1ae9: 0x0fa9, - 0x1aea: 0x0fb9, 0x1aeb: 0x1089, 0x1aec: 0x0279, 0x1aed: 0x0369, 0x1aee: 0x0289, 0x1aef: 0x13d1, - 0x1af0: 0x0039, 0x1af1: 0x0ee9, 0x1af2: 0x1159, 0x1af3: 0x0ef9, 0x1af4: 0x0f09, 0x1af5: 0x1199, - 0x1af6: 0x0f31, 0x1af7: 0x0249, 0x1af8: 0x0f41, 0x1af9: 0x0259, 0x1afa: 0x0f51, 0x1afb: 0x0359, - 0x1afc: 0x0f61, 0x1afd: 0x0f71, 0x1afe: 0x00d9, 0x1aff: 0x0f99, + 0x1ac0: 0x0769, 0x1ac1: 0x22f9, 0x1ac2: 0x2289, 0x1ac3: 0x0399, 0x1ac4: 0x03a1, 0x1ac5: 0x03a9, + 0x1ac6: 0x2291, 0x1ac7: 0x2299, 0x1ac8: 0x22a1, 0x1ac9: 0x04d1, 0x1aca: 0x05f9, 0x1acb: 0x22a9, + 0x1acc: 0x22b1, 0x1acd: 0x22b9, 0x1ace: 0x22c1, 0x1acf: 0x22c9, 0x1ad0: 0x22d1, 0x1ad1: 0x0799, + 0x1ad2: 0x03c1, 0x1ad3: 0x22d9, 0x1ad4: 0x22d9, 0x1ad5: 0x22e1, 0x1ad6: 0x22e9, 0x1ad7: 0x03b1, + 0x1ad8: 0x03b9, 0x1ad9: 0x22f1, 0x1ada: 0x0769, 0x1adb: 0x2301, 0x1adc: 0x2291, 0x1add: 0x04d1, + 0x1ade: 0x22a9, 0x1adf: 0x03b1, 0x1ae0: 0x03c1, 0x1ae1: 0x0799, 0x1ae2: 0x2289, 0x1ae3: 0x0399, + 0x1ae4: 0x03a1, 0x1ae5: 0x03a9, 0x1ae6: 0x2291, 0x1ae7: 0x2299, 0x1ae8: 0x22a1, 0x1ae9: 0x04d1, + 0x1aea: 0x05f9, 0x1aeb: 0x22a9, 0x1aec: 0x22b1, 0x1aed: 0x22b9, 0x1aee: 0x22c1, 0x1aef: 0x22c9, + 0x1af0: 0x22d1, 0x1af1: 0x0799, 0x1af2: 0x03c1, 0x1af3: 0x04d1, 0x1af4: 0x22d9, 0x1af5: 0x22e1, + 0x1af6: 0x22e9, 0x1af7: 0x03b1, 0x1af8: 0x03b9, 0x1af9: 0x22f1, 0x1afa: 0x0769, 0x1afb: 0x22f9, + 0x1afc: 0x2289, 0x1afd: 0x0399, 0x1afe: 0x03a1, 0x1aff: 0x03a9, // Block 0x6c, offset 0x1b00 - 0x1b00: 0x2039, 0x1b01: 0x0269, 0x1b02: 0x01d9, 0x1b03: 0x0fa9, 0x1b04: 0x0fb9, 0x1b05: 0x1089, - 0x1b06: 0x0279, 0x1b07: 0x0369, 0x1b08: 0x0289, 0x1b09: 0x13d1, 0x1b0a: 0x0039, 0x1b0b: 0x0ee9, - 0x1b0c: 0x1159, 0x1b0d: 0x0ef9, 0x1b0e: 0x0f09, 0x1b0f: 0x1199, 0x1b10: 0x0f31, 0x1b11: 0x0249, - 0x1b12: 0x0f41, 0x1b13: 0x0259, 0x1b14: 0x0f51, 0x1b15: 0x0359, 0x1b16: 0x0f61, 0x1b17: 0x0f71, - 0x1b18: 0x00d9, 0x1b19: 0x0f99, 0x1b1a: 0x2039, 0x1b1b: 0x0269, 0x1b1c: 0x01d9, 0x1b1d: 0x0fa9, - 0x1b1e: 0x0fb9, 0x1b1f: 0x1089, 0x1b20: 0x0279, 0x1b21: 0x0369, 0x1b22: 0x0289, 0x1b23: 0x13d1, - 0x1b24: 0xbad1, 0x1b25: 0xbae9, 0x1b26: 0x0040, 0x1b27: 0x0040, 0x1b28: 0xbb01, 0x1b29: 0x1099, - 0x1b2a: 0x10b1, 0x1b2b: 0x10c9, 0x1b2c: 0xbb19, 0x1b2d: 0xbb31, 0x1b2e: 0xbb49, 0x1b2f: 0x1429, - 0x1b30: 0x1a31, 0x1b31: 0xbb61, 0x1b32: 0xbb79, 0x1b33: 0xbb91, 0x1b34: 0xbba9, 0x1b35: 0xbbc1, - 0x1b36: 0xbbd9, 0x1b37: 0x2109, 0x1b38: 0x1111, 0x1b39: 0x1429, 0x1b3a: 0xbbf1, 0x1b3b: 0xbc09, - 0x1b3c: 0xbc21, 0x1b3d: 0x10e1, 0x1b3e: 0x10f9, 0x1b3f: 0xbc39, + 0x1b00: 0x2291, 0x1b01: 0x2299, 0x1b02: 0x22a1, 0x1b03: 0x04d1, 0x1b04: 0x05f9, 0x1b05: 0x22a9, + 0x1b06: 0x22b1, 0x1b07: 0x22b9, 0x1b08: 0x22c1, 0x1b09: 0x22c9, 0x1b0a: 0x22d1, 0x1b0b: 0x0799, + 0x1b0c: 0x03c1, 0x1b0d: 0x22d9, 0x1b0e: 0x22d9, 0x1b0f: 0x22e1, 0x1b10: 0x22e9, 0x1b11: 0x03b1, + 0x1b12: 0x03b9, 0x1b13: 0x22f1, 0x1b14: 0x0769, 0x1b15: 0x2301, 0x1b16: 0x2291, 0x1b17: 0x04d1, + 0x1b18: 0x22a9, 0x1b19: 0x03b1, 0x1b1a: 0x03c1, 0x1b1b: 0x0799, 0x1b1c: 0x2289, 0x1b1d: 0x0399, + 0x1b1e: 0x03a1, 0x1b1f: 0x03a9, 0x1b20: 0x2291, 0x1b21: 0x2299, 0x1b22: 0x22a1, 0x1b23: 0x04d1, + 0x1b24: 0x05f9, 0x1b25: 0x22a9, 0x1b26: 0x22b1, 0x1b27: 0x22b9, 0x1b28: 0x22c1, 0x1b29: 0x22c9, + 0x1b2a: 0x22d1, 0x1b2b: 0x0799, 0x1b2c: 0x03c1, 0x1b2d: 0x04d1, 0x1b2e: 0x22d9, 0x1b2f: 0x22e1, + 0x1b30: 0x22e9, 0x1b31: 0x03b1, 0x1b32: 0x03b9, 0x1b33: 0x22f1, 0x1b34: 0x0769, 0x1b35: 0x22f9, + 0x1b36: 0x2289, 0x1b37: 0x0399, 0x1b38: 0x03a1, 0x1b39: 0x03a9, 0x1b3a: 0x2291, 0x1b3b: 0x2299, + 0x1b3c: 0x22a1, 0x1b3d: 0x04d1, 0x1b3e: 0x05f9, 0x1b3f: 0x22a9, // Block 0x6d, offset 0x1b40 - 0x1b40: 0x2079, 0x1b41: 0xbc51, 0x1b42: 0xbb01, 0x1b43: 0x1099, 0x1b44: 0x10b1, 0x1b45: 0x10c9, - 0x1b46: 0xbb19, 0x1b47: 0xbb31, 0x1b48: 0xbb49, 0x1b49: 0x1429, 0x1b4a: 0x1a31, 0x1b4b: 0xbb61, - 0x1b4c: 0xbb79, 0x1b4d: 0xbb91, 0x1b4e: 0xbba9, 0x1b4f: 0xbbc1, 0x1b50: 0xbbd9, 0x1b51: 0x2109, - 0x1b52: 0x1111, 0x1b53: 0xbbf1, 0x1b54: 0xbbf1, 0x1b55: 0xbc09, 0x1b56: 0xbc21, 0x1b57: 0x10e1, - 0x1b58: 0x10f9, 0x1b59: 0xbc39, 0x1b5a: 0x2079, 0x1b5b: 0xbc71, 0x1b5c: 0xbb19, 0x1b5d: 0x1429, - 0x1b5e: 0xbb61, 0x1b5f: 0x10e1, 0x1b60: 0x1111, 0x1b61: 0x2109, 0x1b62: 0xbb01, 0x1b63: 0x1099, - 0x1b64: 0x10b1, 0x1b65: 0x10c9, 0x1b66: 0xbb19, 0x1b67: 0xbb31, 0x1b68: 0xbb49, 0x1b69: 0x1429, - 0x1b6a: 0x1a31, 0x1b6b: 0xbb61, 0x1b6c: 0xbb79, 0x1b6d: 0xbb91, 0x1b6e: 0xbba9, 0x1b6f: 0xbbc1, - 0x1b70: 0xbbd9, 0x1b71: 0x2109, 0x1b72: 0x1111, 0x1b73: 0x1429, 0x1b74: 0xbbf1, 0x1b75: 0xbc09, - 0x1b76: 0xbc21, 0x1b77: 0x10e1, 0x1b78: 0x10f9, 0x1b79: 0xbc39, 0x1b7a: 0x2079, 0x1b7b: 0xbc51, - 0x1b7c: 0xbb01, 0x1b7d: 0x1099, 0x1b7e: 0x10b1, 0x1b7f: 0x10c9, + 0x1b40: 0x22b1, 0x1b41: 0x22b9, 0x1b42: 0x22c1, 0x1b43: 0x22c9, 0x1b44: 0x22d1, 0x1b45: 0x0799, + 0x1b46: 0x03c1, 0x1b47: 0x22d9, 0x1b48: 0x22d9, 0x1b49: 0x22e1, 0x1b4a: 0x22e9, 0x1b4b: 0x03b1, + 0x1b4c: 0x03b9, 0x1b4d: 0x22f1, 0x1b4e: 0x0769, 0x1b4f: 0x2301, 0x1b50: 0x2291, 0x1b51: 0x04d1, + 0x1b52: 0x22a9, 0x1b53: 0x03b1, 0x1b54: 0x03c1, 0x1b55: 0x0799, 0x1b56: 0x2289, 0x1b57: 0x0399, + 0x1b58: 0x03a1, 0x1b59: 0x03a9, 0x1b5a: 0x2291, 0x1b5b: 0x2299, 0x1b5c: 0x22a1, 0x1b5d: 0x04d1, + 0x1b5e: 0x05f9, 0x1b5f: 0x22a9, 0x1b60: 0x22b1, 0x1b61: 0x22b9, 0x1b62: 0x22c1, 0x1b63: 0x22c9, + 0x1b64: 0x22d1, 0x1b65: 0x0799, 0x1b66: 0x03c1, 0x1b67: 0x04d1, 0x1b68: 0x22d9, 0x1b69: 0x22e1, + 0x1b6a: 0x22e9, 0x1b6b: 0x03b1, 0x1b6c: 0x03b9, 0x1b6d: 0x22f1, 0x1b6e: 0x0769, 0x1b6f: 0x22f9, + 0x1b70: 0x2289, 0x1b71: 0x0399, 0x1b72: 0x03a1, 0x1b73: 0x03a9, 0x1b74: 0x2291, 0x1b75: 0x2299, + 0x1b76: 0x22a1, 0x1b77: 0x04d1, 0x1b78: 0x05f9, 0x1b79: 0x22a9, 0x1b7a: 0x22b1, 0x1b7b: 0x22b9, + 0x1b7c: 0x22c1, 0x1b7d: 0x22c9, 0x1b7e: 0x22d1, 0x1b7f: 0x0799, // Block 0x6e, offset 0x1b80 - 0x1b80: 0xbb19, 0x1b81: 0xbb31, 0x1b82: 0xbb49, 0x1b83: 0x1429, 0x1b84: 0x1a31, 0x1b85: 0xbb61, - 0x1b86: 0xbb79, 0x1b87: 0xbb91, 0x1b88: 0xbba9, 0x1b89: 0xbbc1, 0x1b8a: 0xbbd9, 0x1b8b: 0x2109, - 0x1b8c: 0x1111, 0x1b8d: 0xbbf1, 0x1b8e: 0xbbf1, 0x1b8f: 0xbc09, 0x1b90: 0xbc21, 0x1b91: 0x10e1, - 0x1b92: 0x10f9, 0x1b93: 0xbc39, 0x1b94: 0x2079, 0x1b95: 0xbc71, 0x1b96: 0xbb19, 0x1b97: 0x1429, - 0x1b98: 0xbb61, 0x1b99: 0x10e1, 0x1b9a: 0x1111, 0x1b9b: 0x2109, 0x1b9c: 0xbb01, 0x1b9d: 0x1099, - 0x1b9e: 0x10b1, 0x1b9f: 0x10c9, 0x1ba0: 0xbb19, 0x1ba1: 0xbb31, 0x1ba2: 0xbb49, 0x1ba3: 0x1429, - 0x1ba4: 0x1a31, 0x1ba5: 0xbb61, 0x1ba6: 0xbb79, 0x1ba7: 0xbb91, 0x1ba8: 0xbba9, 0x1ba9: 0xbbc1, - 0x1baa: 0xbbd9, 0x1bab: 0x2109, 0x1bac: 0x1111, 0x1bad: 0x1429, 0x1bae: 0xbbf1, 0x1baf: 0xbc09, - 0x1bb0: 0xbc21, 0x1bb1: 0x10e1, 0x1bb2: 0x10f9, 0x1bb3: 0xbc39, 0x1bb4: 0x2079, 0x1bb5: 0xbc51, - 0x1bb6: 0xbb01, 0x1bb7: 0x1099, 0x1bb8: 0x10b1, 0x1bb9: 0x10c9, 0x1bba: 0xbb19, 0x1bbb: 0xbb31, - 0x1bbc: 0xbb49, 0x1bbd: 0x1429, 0x1bbe: 0x1a31, 0x1bbf: 0xbb61, + 0x1b80: 0x03c1, 0x1b81: 0x22d9, 0x1b82: 0x22d9, 0x1b83: 0x22e1, 0x1b84: 0x22e9, 0x1b85: 0x03b1, + 0x1b86: 0x03b9, 0x1b87: 0x22f1, 0x1b88: 0x0769, 0x1b89: 0x2301, 0x1b8a: 0x2291, 0x1b8b: 0x04d1, + 0x1b8c: 0x22a9, 0x1b8d: 0x03b1, 0x1b8e: 0x03c1, 0x1b8f: 0x0799, 0x1b90: 0x2289, 0x1b91: 0x0399, + 0x1b92: 0x03a1, 0x1b93: 0x03a9, 0x1b94: 0x2291, 0x1b95: 0x2299, 0x1b96: 0x22a1, 0x1b97: 0x04d1, + 0x1b98: 0x05f9, 0x1b99: 0x22a9, 0x1b9a: 0x22b1, 0x1b9b: 0x22b9, 0x1b9c: 0x22c1, 0x1b9d: 0x22c9, + 0x1b9e: 0x22d1, 0x1b9f: 0x0799, 0x1ba0: 0x03c1, 0x1ba1: 0x04d1, 0x1ba2: 0x22d9, 0x1ba3: 0x22e1, + 0x1ba4: 0x22e9, 0x1ba5: 0x03b1, 0x1ba6: 0x03b9, 0x1ba7: 0x22f1, 0x1ba8: 0x0769, 0x1ba9: 0x22f9, + 0x1baa: 0x2289, 0x1bab: 0x0399, 0x1bac: 0x03a1, 0x1bad: 0x03a9, 0x1bae: 0x2291, 0x1baf: 0x2299, + 0x1bb0: 0x22a1, 0x1bb1: 0x04d1, 0x1bb2: 0x05f9, 0x1bb3: 0x22a9, 0x1bb4: 0x22b1, 0x1bb5: 0x22b9, + 0x1bb6: 0x22c1, 0x1bb7: 0x22c9, 0x1bb8: 0x22d1, 0x1bb9: 0x0799, 0x1bba: 0x03c1, 0x1bbb: 0x22d9, + 0x1bbc: 0x22d9, 0x1bbd: 0x22e1, 0x1bbe: 0x22e9, 0x1bbf: 0x03b1, // Block 0x6f, offset 0x1bc0 - 0x1bc0: 0xbb79, 0x1bc1: 0xbb91, 0x1bc2: 0xbba9, 0x1bc3: 0xbbc1, 0x1bc4: 0xbbd9, 0x1bc5: 0x2109, - 0x1bc6: 0x1111, 0x1bc7: 0xbbf1, 0x1bc8: 0xbbf1, 0x1bc9: 0xbc09, 0x1bca: 0xbc21, 0x1bcb: 0x10e1, - 0x1bcc: 0x10f9, 0x1bcd: 0xbc39, 0x1bce: 0x2079, 0x1bcf: 0xbc71, 0x1bd0: 0xbb19, 0x1bd1: 0x1429, - 0x1bd2: 0xbb61, 0x1bd3: 0x10e1, 0x1bd4: 0x1111, 0x1bd5: 0x2109, 0x1bd6: 0xbb01, 0x1bd7: 0x1099, - 0x1bd8: 0x10b1, 0x1bd9: 0x10c9, 0x1bda: 0xbb19, 0x1bdb: 0xbb31, 0x1bdc: 0xbb49, 0x1bdd: 0x1429, - 0x1bde: 0x1a31, 0x1bdf: 0xbb61, 0x1be0: 0xbb79, 0x1be1: 0xbb91, 0x1be2: 0xbba9, 0x1be3: 0xbbc1, - 0x1be4: 0xbbd9, 0x1be5: 0x2109, 0x1be6: 0x1111, 0x1be7: 0x1429, 0x1be8: 0xbbf1, 0x1be9: 0xbc09, - 0x1bea: 0xbc21, 0x1beb: 0x10e1, 0x1bec: 0x10f9, 0x1bed: 0xbc39, 0x1bee: 0x2079, 0x1bef: 0xbc51, - 0x1bf0: 0xbb01, 0x1bf1: 0x1099, 0x1bf2: 0x10b1, 0x1bf3: 0x10c9, 0x1bf4: 0xbb19, 0x1bf5: 0xbb31, - 0x1bf6: 0xbb49, 0x1bf7: 0x1429, 0x1bf8: 0x1a31, 0x1bf9: 0xbb61, 0x1bfa: 0xbb79, 0x1bfb: 0xbb91, - 0x1bfc: 0xbba9, 0x1bfd: 0xbbc1, 0x1bfe: 0xbbd9, 0x1bff: 0x2109, + 0x1bc0: 0x03b9, 0x1bc1: 0x22f1, 0x1bc2: 0x0769, 0x1bc3: 0x2301, 0x1bc4: 0x2291, 0x1bc5: 0x04d1, + 0x1bc6: 0x22a9, 0x1bc7: 0x03b1, 0x1bc8: 0x03c1, 0x1bc9: 0x0799, 0x1bca: 0x2309, 0x1bcb: 0x2309, + 0x1bcc: 0x0040, 0x1bcd: 0x0040, 0x1bce: 0x06e1, 0x1bcf: 0x0049, 0x1bd0: 0x0029, 0x1bd1: 0x0031, + 0x1bd2: 0x06e9, 0x1bd3: 0x06f1, 0x1bd4: 0x06f9, 0x1bd5: 0x0701, 0x1bd6: 0x0709, 0x1bd7: 0x0711, + 0x1bd8: 0x06e1, 0x1bd9: 0x0049, 0x1bda: 0x0029, 0x1bdb: 0x0031, 0x1bdc: 0x06e9, 0x1bdd: 0x06f1, + 0x1bde: 0x06f9, 0x1bdf: 0x0701, 0x1be0: 0x0709, 0x1be1: 0x0711, 0x1be2: 0x06e1, 0x1be3: 0x0049, + 0x1be4: 0x0029, 0x1be5: 0x0031, 0x1be6: 0x06e9, 0x1be7: 0x06f1, 0x1be8: 0x06f9, 0x1be9: 0x0701, + 0x1bea: 0x0709, 0x1beb: 0x0711, 0x1bec: 0x06e1, 0x1bed: 0x0049, 0x1bee: 0x0029, 0x1bef: 0x0031, + 0x1bf0: 0x06e9, 0x1bf1: 0x06f1, 0x1bf2: 0x06f9, 0x1bf3: 0x0701, 0x1bf4: 0x0709, 0x1bf5: 0x0711, + 0x1bf6: 0x06e1, 0x1bf7: 0x0049, 0x1bf8: 0x0029, 0x1bf9: 0x0031, 0x1bfa: 0x06e9, 0x1bfb: 0x06f1, + 0x1bfc: 0x06f9, 0x1bfd: 0x0701, 0x1bfe: 0x0709, 0x1bff: 0x0711, // Block 0x70, offset 0x1c00 - 0x1c00: 0x1111, 0x1c01: 0xbbf1, 0x1c02: 0xbbf1, 0x1c03: 0xbc09, 0x1c04: 0xbc21, 0x1c05: 0x10e1, - 0x1c06: 0x10f9, 0x1c07: 0xbc39, 0x1c08: 0x2079, 0x1c09: 0xbc71, 0x1c0a: 0xbb19, 0x1c0b: 0x1429, - 0x1c0c: 0xbb61, 0x1c0d: 0x10e1, 0x1c0e: 0x1111, 0x1c0f: 0x2109, 0x1c10: 0xbb01, 0x1c11: 0x1099, - 0x1c12: 0x10b1, 0x1c13: 0x10c9, 0x1c14: 0xbb19, 0x1c15: 0xbb31, 0x1c16: 0xbb49, 0x1c17: 0x1429, - 0x1c18: 0x1a31, 0x1c19: 0xbb61, 0x1c1a: 0xbb79, 0x1c1b: 0xbb91, 0x1c1c: 0xbba9, 0x1c1d: 0xbbc1, - 0x1c1e: 0xbbd9, 0x1c1f: 0x2109, 0x1c20: 0x1111, 0x1c21: 0x1429, 0x1c22: 0xbbf1, 0x1c23: 0xbc09, - 0x1c24: 0xbc21, 0x1c25: 0x10e1, 0x1c26: 0x10f9, 0x1c27: 0xbc39, 0x1c28: 0x2079, 0x1c29: 0xbc51, - 0x1c2a: 0xbb01, 0x1c2b: 0x1099, 0x1c2c: 0x10b1, 0x1c2d: 0x10c9, 0x1c2e: 0xbb19, 0x1c2f: 0xbb31, - 0x1c30: 0xbb49, 0x1c31: 0x1429, 0x1c32: 0x1a31, 0x1c33: 0xbb61, 0x1c34: 0xbb79, 0x1c35: 0xbb91, - 0x1c36: 0xbba9, 0x1c37: 0xbbc1, 0x1c38: 0xbbd9, 0x1c39: 0x2109, 0x1c3a: 0x1111, 0x1c3b: 0xbbf1, - 0x1c3c: 0xbbf1, 0x1c3d: 0xbc09, 0x1c3e: 0xbc21, 0x1c3f: 0x10e1, + 0x1c00: 0xe115, 0x1c01: 0xe115, 0x1c02: 0xe135, 0x1c03: 0xe135, 0x1c04: 0xe115, 0x1c05: 0xe115, + 0x1c06: 0xe175, 0x1c07: 0xe175, 0x1c08: 0xe115, 0x1c09: 0xe115, 0x1c0a: 0xe135, 0x1c0b: 0xe135, + 0x1c0c: 0xe115, 0x1c0d: 0xe115, 0x1c0e: 0xe1f5, 0x1c0f: 0xe1f5, 0x1c10: 0xe115, 0x1c11: 0xe115, + 0x1c12: 0xe135, 0x1c13: 0xe135, 0x1c14: 0xe115, 0x1c15: 0xe115, 0x1c16: 0xe175, 0x1c17: 0xe175, + 0x1c18: 0xe115, 0x1c19: 0xe115, 0x1c1a: 0xe135, 0x1c1b: 0xe135, 0x1c1c: 0xe115, 0x1c1d: 0xe115, + 0x1c1e: 0x8b3d, 0x1c1f: 0x8b3d, 0x1c20: 0x04b5, 0x1c21: 0x04b5, 0x1c22: 0x0a08, 0x1c23: 0x0a08, + 0x1c24: 0x0a08, 0x1c25: 0x0a08, 0x1c26: 0x0a08, 0x1c27: 0x0a08, 0x1c28: 0x0a08, 0x1c29: 0x0a08, + 0x1c2a: 0x0a08, 0x1c2b: 0x0a08, 0x1c2c: 0x0a08, 0x1c2d: 0x0a08, 0x1c2e: 0x0a08, 0x1c2f: 0x0a08, + 0x1c30: 0x0a08, 0x1c31: 0x0a08, 0x1c32: 0x0a08, 0x1c33: 0x0a08, 0x1c34: 0x0a08, 0x1c35: 0x0a08, + 0x1c36: 0x0a08, 0x1c37: 0x0a08, 0x1c38: 0x0a08, 0x1c39: 0x0a08, 0x1c3a: 0x0a08, 0x1c3b: 0x0a08, + 0x1c3c: 0x0a08, 0x1c3d: 0x0a08, 0x1c3e: 0x0a08, 0x1c3f: 0x0a08, // Block 0x71, offset 0x1c40 - 0x1c40: 0x10f9, 0x1c41: 0xbc39, 0x1c42: 0x2079, 0x1c43: 0xbc71, 0x1c44: 0xbb19, 0x1c45: 0x1429, - 0x1c46: 0xbb61, 0x1c47: 0x10e1, 0x1c48: 0x1111, 0x1c49: 0x2109, 0x1c4a: 0xbc91, 0x1c4b: 0xbc91, - 0x1c4c: 0x0040, 0x1c4d: 0x0040, 0x1c4e: 0x1f41, 0x1c4f: 0x00c9, 0x1c50: 0x0069, 0x1c51: 0x0079, - 0x1c52: 0x1f51, 0x1c53: 0x1f61, 0x1c54: 0x1f71, 0x1c55: 0x1f81, 0x1c56: 0x1f91, 0x1c57: 0x1fa1, - 0x1c58: 0x1f41, 0x1c59: 0x00c9, 0x1c5a: 0x0069, 0x1c5b: 0x0079, 0x1c5c: 0x1f51, 0x1c5d: 0x1f61, - 0x1c5e: 0x1f71, 0x1c5f: 0x1f81, 0x1c60: 0x1f91, 0x1c61: 0x1fa1, 0x1c62: 0x1f41, 0x1c63: 0x00c9, - 0x1c64: 0x0069, 0x1c65: 0x0079, 0x1c66: 0x1f51, 0x1c67: 0x1f61, 0x1c68: 0x1f71, 0x1c69: 0x1f81, - 0x1c6a: 0x1f91, 0x1c6b: 0x1fa1, 0x1c6c: 0x1f41, 0x1c6d: 0x00c9, 0x1c6e: 0x0069, 0x1c6f: 0x0079, - 0x1c70: 0x1f51, 0x1c71: 0x1f61, 0x1c72: 0x1f71, 0x1c73: 0x1f81, 0x1c74: 0x1f91, 0x1c75: 0x1fa1, - 0x1c76: 0x1f41, 0x1c77: 0x00c9, 0x1c78: 0x0069, 0x1c79: 0x0079, 0x1c7a: 0x1f51, 0x1c7b: 0x1f61, - 0x1c7c: 0x1f71, 0x1c7d: 0x1f81, 0x1c7e: 0x1f91, 0x1c7f: 0x1fa1, + 0x1c40: 0x20b1, 0x1c41: 0x20b9, 0x1c42: 0x20d9, 0x1c43: 0x20f1, 0x1c44: 0x0040, 0x1c45: 0x2189, + 0x1c46: 0x2109, 0x1c47: 0x20e1, 0x1c48: 0x2131, 0x1c49: 0x2191, 0x1c4a: 0x2161, 0x1c4b: 0x2169, + 0x1c4c: 0x2171, 0x1c4d: 0x2179, 0x1c4e: 0x2111, 0x1c4f: 0x2141, 0x1c50: 0x2151, 0x1c51: 0x2121, + 0x1c52: 0x2159, 0x1c53: 0x2101, 0x1c54: 0x2119, 0x1c55: 0x20c9, 0x1c56: 0x20d1, 0x1c57: 0x20e9, + 0x1c58: 0x20f9, 0x1c59: 0x2129, 0x1c5a: 0x2139, 0x1c5b: 0x2149, 0x1c5c: 0x2311, 0x1c5d: 0x1689, + 0x1c5e: 0x2319, 0x1c5f: 0x2321, 0x1c60: 0x0040, 0x1c61: 0x20b9, 0x1c62: 0x20d9, 0x1c63: 0x0040, + 0x1c64: 0x2181, 0x1c65: 0x0040, 0x1c66: 0x0040, 0x1c67: 0x20e1, 0x1c68: 0x0040, 0x1c69: 0x2191, + 0x1c6a: 0x2161, 0x1c6b: 0x2169, 0x1c6c: 0x2171, 0x1c6d: 0x2179, 0x1c6e: 0x2111, 0x1c6f: 0x2141, + 0x1c70: 0x2151, 0x1c71: 0x2121, 0x1c72: 0x2159, 0x1c73: 0x0040, 0x1c74: 0x2119, 0x1c75: 0x20c9, + 0x1c76: 0x20d1, 0x1c77: 0x20e9, 0x1c78: 0x0040, 0x1c79: 0x2129, 0x1c7a: 0x0040, 0x1c7b: 0x2149, + 0x1c7c: 0x0040, 0x1c7d: 0x0040, 0x1c7e: 0x0040, 0x1c7f: 0x0040, // Block 0x72, offset 0x1c80 - 0x1c80: 0xe115, 0x1c81: 0xe115, 0x1c82: 0xe135, 0x1c83: 0xe135, 0x1c84: 0xe115, 0x1c85: 0xe115, - 0x1c86: 0xe175, 0x1c87: 0xe175, 0x1c88: 0xe115, 0x1c89: 0xe115, 0x1c8a: 0xe135, 0x1c8b: 0xe135, - 0x1c8c: 0xe115, 0x1c8d: 0xe115, 0x1c8e: 0xe1f5, 0x1c8f: 0xe1f5, 0x1c90: 0xe115, 0x1c91: 0xe115, - 0x1c92: 0xe135, 0x1c93: 0xe135, 0x1c94: 0xe115, 0x1c95: 0xe115, 0x1c96: 0xe175, 0x1c97: 0xe175, - 0x1c98: 0xe115, 0x1c99: 0xe115, 0x1c9a: 0xe135, 0x1c9b: 0xe135, 0x1c9c: 0xe115, 0x1c9d: 0xe115, - 0x1c9e: 0x8b3d, 0x1c9f: 0x8b3d, 0x1ca0: 0x04b5, 0x1ca1: 0x04b5, 0x1ca2: 0x0a08, 0x1ca3: 0x0a08, - 0x1ca4: 0x0a08, 0x1ca5: 0x0a08, 0x1ca6: 0x0a08, 0x1ca7: 0x0a08, 0x1ca8: 0x0a08, 0x1ca9: 0x0a08, - 0x1caa: 0x0a08, 0x1cab: 0x0a08, 0x1cac: 0x0a08, 0x1cad: 0x0a08, 0x1cae: 0x0a08, 0x1caf: 0x0a08, - 0x1cb0: 0x0a08, 0x1cb1: 0x0a08, 0x1cb2: 0x0a08, 0x1cb3: 0x0a08, 0x1cb4: 0x0a08, 0x1cb5: 0x0a08, - 0x1cb6: 0x0a08, 0x1cb7: 0x0a08, 0x1cb8: 0x0a08, 0x1cb9: 0x0a08, 0x1cba: 0x0a08, 0x1cbb: 0x0a08, - 0x1cbc: 0x0a08, 0x1cbd: 0x0a08, 0x1cbe: 0x0a08, 0x1cbf: 0x0a08, + 0x1c80: 0x0040, 0x1c81: 0x0040, 0x1c82: 0x20d9, 0x1c83: 0x0040, 0x1c84: 0x0040, 0x1c85: 0x0040, + 0x1c86: 0x0040, 0x1c87: 0x20e1, 0x1c88: 0x0040, 0x1c89: 0x2191, 0x1c8a: 0x0040, 0x1c8b: 0x2169, + 0x1c8c: 0x0040, 0x1c8d: 0x2179, 0x1c8e: 0x2111, 0x1c8f: 0x2141, 0x1c90: 0x0040, 0x1c91: 0x2121, + 0x1c92: 0x2159, 0x1c93: 0x0040, 0x1c94: 0x2119, 0x1c95: 0x0040, 0x1c96: 0x0040, 0x1c97: 0x20e9, + 0x1c98: 0x0040, 0x1c99: 0x2129, 0x1c9a: 0x0040, 0x1c9b: 0x2149, 0x1c9c: 0x0040, 0x1c9d: 0x1689, + 0x1c9e: 0x0040, 0x1c9f: 0x2321, 0x1ca0: 0x0040, 0x1ca1: 0x20b9, 0x1ca2: 0x20d9, 0x1ca3: 0x0040, + 0x1ca4: 0x2181, 0x1ca5: 0x0040, 0x1ca6: 0x0040, 0x1ca7: 0x20e1, 0x1ca8: 0x2131, 0x1ca9: 0x2191, + 0x1caa: 0x2161, 0x1cab: 0x0040, 0x1cac: 0x2171, 0x1cad: 0x2179, 0x1cae: 0x2111, 0x1caf: 0x2141, + 0x1cb0: 0x2151, 0x1cb1: 0x2121, 0x1cb2: 0x2159, 0x1cb3: 0x0040, 0x1cb4: 0x2119, 0x1cb5: 0x20c9, + 0x1cb6: 0x20d1, 0x1cb7: 0x20e9, 0x1cb8: 0x0040, 0x1cb9: 0x2129, 0x1cba: 0x2139, 0x1cbb: 0x2149, + 0x1cbc: 0x2311, 0x1cbd: 0x0040, 0x1cbe: 0x2319, 0x1cbf: 0x0040, // Block 0x73, offset 0x1cc0 - 0x1cc0: 0xb1d9, 0x1cc1: 0xb1f1, 0x1cc2: 0xb251, 0x1cc3: 0xb299, 0x1cc4: 0x0040, 0x1cc5: 0xb461, - 0x1cc6: 0xb2e1, 0x1cc7: 0xb269, 0x1cc8: 0xb359, 0x1cc9: 0xb479, 0x1cca: 0xb3e9, 0x1ccb: 0xb401, - 0x1ccc: 0xb419, 0x1ccd: 0xb431, 0x1cce: 0xb2f9, 0x1ccf: 0xb389, 0x1cd0: 0xb3b9, 0x1cd1: 0xb329, - 0x1cd2: 0xb3d1, 0x1cd3: 0xb2c9, 0x1cd4: 0xb311, 0x1cd5: 0xb221, 0x1cd6: 0xb239, 0x1cd7: 0xb281, - 0x1cd8: 0xb2b1, 0x1cd9: 0xb341, 0x1cda: 0xb371, 0x1cdb: 0xb3a1, 0x1cdc: 0xbca9, 0x1cdd: 0x7999, - 0x1cde: 0xbcc1, 0x1cdf: 0xbcd9, 0x1ce0: 0x0040, 0x1ce1: 0xb1f1, 0x1ce2: 0xb251, 0x1ce3: 0x0040, - 0x1ce4: 0xb449, 0x1ce5: 0x0040, 0x1ce6: 0x0040, 0x1ce7: 0xb269, 0x1ce8: 0x0040, 0x1ce9: 0xb479, - 0x1cea: 0xb3e9, 0x1ceb: 0xb401, 0x1cec: 0xb419, 0x1ced: 0xb431, 0x1cee: 0xb2f9, 0x1cef: 0xb389, - 0x1cf0: 0xb3b9, 0x1cf1: 0xb329, 0x1cf2: 0xb3d1, 0x1cf3: 0x0040, 0x1cf4: 0xb311, 0x1cf5: 0xb221, - 0x1cf6: 0xb239, 0x1cf7: 0xb281, 0x1cf8: 0x0040, 0x1cf9: 0xb341, 0x1cfa: 0x0040, 0x1cfb: 0xb3a1, + 0x1cc0: 0x20b1, 0x1cc1: 0x20b9, 0x1cc2: 0x20d9, 0x1cc3: 0x20f1, 0x1cc4: 0x2181, 0x1cc5: 0x2189, + 0x1cc6: 0x2109, 0x1cc7: 0x20e1, 0x1cc8: 0x2131, 0x1cc9: 0x2191, 0x1cca: 0x0040, 0x1ccb: 0x2169, + 0x1ccc: 0x2171, 0x1ccd: 0x2179, 0x1cce: 0x2111, 0x1ccf: 0x2141, 0x1cd0: 0x2151, 0x1cd1: 0x2121, + 0x1cd2: 0x2159, 0x1cd3: 0x2101, 0x1cd4: 0x2119, 0x1cd5: 0x20c9, 0x1cd6: 0x20d1, 0x1cd7: 0x20e9, + 0x1cd8: 0x20f9, 0x1cd9: 0x2129, 0x1cda: 0x2139, 0x1cdb: 0x2149, 0x1cdc: 0x0040, 0x1cdd: 0x0040, + 0x1cde: 0x0040, 0x1cdf: 0x0040, 0x1ce0: 0x0040, 0x1ce1: 0x20b9, 0x1ce2: 0x20d9, 0x1ce3: 0x20f1, + 0x1ce4: 0x0040, 0x1ce5: 0x2189, 0x1ce6: 0x2109, 0x1ce7: 0x20e1, 0x1ce8: 0x2131, 0x1ce9: 0x2191, + 0x1cea: 0x0040, 0x1ceb: 0x2169, 0x1cec: 0x2171, 0x1ced: 0x2179, 0x1cee: 0x2111, 0x1cef: 0x2141, + 0x1cf0: 0x2151, 0x1cf1: 0x2121, 0x1cf2: 0x2159, 0x1cf3: 0x2101, 0x1cf4: 0x2119, 0x1cf5: 0x20c9, + 0x1cf6: 0x20d1, 0x1cf7: 0x20e9, 0x1cf8: 0x20f9, 0x1cf9: 0x2129, 0x1cfa: 0x2139, 0x1cfb: 0x2149, 0x1cfc: 0x0040, 0x1cfd: 0x0040, 0x1cfe: 0x0040, 0x1cff: 0x0040, // Block 0x74, offset 0x1d00 - 0x1d00: 0x0040, 0x1d01: 0x0040, 0x1d02: 0xb251, 0x1d03: 0x0040, 0x1d04: 0x0040, 0x1d05: 0x0040, - 0x1d06: 0x0040, 0x1d07: 0xb269, 0x1d08: 0x0040, 0x1d09: 0xb479, 0x1d0a: 0x0040, 0x1d0b: 0xb401, - 0x1d0c: 0x0040, 0x1d0d: 0xb431, 0x1d0e: 0xb2f9, 0x1d0f: 0xb389, 0x1d10: 0x0040, 0x1d11: 0xb329, - 0x1d12: 0xb3d1, 0x1d13: 0x0040, 0x1d14: 0xb311, 0x1d15: 0x0040, 0x1d16: 0x0040, 0x1d17: 0xb281, - 0x1d18: 0x0040, 0x1d19: 0xb341, 0x1d1a: 0x0040, 0x1d1b: 0xb3a1, 0x1d1c: 0x0040, 0x1d1d: 0x7999, - 0x1d1e: 0x0040, 0x1d1f: 0xbcd9, 0x1d20: 0x0040, 0x1d21: 0xb1f1, 0x1d22: 0xb251, 0x1d23: 0x0040, - 0x1d24: 0xb449, 0x1d25: 0x0040, 0x1d26: 0x0040, 0x1d27: 0xb269, 0x1d28: 0xb359, 0x1d29: 0xb479, - 0x1d2a: 0xb3e9, 0x1d2b: 0x0040, 0x1d2c: 0xb419, 0x1d2d: 0xb431, 0x1d2e: 0xb2f9, 0x1d2f: 0xb389, - 0x1d30: 0xb3b9, 0x1d31: 0xb329, 0x1d32: 0xb3d1, 0x1d33: 0x0040, 0x1d34: 0xb311, 0x1d35: 0xb221, - 0x1d36: 0xb239, 0x1d37: 0xb281, 0x1d38: 0x0040, 0x1d39: 0xb341, 0x1d3a: 0xb371, 0x1d3b: 0xb3a1, - 0x1d3c: 0xbca9, 0x1d3d: 0x0040, 0x1d3e: 0xbcc1, 0x1d3f: 0x0040, + 0x1d00: 0x0040, 0x1d01: 0x232a, 0x1d02: 0x2332, 0x1d03: 0x233a, 0x1d04: 0x2342, 0x1d05: 0x234a, + 0x1d06: 0x2352, 0x1d07: 0x235a, 0x1d08: 0x2362, 0x1d09: 0x236a, 0x1d0a: 0x2372, 0x1d0b: 0x0018, + 0x1d0c: 0x0018, 0x1d0d: 0x0018, 0x1d0e: 0x0018, 0x1d0f: 0x0018, 0x1d10: 0x237a, 0x1d11: 0x2382, + 0x1d12: 0x238a, 0x1d13: 0x2392, 0x1d14: 0x239a, 0x1d15: 0x23a2, 0x1d16: 0x23aa, 0x1d17: 0x23b2, + 0x1d18: 0x23ba, 0x1d19: 0x23c2, 0x1d1a: 0x23ca, 0x1d1b: 0x23d2, 0x1d1c: 0x23da, 0x1d1d: 0x23e2, + 0x1d1e: 0x23ea, 0x1d1f: 0x23f2, 0x1d20: 0x23fa, 0x1d21: 0x2402, 0x1d22: 0x240a, 0x1d23: 0x2412, + 0x1d24: 0x241a, 0x1d25: 0x2422, 0x1d26: 0x242a, 0x1d27: 0x2432, 0x1d28: 0x243a, 0x1d29: 0x2442, + 0x1d2a: 0x2449, 0x1d2b: 0x03d9, 0x1d2c: 0x00b9, 0x1d2d: 0x1239, 0x1d2e: 0x2451, 0x1d2f: 0x0018, + 0x1d30: 0x0019, 0x1d31: 0x02e9, 0x1d32: 0x03d9, 0x1d33: 0x02f1, 0x1d34: 0x02f9, 0x1d35: 0x03f1, + 0x1d36: 0x0309, 0x1d37: 0x00a9, 0x1d38: 0x0311, 0x1d39: 0x00b1, 0x1d3a: 0x0319, 0x1d3b: 0x0101, + 0x1d3c: 0x0321, 0x1d3d: 0x0329, 0x1d3e: 0x0051, 0x1d3f: 0x0339, // Block 0x75, offset 0x1d40 - 0x1d40: 0xb1d9, 0x1d41: 0xb1f1, 0x1d42: 0xb251, 0x1d43: 0xb299, 0x1d44: 0xb449, 0x1d45: 0xb461, - 0x1d46: 0xb2e1, 0x1d47: 0xb269, 0x1d48: 0xb359, 0x1d49: 0xb479, 0x1d4a: 0x0040, 0x1d4b: 0xb401, - 0x1d4c: 0xb419, 0x1d4d: 0xb431, 0x1d4e: 0xb2f9, 0x1d4f: 0xb389, 0x1d50: 0xb3b9, 0x1d51: 0xb329, - 0x1d52: 0xb3d1, 0x1d53: 0xb2c9, 0x1d54: 0xb311, 0x1d55: 0xb221, 0x1d56: 0xb239, 0x1d57: 0xb281, - 0x1d58: 0xb2b1, 0x1d59: 0xb341, 0x1d5a: 0xb371, 0x1d5b: 0xb3a1, 0x1d5c: 0x0040, 0x1d5d: 0x0040, - 0x1d5e: 0x0040, 0x1d5f: 0x0040, 0x1d60: 0x0040, 0x1d61: 0xb1f1, 0x1d62: 0xb251, 0x1d63: 0xb299, - 0x1d64: 0x0040, 0x1d65: 0xb461, 0x1d66: 0xb2e1, 0x1d67: 0xb269, 0x1d68: 0xb359, 0x1d69: 0xb479, - 0x1d6a: 0x0040, 0x1d6b: 0xb401, 0x1d6c: 0xb419, 0x1d6d: 0xb431, 0x1d6e: 0xb2f9, 0x1d6f: 0xb389, - 0x1d70: 0xb3b9, 0x1d71: 0xb329, 0x1d72: 0xb3d1, 0x1d73: 0xb2c9, 0x1d74: 0xb311, 0x1d75: 0xb221, - 0x1d76: 0xb239, 0x1d77: 0xb281, 0x1d78: 0xb2b1, 0x1d79: 0xb341, 0x1d7a: 0xb371, 0x1d7b: 0xb3a1, - 0x1d7c: 0x0040, 0x1d7d: 0x0040, 0x1d7e: 0x0040, 0x1d7f: 0x0040, + 0x1d40: 0x0751, 0x1d41: 0x00b9, 0x1d42: 0x0089, 0x1d43: 0x0341, 0x1d44: 0x0349, 0x1d45: 0x0391, + 0x1d46: 0x00c1, 0x1d47: 0x0109, 0x1d48: 0x00c9, 0x1d49: 0x04b1, 0x1d4a: 0x2459, 0x1d4b: 0x11f9, + 0x1d4c: 0x2461, 0x1d4d: 0x04d9, 0x1d4e: 0x2469, 0x1d4f: 0x2471, 0x1d50: 0x0018, 0x1d51: 0x0018, + 0x1d52: 0x0018, 0x1d53: 0x0018, 0x1d54: 0x0018, 0x1d55: 0x0018, 0x1d56: 0x0018, 0x1d57: 0x0018, + 0x1d58: 0x0018, 0x1d59: 0x0018, 0x1d5a: 0x0018, 0x1d5b: 0x0018, 0x1d5c: 0x0018, 0x1d5d: 0x0018, + 0x1d5e: 0x0018, 0x1d5f: 0x0018, 0x1d60: 0x0018, 0x1d61: 0x0018, 0x1d62: 0x0018, 0x1d63: 0x0018, + 0x1d64: 0x0018, 0x1d65: 0x0018, 0x1d66: 0x0018, 0x1d67: 0x0018, 0x1d68: 0x0018, 0x1d69: 0x0018, + 0x1d6a: 0x2479, 0x1d6b: 0x2481, 0x1d6c: 0x2489, 0x1d6d: 0x0018, 0x1d6e: 0x0018, 0x1d6f: 0x0018, + 0x1d70: 0x0018, 0x1d71: 0x0018, 0x1d72: 0x0018, 0x1d73: 0x0018, 0x1d74: 0x0018, 0x1d75: 0x0018, + 0x1d76: 0x0018, 0x1d77: 0x0018, 0x1d78: 0x0018, 0x1d79: 0x0018, 0x1d7a: 0x0018, 0x1d7b: 0x0018, + 0x1d7c: 0x0018, 0x1d7d: 0x0018, 0x1d7e: 0x0018, 0x1d7f: 0x0018, // Block 0x76, offset 0x1d80 - 0x1d80: 0x0040, 0x1d81: 0xbcf2, 0x1d82: 0xbd0a, 0x1d83: 0xbd22, 0x1d84: 0xbd3a, 0x1d85: 0xbd52, - 0x1d86: 0xbd6a, 0x1d87: 0xbd82, 0x1d88: 0xbd9a, 0x1d89: 0xbdb2, 0x1d8a: 0xbdca, 0x1d8b: 0x0018, - 0x1d8c: 0x0018, 0x1d8d: 0x0018, 0x1d8e: 0x0018, 0x1d8f: 0x0018, 0x1d90: 0xbde2, 0x1d91: 0xbe02, - 0x1d92: 0xbe22, 0x1d93: 0xbe42, 0x1d94: 0xbe62, 0x1d95: 0xbe82, 0x1d96: 0xbea2, 0x1d97: 0xbec2, - 0x1d98: 0xbee2, 0x1d99: 0xbf02, 0x1d9a: 0xbf22, 0x1d9b: 0xbf42, 0x1d9c: 0xbf62, 0x1d9d: 0xbf82, - 0x1d9e: 0xbfa2, 0x1d9f: 0xbfc2, 0x1da0: 0xbfe2, 0x1da1: 0xc002, 0x1da2: 0xc022, 0x1da3: 0xc042, - 0x1da4: 0xc062, 0x1da5: 0xc082, 0x1da6: 0xc0a2, 0x1da7: 0xc0c2, 0x1da8: 0xc0e2, 0x1da9: 0xc102, - 0x1daa: 0xc121, 0x1dab: 0x1159, 0x1dac: 0x0269, 0x1dad: 0x66a9, 0x1dae: 0xc161, 0x1daf: 0x0018, - 0x1db0: 0x0039, 0x1db1: 0x0ee9, 0x1db2: 0x1159, 0x1db3: 0x0ef9, 0x1db4: 0x0f09, 0x1db5: 0x1199, - 0x1db6: 0x0f31, 0x1db7: 0x0249, 0x1db8: 0x0f41, 0x1db9: 0x0259, 0x1dba: 0x0f51, 0x1dbb: 0x0359, - 0x1dbc: 0x0f61, 0x1dbd: 0x0f71, 0x1dbe: 0x00d9, 0x1dbf: 0x0f99, + 0x1d80: 0x2499, 0x1d81: 0x24a1, 0x1d82: 0x24a9, 0x1d83: 0x0040, 0x1d84: 0x0040, 0x1d85: 0x0040, + 0x1d86: 0x0040, 0x1d87: 0x0040, 0x1d88: 0x0040, 0x1d89: 0x0040, 0x1d8a: 0x0040, 0x1d8b: 0x0040, + 0x1d8c: 0x0040, 0x1d8d: 0x0040, 0x1d8e: 0x0040, 0x1d8f: 0x0040, 0x1d90: 0x24b1, 0x1d91: 0x24b9, + 0x1d92: 0x24c1, 0x1d93: 0x24c9, 0x1d94: 0x24d1, 0x1d95: 0x24d9, 0x1d96: 0x24e1, 0x1d97: 0x24e9, + 0x1d98: 0x24f1, 0x1d99: 0x24f9, 0x1d9a: 0x2501, 0x1d9b: 0x2509, 0x1d9c: 0x2511, 0x1d9d: 0x2519, + 0x1d9e: 0x2521, 0x1d9f: 0x2529, 0x1da0: 0x2531, 0x1da1: 0x2539, 0x1da2: 0x2541, 0x1da3: 0x2549, + 0x1da4: 0x2551, 0x1da5: 0x2559, 0x1da6: 0x2561, 0x1da7: 0x2569, 0x1da8: 0x2571, 0x1da9: 0x2579, + 0x1daa: 0x2581, 0x1dab: 0x2589, 0x1dac: 0x2591, 0x1dad: 0x2599, 0x1dae: 0x25a1, 0x1daf: 0x25a9, + 0x1db0: 0x25b1, 0x1db1: 0x25b9, 0x1db2: 0x25c1, 0x1db3: 0x25c9, 0x1db4: 0x25d1, 0x1db5: 0x25d9, + 0x1db6: 0x25e1, 0x1db7: 0x25e9, 0x1db8: 0x25f1, 0x1db9: 0x25f9, 0x1dba: 0x2601, 0x1dbb: 0x2609, + 0x1dbc: 0x0040, 0x1dbd: 0x0040, 0x1dbe: 0x0040, 0x1dbf: 0x0040, // Block 0x77, offset 0x1dc0 - 0x1dc0: 0x2039, 0x1dc1: 0x0269, 0x1dc2: 0x01d9, 0x1dc3: 0x0fa9, 0x1dc4: 0x0fb9, 0x1dc5: 0x1089, - 0x1dc6: 0x0279, 0x1dc7: 0x0369, 0x1dc8: 0x0289, 0x1dc9: 0x13d1, 0x1dca: 0xc179, 0x1dcb: 0x65e9, - 0x1dcc: 0xc191, 0x1dcd: 0x1441, 0x1dce: 0xc1a9, 0x1dcf: 0xc1c9, 0x1dd0: 0x0018, 0x1dd1: 0x0018, - 0x1dd2: 0x0018, 0x1dd3: 0x0018, 0x1dd4: 0x0018, 0x1dd5: 0x0018, 0x1dd6: 0x0018, 0x1dd7: 0x0018, - 0x1dd8: 0x0018, 0x1dd9: 0x0018, 0x1dda: 0x0018, 0x1ddb: 0x0018, 0x1ddc: 0x0018, 0x1ddd: 0x0018, - 0x1dde: 0x0018, 0x1ddf: 0x0018, 0x1de0: 0x0018, 0x1de1: 0x0018, 0x1de2: 0x0018, 0x1de3: 0x0018, - 0x1de4: 0x0018, 0x1de5: 0x0018, 0x1de6: 0x0018, 0x1de7: 0x0018, 0x1de8: 0x0018, 0x1de9: 0x0018, - 0x1dea: 0xc1e1, 0x1deb: 0xc1f9, 0x1dec: 0xc211, 0x1ded: 0x0018, 0x1dee: 0x0018, 0x1def: 0x0018, - 0x1df0: 0x0018, 0x1df1: 0x0018, 0x1df2: 0x0018, 0x1df3: 0x0018, 0x1df4: 0x0018, 0x1df5: 0x0018, - 0x1df6: 0x0018, 0x1df7: 0x0018, 0x1df8: 0x0018, 0x1df9: 0x0018, 0x1dfa: 0x0018, 0x1dfb: 0x0018, - 0x1dfc: 0x0018, 0x1dfd: 0x0018, 0x1dfe: 0x0018, 0x1dff: 0x0018, + 0x1dc0: 0x2669, 0x1dc1: 0x2671, 0x1dc2: 0x2679, 0x1dc3: 0x8b55, 0x1dc4: 0x2681, 0x1dc5: 0x2689, + 0x1dc6: 0x2691, 0x1dc7: 0x2699, 0x1dc8: 0x26a1, 0x1dc9: 0x26a9, 0x1dca: 0x26b1, 0x1dcb: 0x26b9, + 0x1dcc: 0x26c1, 0x1dcd: 0x8b75, 0x1dce: 0x26c9, 0x1dcf: 0x26d1, 0x1dd0: 0x26d9, 0x1dd1: 0x26e1, + 0x1dd2: 0x8b95, 0x1dd3: 0x26e9, 0x1dd4: 0x26f1, 0x1dd5: 0x2521, 0x1dd6: 0x8bb5, 0x1dd7: 0x26f9, + 0x1dd8: 0x2701, 0x1dd9: 0x2709, 0x1dda: 0x2711, 0x1ddb: 0x2719, 0x1ddc: 0x8bd5, 0x1ddd: 0x2721, + 0x1dde: 0x2729, 0x1ddf: 0x2731, 0x1de0: 0x2739, 0x1de1: 0x2741, 0x1de2: 0x25f9, 0x1de3: 0x2749, + 0x1de4: 0x2751, 0x1de5: 0x2759, 0x1de6: 0x2761, 0x1de7: 0x2769, 0x1de8: 0x2771, 0x1de9: 0x2779, + 0x1dea: 0x2781, 0x1deb: 0x2789, 0x1dec: 0x2791, 0x1ded: 0x2799, 0x1dee: 0x27a1, 0x1def: 0x27a9, + 0x1df0: 0x27b1, 0x1df1: 0x27b9, 0x1df2: 0x27b9, 0x1df3: 0x27b9, 0x1df4: 0x8bf5, 0x1df5: 0x27c1, + 0x1df6: 0x27c9, 0x1df7: 0x27d1, 0x1df8: 0x8c15, 0x1df9: 0x27d9, 0x1dfa: 0x27e1, 0x1dfb: 0x27e9, + 0x1dfc: 0x27f1, 0x1dfd: 0x27f9, 0x1dfe: 0x2801, 0x1dff: 0x2809, // Block 0x78, offset 0x1e00 - 0x1e00: 0xc241, 0x1e01: 0xc279, 0x1e02: 0xc2b1, 0x1e03: 0x0040, 0x1e04: 0x0040, 0x1e05: 0x0040, - 0x1e06: 0x0040, 0x1e07: 0x0040, 0x1e08: 0x0040, 0x1e09: 0x0040, 0x1e0a: 0x0040, 0x1e0b: 0x0040, - 0x1e0c: 0x0040, 0x1e0d: 0x0040, 0x1e0e: 0x0040, 0x1e0f: 0x0040, 0x1e10: 0xc2d1, 0x1e11: 0xc2f1, - 0x1e12: 0xc311, 0x1e13: 0xc331, 0x1e14: 0xc351, 0x1e15: 0xc371, 0x1e16: 0xc391, 0x1e17: 0xc3b1, - 0x1e18: 0xc3d1, 0x1e19: 0xc3f1, 0x1e1a: 0xc411, 0x1e1b: 0xc431, 0x1e1c: 0xc451, 0x1e1d: 0xc471, - 0x1e1e: 0xc491, 0x1e1f: 0xc4b1, 0x1e20: 0xc4d1, 0x1e21: 0xc4f1, 0x1e22: 0xc511, 0x1e23: 0xc531, - 0x1e24: 0xc551, 0x1e25: 0xc571, 0x1e26: 0xc591, 0x1e27: 0xc5b1, 0x1e28: 0xc5d1, 0x1e29: 0xc5f1, - 0x1e2a: 0xc611, 0x1e2b: 0xc631, 0x1e2c: 0xc651, 0x1e2d: 0xc671, 0x1e2e: 0xc691, 0x1e2f: 0xc6b1, - 0x1e30: 0xc6d1, 0x1e31: 0xc6f1, 0x1e32: 0xc711, 0x1e33: 0xc731, 0x1e34: 0xc751, 0x1e35: 0xc771, - 0x1e36: 0xc791, 0x1e37: 0xc7b1, 0x1e38: 0xc7d1, 0x1e39: 0xc7f1, 0x1e3a: 0xc811, 0x1e3b: 0xc831, - 0x1e3c: 0x0040, 0x1e3d: 0x0040, 0x1e3e: 0x0040, 0x1e3f: 0x0040, + 0x1e00: 0x2811, 0x1e01: 0x2819, 0x1e02: 0x2821, 0x1e03: 0x2829, 0x1e04: 0x2831, 0x1e05: 0x2839, + 0x1e06: 0x2839, 0x1e07: 0x2841, 0x1e08: 0x2849, 0x1e09: 0x2851, 0x1e0a: 0x2859, 0x1e0b: 0x2861, + 0x1e0c: 0x2869, 0x1e0d: 0x2871, 0x1e0e: 0x2879, 0x1e0f: 0x2881, 0x1e10: 0x2889, 0x1e11: 0x2891, + 0x1e12: 0x2899, 0x1e13: 0x28a1, 0x1e14: 0x28a9, 0x1e15: 0x28b1, 0x1e16: 0x28b9, 0x1e17: 0x28c1, + 0x1e18: 0x28c9, 0x1e19: 0x8c35, 0x1e1a: 0x28d1, 0x1e1b: 0x28d9, 0x1e1c: 0x28e1, 0x1e1d: 0x24d9, + 0x1e1e: 0x28e9, 0x1e1f: 0x28f1, 0x1e20: 0x8c55, 0x1e21: 0x8c75, 0x1e22: 0x28f9, 0x1e23: 0x2901, + 0x1e24: 0x2909, 0x1e25: 0x2911, 0x1e26: 0x2919, 0x1e27: 0x2921, 0x1e28: 0x2040, 0x1e29: 0x2929, + 0x1e2a: 0x2931, 0x1e2b: 0x2931, 0x1e2c: 0x8c95, 0x1e2d: 0x2939, 0x1e2e: 0x2941, 0x1e2f: 0x2949, + 0x1e30: 0x2951, 0x1e31: 0x8cb5, 0x1e32: 0x2959, 0x1e33: 0x2961, 0x1e34: 0x2040, 0x1e35: 0x2969, + 0x1e36: 0x2971, 0x1e37: 0x2979, 0x1e38: 0x2981, 0x1e39: 0x2989, 0x1e3a: 0x2991, 0x1e3b: 0x8cd5, + 0x1e3c: 0x2999, 0x1e3d: 0x8cf5, 0x1e3e: 0x29a1, 0x1e3f: 0x29a9, // Block 0x79, offset 0x1e40 - 0x1e40: 0xcb61, 0x1e41: 0xcb81, 0x1e42: 0xcba1, 0x1e43: 0x8b55, 0x1e44: 0xcbc1, 0x1e45: 0xcbe1, - 0x1e46: 0xcc01, 0x1e47: 0xcc21, 0x1e48: 0xcc41, 0x1e49: 0xcc61, 0x1e4a: 0xcc81, 0x1e4b: 0xcca1, - 0x1e4c: 0xccc1, 0x1e4d: 0x8b75, 0x1e4e: 0xcce1, 0x1e4f: 0xcd01, 0x1e50: 0xcd21, 0x1e51: 0xcd41, - 0x1e52: 0x8b95, 0x1e53: 0xcd61, 0x1e54: 0xcd81, 0x1e55: 0xc491, 0x1e56: 0x8bb5, 0x1e57: 0xcda1, - 0x1e58: 0xcdc1, 0x1e59: 0xcde1, 0x1e5a: 0xce01, 0x1e5b: 0xce21, 0x1e5c: 0x8bd5, 0x1e5d: 0xce41, - 0x1e5e: 0xce61, 0x1e5f: 0xce81, 0x1e60: 0xcea1, 0x1e61: 0xcec1, 0x1e62: 0xc7f1, 0x1e63: 0xcee1, - 0x1e64: 0xcf01, 0x1e65: 0xcf21, 0x1e66: 0xcf41, 0x1e67: 0xcf61, 0x1e68: 0xcf81, 0x1e69: 0xcfa1, - 0x1e6a: 0xcfc1, 0x1e6b: 0xcfe1, 0x1e6c: 0xd001, 0x1e6d: 0xd021, 0x1e6e: 0xd041, 0x1e6f: 0xd061, - 0x1e70: 0xd081, 0x1e71: 0xd0a1, 0x1e72: 0xd0a1, 0x1e73: 0xd0a1, 0x1e74: 0x8bf5, 0x1e75: 0xd0c1, - 0x1e76: 0xd0e1, 0x1e77: 0xd101, 0x1e78: 0x8c15, 0x1e79: 0xd121, 0x1e7a: 0xd141, 0x1e7b: 0xd161, - 0x1e7c: 0xd181, 0x1e7d: 0xd1a1, 0x1e7e: 0xd1c1, 0x1e7f: 0xd1e1, + 0x1e40: 0x29b1, 0x1e41: 0x29b9, 0x1e42: 0x29c1, 0x1e43: 0x29c9, 0x1e44: 0x29d1, 0x1e45: 0x29d9, + 0x1e46: 0x29e1, 0x1e47: 0x29e9, 0x1e48: 0x29f1, 0x1e49: 0x8d15, 0x1e4a: 0x29f9, 0x1e4b: 0x2a01, + 0x1e4c: 0x2a09, 0x1e4d: 0x2a11, 0x1e4e: 0x2a19, 0x1e4f: 0x8d35, 0x1e50: 0x2a21, 0x1e51: 0x8d55, + 0x1e52: 0x8d75, 0x1e53: 0x2a29, 0x1e54: 0x2a31, 0x1e55: 0x2a31, 0x1e56: 0x2a39, 0x1e57: 0x8d95, + 0x1e58: 0x8db5, 0x1e59: 0x2a41, 0x1e5a: 0x2a49, 0x1e5b: 0x2a51, 0x1e5c: 0x2a59, 0x1e5d: 0x2a61, + 0x1e5e: 0x2a69, 0x1e5f: 0x2a71, 0x1e60: 0x2a79, 0x1e61: 0x2a81, 0x1e62: 0x2a89, 0x1e63: 0x2a91, + 0x1e64: 0x8dd5, 0x1e65: 0x2a99, 0x1e66: 0x2aa1, 0x1e67: 0x2aa9, 0x1e68: 0x2ab1, 0x1e69: 0x2aa9, + 0x1e6a: 0x2ab9, 0x1e6b: 0x2ac1, 0x1e6c: 0x2ac9, 0x1e6d: 0x2ad1, 0x1e6e: 0x2ad9, 0x1e6f: 0x2ae1, + 0x1e70: 0x2ae9, 0x1e71: 0x2af1, 0x1e72: 0x2af9, 0x1e73: 0x2b01, 0x1e74: 0x2b09, 0x1e75: 0x2b11, + 0x1e76: 0x2b19, 0x1e77: 0x2b21, 0x1e78: 0x8df5, 0x1e79: 0x2b29, 0x1e7a: 0x2b31, 0x1e7b: 0x2b39, + 0x1e7c: 0x2b41, 0x1e7d: 0x2b49, 0x1e7e: 0x8e15, 0x1e7f: 0x2b51, // Block 0x7a, offset 0x1e80 - 0x1e80: 0xd201, 0x1e81: 0xd221, 0x1e82: 0xd241, 0x1e83: 0xd261, 0x1e84: 0xd281, 0x1e85: 0xd2a1, - 0x1e86: 0xd2a1, 0x1e87: 0xd2c1, 0x1e88: 0xd2e1, 0x1e89: 0xd301, 0x1e8a: 0xd321, 0x1e8b: 0xd341, - 0x1e8c: 0xd361, 0x1e8d: 0xd381, 0x1e8e: 0xd3a1, 0x1e8f: 0xd3c1, 0x1e90: 0xd3e1, 0x1e91: 0xd401, - 0x1e92: 0xd421, 0x1e93: 0xd441, 0x1e94: 0xd461, 0x1e95: 0xd481, 0x1e96: 0xd4a1, 0x1e97: 0xd4c1, - 0x1e98: 0xd4e1, 0x1e99: 0x8c35, 0x1e9a: 0xd501, 0x1e9b: 0xd521, 0x1e9c: 0xd541, 0x1e9d: 0xc371, - 0x1e9e: 0xd561, 0x1e9f: 0xd581, 0x1ea0: 0x8c55, 0x1ea1: 0x8c75, 0x1ea2: 0xd5a1, 0x1ea3: 0xd5c1, - 0x1ea4: 0xd5e1, 0x1ea5: 0xd601, 0x1ea6: 0xd621, 0x1ea7: 0xd641, 0x1ea8: 0x2040, 0x1ea9: 0xd661, - 0x1eaa: 0xd681, 0x1eab: 0xd681, 0x1eac: 0x8c95, 0x1ead: 0xd6a1, 0x1eae: 0xd6c1, 0x1eaf: 0xd6e1, - 0x1eb0: 0xd701, 0x1eb1: 0x8cb5, 0x1eb2: 0xd721, 0x1eb3: 0xd741, 0x1eb4: 0x2040, 0x1eb5: 0xd761, - 0x1eb6: 0xd781, 0x1eb7: 0xd7a1, 0x1eb8: 0xd7c1, 0x1eb9: 0xd7e1, 0x1eba: 0xd801, 0x1ebb: 0x8cd5, - 0x1ebc: 0xd821, 0x1ebd: 0x8cf5, 0x1ebe: 0xd841, 0x1ebf: 0xd861, + 0x1e80: 0x2b59, 0x1e81: 0x2b61, 0x1e82: 0x2b69, 0x1e83: 0x2b71, 0x1e84: 0x2b79, 0x1e85: 0x2b81, + 0x1e86: 0x2b89, 0x1e87: 0x2b91, 0x1e88: 0x2b99, 0x1e89: 0x2ba1, 0x1e8a: 0x8e35, 0x1e8b: 0x2ba9, + 0x1e8c: 0x2bb1, 0x1e8d: 0x2bb9, 0x1e8e: 0x2bc1, 0x1e8f: 0x2bc9, 0x1e90: 0x2bd1, 0x1e91: 0x2bd9, + 0x1e92: 0x2be1, 0x1e93: 0x2be9, 0x1e94: 0x2bf1, 0x1e95: 0x2bf9, 0x1e96: 0x2c01, 0x1e97: 0x2c09, + 0x1e98: 0x2c11, 0x1e99: 0x2c19, 0x1e9a: 0x2c21, 0x1e9b: 0x2c29, 0x1e9c: 0x2c31, 0x1e9d: 0x8e55, + 0x1e9e: 0x2c39, 0x1e9f: 0x2c41, 0x1ea0: 0x2c49, 0x1ea1: 0x2c51, 0x1ea2: 0x2c59, 0x1ea3: 0x8e75, + 0x1ea4: 0x2c61, 0x1ea5: 0x2c69, 0x1ea6: 0x2c71, 0x1ea7: 0x2c79, 0x1ea8: 0x2c81, 0x1ea9: 0x2c89, + 0x1eaa: 0x2c91, 0x1eab: 0x2c99, 0x1eac: 0x7f0d, 0x1ead: 0x2ca1, 0x1eae: 0x2ca9, 0x1eaf: 0x2cb1, + 0x1eb0: 0x8e95, 0x1eb1: 0x2cb9, 0x1eb2: 0x2cc1, 0x1eb3: 0x2cc9, 0x1eb4: 0x2cd1, 0x1eb5: 0x2cd9, + 0x1eb6: 0x2ce1, 0x1eb7: 0x8eb5, 0x1eb8: 0x8ed5, 0x1eb9: 0x8ef5, 0x1eba: 0x2ce9, 0x1ebb: 0x8f15, + 0x1ebc: 0x2cf1, 0x1ebd: 0x2cf9, 0x1ebe: 0x2d01, 0x1ebf: 0x2d09, // Block 0x7b, offset 0x1ec0 - 0x1ec0: 0xd881, 0x1ec1: 0xd8a1, 0x1ec2: 0xd8c1, 0x1ec3: 0xd8e1, 0x1ec4: 0xd901, 0x1ec5: 0xd921, - 0x1ec6: 0xd941, 0x1ec7: 0xd961, 0x1ec8: 0xd981, 0x1ec9: 0x8d15, 0x1eca: 0xd9a1, 0x1ecb: 0xd9c1, - 0x1ecc: 0xd9e1, 0x1ecd: 0xda01, 0x1ece: 0xda21, 0x1ecf: 0x8d35, 0x1ed0: 0xda41, 0x1ed1: 0x8d55, - 0x1ed2: 0x8d75, 0x1ed3: 0xda61, 0x1ed4: 0xda81, 0x1ed5: 0xda81, 0x1ed6: 0xdaa1, 0x1ed7: 0x8d95, - 0x1ed8: 0x8db5, 0x1ed9: 0xdac1, 0x1eda: 0xdae1, 0x1edb: 0xdb01, 0x1edc: 0xdb21, 0x1edd: 0xdb41, - 0x1ede: 0xdb61, 0x1edf: 0xdb81, 0x1ee0: 0xdba1, 0x1ee1: 0xdbc1, 0x1ee2: 0xdbe1, 0x1ee3: 0xdc01, - 0x1ee4: 0x8dd5, 0x1ee5: 0xdc21, 0x1ee6: 0xdc41, 0x1ee7: 0xdc61, 0x1ee8: 0xdc81, 0x1ee9: 0xdc61, - 0x1eea: 0xdca1, 0x1eeb: 0xdcc1, 0x1eec: 0xdce1, 0x1eed: 0xdd01, 0x1eee: 0xdd21, 0x1eef: 0xdd41, - 0x1ef0: 0xdd61, 0x1ef1: 0xdd81, 0x1ef2: 0xdda1, 0x1ef3: 0xddc1, 0x1ef4: 0xdde1, 0x1ef5: 0xde01, - 0x1ef6: 0xde21, 0x1ef7: 0xde41, 0x1ef8: 0x8df5, 0x1ef9: 0xde61, 0x1efa: 0xde81, 0x1efb: 0xdea1, - 0x1efc: 0xdec1, 0x1efd: 0xdee1, 0x1efe: 0x8e15, 0x1eff: 0xdf01, + 0x1ec0: 0x2d11, 0x1ec1: 0x2d19, 0x1ec2: 0x2d21, 0x1ec3: 0x2d29, 0x1ec4: 0x2d31, 0x1ec5: 0x2d39, + 0x1ec6: 0x8f35, 0x1ec7: 0x2d41, 0x1ec8: 0x2d49, 0x1ec9: 0x2d51, 0x1eca: 0x2d59, 0x1ecb: 0x2d61, + 0x1ecc: 0x2d69, 0x1ecd: 0x8f55, 0x1ece: 0x2d71, 0x1ecf: 0x2d79, 0x1ed0: 0x8f75, 0x1ed1: 0x8f95, + 0x1ed2: 0x2d81, 0x1ed3: 0x2d89, 0x1ed4: 0x2d91, 0x1ed5: 0x2d99, 0x1ed6: 0x2da1, 0x1ed7: 0x2da9, + 0x1ed8: 0x2db1, 0x1ed9: 0x2db9, 0x1eda: 0x2dc1, 0x1edb: 0x8fb5, 0x1edc: 0x2dc9, 0x1edd: 0x8fd5, + 0x1ede: 0x2dd1, 0x1edf: 0x2040, 0x1ee0: 0x2dd9, 0x1ee1: 0x2de1, 0x1ee2: 0x2de9, 0x1ee3: 0x8ff5, + 0x1ee4: 0x2df1, 0x1ee5: 0x2df9, 0x1ee6: 0x9015, 0x1ee7: 0x9035, 0x1ee8: 0x2e01, 0x1ee9: 0x2e09, + 0x1eea: 0x2e11, 0x1eeb: 0x2e19, 0x1eec: 0x2e21, 0x1eed: 0x2e21, 0x1eee: 0x2e29, 0x1eef: 0x2e31, + 0x1ef0: 0x2e39, 0x1ef1: 0x2e41, 0x1ef2: 0x2e49, 0x1ef3: 0x2e51, 0x1ef4: 0x2e59, 0x1ef5: 0x9055, + 0x1ef6: 0x2e61, 0x1ef7: 0x9075, 0x1ef8: 0x2e69, 0x1ef9: 0x9095, 0x1efa: 0x2e71, 0x1efb: 0x90b5, + 0x1efc: 0x90d5, 0x1efd: 0x90f5, 0x1efe: 0x2e79, 0x1eff: 0x2e81, // Block 0x7c, offset 0x1f00 - 0x1f00: 0xe601, 0x1f01: 0xe621, 0x1f02: 0xe641, 0x1f03: 0xe661, 0x1f04: 0xe681, 0x1f05: 0xe6a1, - 0x1f06: 0x8f35, 0x1f07: 0xe6c1, 0x1f08: 0xe6e1, 0x1f09: 0xe701, 0x1f0a: 0xe721, 0x1f0b: 0xe741, - 0x1f0c: 0xe761, 0x1f0d: 0x8f55, 0x1f0e: 0xe781, 0x1f0f: 0xe7a1, 0x1f10: 0x8f75, 0x1f11: 0x8f95, - 0x1f12: 0xe7c1, 0x1f13: 0xe7e1, 0x1f14: 0xe801, 0x1f15: 0xe821, 0x1f16: 0xe841, 0x1f17: 0xe861, - 0x1f18: 0xe881, 0x1f19: 0xe8a1, 0x1f1a: 0xe8c1, 0x1f1b: 0x8fb5, 0x1f1c: 0xe8e1, 0x1f1d: 0x8fd5, - 0x1f1e: 0xe901, 0x1f1f: 0x2040, 0x1f20: 0xe921, 0x1f21: 0xe941, 0x1f22: 0xe961, 0x1f23: 0x8ff5, - 0x1f24: 0xe981, 0x1f25: 0xe9a1, 0x1f26: 0x9015, 0x1f27: 0x9035, 0x1f28: 0xe9c1, 0x1f29: 0xe9e1, - 0x1f2a: 0xea01, 0x1f2b: 0xea21, 0x1f2c: 0xea41, 0x1f2d: 0xea41, 0x1f2e: 0xea61, 0x1f2f: 0xea81, - 0x1f30: 0xeaa1, 0x1f31: 0xeac1, 0x1f32: 0xeae1, 0x1f33: 0xeb01, 0x1f34: 0xeb21, 0x1f35: 0x9055, - 0x1f36: 0xeb41, 0x1f37: 0x9075, 0x1f38: 0xeb61, 0x1f39: 0x9095, 0x1f3a: 0xeb81, 0x1f3b: 0x90b5, - 0x1f3c: 0x90d5, 0x1f3d: 0x90f5, 0x1f3e: 0xeba1, 0x1f3f: 0xebc1, + 0x1f00: 0x2e89, 0x1f01: 0x9115, 0x1f02: 0x9135, 0x1f03: 0x9155, 0x1f04: 0x9175, 0x1f05: 0x2e91, + 0x1f06: 0x2e99, 0x1f07: 0x2e99, 0x1f08: 0x2ea1, 0x1f09: 0x2ea9, 0x1f0a: 0x2eb1, 0x1f0b: 0x2eb9, + 0x1f0c: 0x2ec1, 0x1f0d: 0x9195, 0x1f0e: 0x2ec9, 0x1f0f: 0x2ed1, 0x1f10: 0x2ed9, 0x1f11: 0x2ee1, + 0x1f12: 0x91b5, 0x1f13: 0x2ee9, 0x1f14: 0x91d5, 0x1f15: 0x91f5, 0x1f16: 0x2ef1, 0x1f17: 0x2ef9, + 0x1f18: 0x2f01, 0x1f19: 0x2f09, 0x1f1a: 0x2f11, 0x1f1b: 0x2f19, 0x1f1c: 0x9215, 0x1f1d: 0x9235, + 0x1f1e: 0x9255, 0x1f1f: 0x2040, 0x1f20: 0x2f21, 0x1f21: 0x9275, 0x1f22: 0x2f29, 0x1f23: 0x2f31, + 0x1f24: 0x2f39, 0x1f25: 0x9295, 0x1f26: 0x2f41, 0x1f27: 0x2f49, 0x1f28: 0x2f51, 0x1f29: 0x2f59, + 0x1f2a: 0x2f61, 0x1f2b: 0x92b5, 0x1f2c: 0x2f69, 0x1f2d: 0x2f71, 0x1f2e: 0x2f79, 0x1f2f: 0x2f81, + 0x1f30: 0x2f89, 0x1f31: 0x2f91, 0x1f32: 0x92d5, 0x1f33: 0x92f5, 0x1f34: 0x2f99, 0x1f35: 0x9315, + 0x1f36: 0x2fa1, 0x1f37: 0x9335, 0x1f38: 0x2fa9, 0x1f39: 0x2fb1, 0x1f3a: 0x2fb9, 0x1f3b: 0x9355, + 0x1f3c: 0x9375, 0x1f3d: 0x2fc1, 0x1f3e: 0x9395, 0x1f3f: 0x2fc9, // Block 0x7d, offset 0x1f40 - 0x1f40: 0xebe1, 0x1f41: 0x9115, 0x1f42: 0x9135, 0x1f43: 0x9155, 0x1f44: 0x9175, 0x1f45: 0xec01, - 0x1f46: 0xec21, 0x1f47: 0xec21, 0x1f48: 0xec41, 0x1f49: 0xec61, 0x1f4a: 0xec81, 0x1f4b: 0xeca1, - 0x1f4c: 0xecc1, 0x1f4d: 0x9195, 0x1f4e: 0xece1, 0x1f4f: 0xed01, 0x1f50: 0xed21, 0x1f51: 0xed41, - 0x1f52: 0x91b5, 0x1f53: 0xed61, 0x1f54: 0x91d5, 0x1f55: 0x91f5, 0x1f56: 0xed81, 0x1f57: 0xeda1, - 0x1f58: 0xedc1, 0x1f59: 0xede1, 0x1f5a: 0xee01, 0x1f5b: 0xee21, 0x1f5c: 0x9215, 0x1f5d: 0x9235, - 0x1f5e: 0x9255, 0x1f5f: 0x2040, 0x1f60: 0xee41, 0x1f61: 0x9275, 0x1f62: 0xee61, 0x1f63: 0xee81, - 0x1f64: 0xeea1, 0x1f65: 0x9295, 0x1f66: 0xeec1, 0x1f67: 0xeee1, 0x1f68: 0xef01, 0x1f69: 0xef21, - 0x1f6a: 0xef41, 0x1f6b: 0x92b5, 0x1f6c: 0xef61, 0x1f6d: 0xef81, 0x1f6e: 0xefa1, 0x1f6f: 0xefc1, - 0x1f70: 0xefe1, 0x1f71: 0xf001, 0x1f72: 0x92d5, 0x1f73: 0x92f5, 0x1f74: 0xf021, 0x1f75: 0x9315, - 0x1f76: 0xf041, 0x1f77: 0x9335, 0x1f78: 0xf061, 0x1f79: 0xf081, 0x1f7a: 0xf0a1, 0x1f7b: 0x9355, - 0x1f7c: 0x9375, 0x1f7d: 0xf0c1, 0x1f7e: 0x9395, 0x1f7f: 0xf0e1, + 0x1f40: 0x93b5, 0x1f41: 0x2fd1, 0x1f42: 0x2fd9, 0x1f43: 0x2fe1, 0x1f44: 0x2fe9, 0x1f45: 0x2ff1, + 0x1f46: 0x2ff9, 0x1f47: 0x93d5, 0x1f48: 0x93f5, 0x1f49: 0x9415, 0x1f4a: 0x9435, 0x1f4b: 0x2a29, + 0x1f4c: 0x3001, 0x1f4d: 0x3009, 0x1f4e: 0x3011, 0x1f4f: 0x3019, 0x1f50: 0x3021, 0x1f51: 0x3029, + 0x1f52: 0x3031, 0x1f53: 0x3039, 0x1f54: 0x3041, 0x1f55: 0x3049, 0x1f56: 0x3051, 0x1f57: 0x9455, + 0x1f58: 0x3059, 0x1f59: 0x3061, 0x1f5a: 0x3069, 0x1f5b: 0x3071, 0x1f5c: 0x3079, 0x1f5d: 0x3081, + 0x1f5e: 0x3089, 0x1f5f: 0x3091, 0x1f60: 0x3099, 0x1f61: 0x30a1, 0x1f62: 0x30a9, 0x1f63: 0x30b1, + 0x1f64: 0x9475, 0x1f65: 0x9495, 0x1f66: 0x94b5, 0x1f67: 0x30b9, 0x1f68: 0x30c1, 0x1f69: 0x30c9, + 0x1f6a: 0x30d1, 0x1f6b: 0x94d5, 0x1f6c: 0x30d9, 0x1f6d: 0x94f5, 0x1f6e: 0x30e1, 0x1f6f: 0x30e9, + 0x1f70: 0x9515, 0x1f71: 0x9535, 0x1f72: 0x30f1, 0x1f73: 0x30f9, 0x1f74: 0x3101, 0x1f75: 0x3109, + 0x1f76: 0x3111, 0x1f77: 0x3119, 0x1f78: 0x3121, 0x1f79: 0x3129, 0x1f7a: 0x3131, 0x1f7b: 0x3139, + 0x1f7c: 0x3141, 0x1f7d: 0x3149, 0x1f7e: 0x3151, 0x1f7f: 0x2040, // Block 0x7e, offset 0x1f80 - 0x1f80: 0xf721, 0x1f81: 0xf741, 0x1f82: 0xf761, 0x1f83: 0xf781, 0x1f84: 0xf7a1, 0x1f85: 0x9555, - 0x1f86: 0xf7c1, 0x1f87: 0xf7e1, 0x1f88: 0xf801, 0x1f89: 0xf821, 0x1f8a: 0xf841, 0x1f8b: 0x9575, - 0x1f8c: 0x9595, 0x1f8d: 0xf861, 0x1f8e: 0xf881, 0x1f8f: 0xf8a1, 0x1f90: 0xf8c1, 0x1f91: 0xf8e1, - 0x1f92: 0xf901, 0x1f93: 0x95b5, 0x1f94: 0xf921, 0x1f95: 0xf941, 0x1f96: 0xf961, 0x1f97: 0xf981, - 0x1f98: 0x95d5, 0x1f99: 0x95f5, 0x1f9a: 0xf9a1, 0x1f9b: 0xf9c1, 0x1f9c: 0xf9e1, 0x1f9d: 0x9615, - 0x1f9e: 0xfa01, 0x1f9f: 0xfa21, 0x1fa0: 0x684d, 0x1fa1: 0x9635, 0x1fa2: 0xfa41, 0x1fa3: 0xfa61, - 0x1fa4: 0xfa81, 0x1fa5: 0x9655, 0x1fa6: 0xfaa1, 0x1fa7: 0xfac1, 0x1fa8: 0xfae1, 0x1fa9: 0xfb01, - 0x1faa: 0xfb21, 0x1fab: 0xfb41, 0x1fac: 0xfb61, 0x1fad: 0x9675, 0x1fae: 0xfb81, 0x1faf: 0xfba1, - 0x1fb0: 0xfbc1, 0x1fb1: 0x9695, 0x1fb2: 0xfbe1, 0x1fb3: 0xfc01, 0x1fb4: 0xfc21, 0x1fb5: 0xfc41, - 0x1fb6: 0x7b6d, 0x1fb7: 0x96b5, 0x1fb8: 0xfc61, 0x1fb9: 0xfc81, 0x1fba: 0xfca1, 0x1fbb: 0x96d5, - 0x1fbc: 0xfcc1, 0x1fbd: 0x96f5, 0x1fbe: 0xfce1, 0x1fbf: 0xfce1, + 0x1f80: 0x3159, 0x1f81: 0x3161, 0x1f82: 0x3169, 0x1f83: 0x3171, 0x1f84: 0x3179, 0x1f85: 0x9555, + 0x1f86: 0x3181, 0x1f87: 0x3189, 0x1f88: 0x3191, 0x1f89: 0x3199, 0x1f8a: 0x31a1, 0x1f8b: 0x9575, + 0x1f8c: 0x9595, 0x1f8d: 0x31a9, 0x1f8e: 0x31b1, 0x1f8f: 0x31b9, 0x1f90: 0x31c1, 0x1f91: 0x31c9, + 0x1f92: 0x31d1, 0x1f93: 0x95b5, 0x1f94: 0x31d9, 0x1f95: 0x31e1, 0x1f96: 0x31e9, 0x1f97: 0x31f1, + 0x1f98: 0x95d5, 0x1f99: 0x95f5, 0x1f9a: 0x31f9, 0x1f9b: 0x3201, 0x1f9c: 0x3209, 0x1f9d: 0x9615, + 0x1f9e: 0x3211, 0x1f9f: 0x3219, 0x1fa0: 0x684d, 0x1fa1: 0x9635, 0x1fa2: 0x3221, 0x1fa3: 0x3229, + 0x1fa4: 0x3231, 0x1fa5: 0x9655, 0x1fa6: 0x3239, 0x1fa7: 0x3241, 0x1fa8: 0x3249, 0x1fa9: 0x3251, + 0x1faa: 0x3259, 0x1fab: 0x3261, 0x1fac: 0x3269, 0x1fad: 0x9675, 0x1fae: 0x3271, 0x1faf: 0x3279, + 0x1fb0: 0x3281, 0x1fb1: 0x9695, 0x1fb2: 0x3289, 0x1fb3: 0x3291, 0x1fb4: 0x3299, 0x1fb5: 0x32a1, + 0x1fb6: 0x7b6d, 0x1fb7: 0x96b5, 0x1fb8: 0x32a9, 0x1fb9: 0x32b1, 0x1fba: 0x32b9, 0x1fbb: 0x96d5, + 0x1fbc: 0x32c1, 0x1fbd: 0x96f5, 0x1fbe: 0x32c9, 0x1fbf: 0x32c9, // Block 0x7f, offset 0x1fc0 - 0x1fc0: 0xfd01, 0x1fc1: 0x9715, 0x1fc2: 0xfd21, 0x1fc3: 0xfd41, 0x1fc4: 0xfd61, 0x1fc5: 0xfd81, - 0x1fc6: 0xfda1, 0x1fc7: 0xfdc1, 0x1fc8: 0xfde1, 0x1fc9: 0x9735, 0x1fca: 0xfe01, 0x1fcb: 0xfe21, - 0x1fcc: 0xfe41, 0x1fcd: 0xfe61, 0x1fce: 0xfe81, 0x1fcf: 0xfea1, 0x1fd0: 0x9755, 0x1fd1: 0xfec1, - 0x1fd2: 0x9775, 0x1fd3: 0x9795, 0x1fd4: 0x97b5, 0x1fd5: 0xfee1, 0x1fd6: 0xff01, 0x1fd7: 0xff21, - 0x1fd8: 0xff41, 0x1fd9: 0xff61, 0x1fda: 0xff81, 0x1fdb: 0xffa1, 0x1fdc: 0xffc1, 0x1fdd: 0x97d5, + 0x1fc0: 0x32d1, 0x1fc1: 0x9715, 0x1fc2: 0x32d9, 0x1fc3: 0x32e1, 0x1fc4: 0x32e9, 0x1fc5: 0x32f1, + 0x1fc6: 0x32f9, 0x1fc7: 0x3301, 0x1fc8: 0x3309, 0x1fc9: 0x9735, 0x1fca: 0x3311, 0x1fcb: 0x3319, + 0x1fcc: 0x3321, 0x1fcd: 0x3329, 0x1fce: 0x3331, 0x1fcf: 0x3339, 0x1fd0: 0x9755, 0x1fd1: 0x3341, + 0x1fd2: 0x9775, 0x1fd3: 0x9795, 0x1fd4: 0x97b5, 0x1fd5: 0x3349, 0x1fd6: 0x3351, 0x1fd7: 0x3359, + 0x1fd8: 0x3361, 0x1fd9: 0x3369, 0x1fda: 0x3371, 0x1fdb: 0x3379, 0x1fdc: 0x3381, 0x1fdd: 0x97d5, 0x1fde: 0x0040, 0x1fdf: 0x0040, 0x1fe0: 0x0040, 0x1fe1: 0x0040, 0x1fe2: 0x0040, 0x1fe3: 0x0040, 0x1fe4: 0x0040, 0x1fe5: 0x0040, 0x1fe6: 0x0040, 0x1fe7: 0x0040, 0x1fe8: 0x0040, 0x1fe9: 0x0040, 0x1fea: 0x0040, 0x1feb: 0x0040, 0x1fec: 0x0040, 0x1fed: 0x0040, 0x1fee: 0x0040, 0x1fef: 0x0040, @@ -2134,7 +2277,7 @@ var idnaIndex = [2368]uint16{ 0x1b8: 0xd6, 0x1b9: 0xd7, 0x1ba: 0xd8, 0x1bb: 0xd9, 0x1bc: 0xda, 0x1bd: 0xdb, 0x1be: 0xdc, 0x1bf: 0x37, // Block 0x7, offset 0x1c0 0x1c0: 0x38, 0x1c1: 0xdd, 0x1c2: 0xde, 0x1c3: 0xdf, 0x1c4: 0xe0, 0x1c5: 0x39, 0x1c6: 0x3a, 0x1c7: 0xe1, - 0x1c8: 0xe2, 0x1c9: 0x3b, 0x1ca: 0x3c, 0x1cb: 0x3d, 0x1cc: 0x3e, 0x1cd: 0x3f, 0x1ce: 0x40, 0x1cf: 0x41, + 0x1c8: 0xe2, 0x1c9: 0x3b, 0x1ca: 0x3c, 0x1cb: 0x3d, 0x1cc: 0xe3, 0x1cd: 0xe4, 0x1ce: 0x3e, 0x1cf: 0x3f, 0x1d0: 0xa0, 0x1d1: 0xa0, 0x1d2: 0xa0, 0x1d3: 0xa0, 0x1d4: 0xa0, 0x1d5: 0xa0, 0x1d6: 0xa0, 0x1d7: 0xa0, 0x1d8: 0xa0, 0x1d9: 0xa0, 0x1da: 0xa0, 0x1db: 0xa0, 0x1dc: 0xa0, 0x1dd: 0xa0, 0x1de: 0xa0, 0x1df: 0xa0, 0x1e0: 0xa0, 0x1e1: 0xa0, 0x1e2: 0xa0, 0x1e3: 0xa0, 0x1e4: 0xa0, 0x1e5: 0xa0, 0x1e6: 0xa0, 0x1e7: 0xa0, @@ -2167,143 +2310,143 @@ var idnaIndex = [2368]uint16{ 0x2a0: 0xa0, 0x2a1: 0xa0, 0x2a2: 0xa0, 0x2a3: 0xa0, 0x2a4: 0xa0, 0x2a5: 0xa0, 0x2a6: 0xa0, 0x2a7: 0xa0, 0x2a8: 0xa0, 0x2a9: 0xa0, 0x2aa: 0xa0, 0x2ab: 0xa0, 0x2ac: 0xa0, 0x2ad: 0xa0, 0x2ae: 0xa0, 0x2af: 0xa0, 0x2b0: 0xa0, 0x2b1: 0xa0, 0x2b2: 0xa0, 0x2b3: 0xa0, 0x2b4: 0xa0, 0x2b5: 0xa0, 0x2b6: 0xa0, 0x2b7: 0xa0, - 0x2b8: 0xa0, 0x2b9: 0xa0, 0x2ba: 0xa0, 0x2bb: 0xa0, 0x2bc: 0xa0, 0x2bd: 0xa0, 0x2be: 0xa0, 0x2bf: 0xe3, + 0x2b8: 0xa0, 0x2b9: 0xa0, 0x2ba: 0xa0, 0x2bb: 0xa0, 0x2bc: 0xa0, 0x2bd: 0xa0, 0x2be: 0xa0, 0x2bf: 0xe5, // Block 0xb, offset 0x2c0 0x2c0: 0xa0, 0x2c1: 0xa0, 0x2c2: 0xa0, 0x2c3: 0xa0, 0x2c4: 0xa0, 0x2c5: 0xa0, 0x2c6: 0xa0, 0x2c7: 0xa0, 0x2c8: 0xa0, 0x2c9: 0xa0, 0x2ca: 0xa0, 0x2cb: 0xa0, 0x2cc: 0xa0, 0x2cd: 0xa0, 0x2ce: 0xa0, 0x2cf: 0xa0, - 0x2d0: 0xa0, 0x2d1: 0xa0, 0x2d2: 0xe4, 0x2d3: 0xe5, 0x2d4: 0xa0, 0x2d5: 0xa0, 0x2d6: 0xa0, 0x2d7: 0xa0, - 0x2d8: 0xe6, 0x2d9: 0x42, 0x2da: 0x43, 0x2db: 0xe7, 0x2dc: 0x44, 0x2dd: 0x45, 0x2de: 0x46, 0x2df: 0xe8, - 0x2e0: 0xe9, 0x2e1: 0xea, 0x2e2: 0xeb, 0x2e3: 0xec, 0x2e4: 0xed, 0x2e5: 0xee, 0x2e6: 0xef, 0x2e7: 0xf0, - 0x2e8: 0xf1, 0x2e9: 0xf2, 0x2ea: 0xf3, 0x2eb: 0xf4, 0x2ec: 0xf5, 0x2ed: 0xf6, 0x2ee: 0xf7, 0x2ef: 0xf8, + 0x2d0: 0xa0, 0x2d1: 0xa0, 0x2d2: 0xe6, 0x2d3: 0xe7, 0x2d4: 0xa0, 0x2d5: 0xa0, 0x2d6: 0xa0, 0x2d7: 0xa0, + 0x2d8: 0xe8, 0x2d9: 0x40, 0x2da: 0x41, 0x2db: 0xe9, 0x2dc: 0x42, 0x2dd: 0x43, 0x2de: 0x44, 0x2df: 0xea, + 0x2e0: 0xeb, 0x2e1: 0xec, 0x2e2: 0xed, 0x2e3: 0xee, 0x2e4: 0xef, 0x2e5: 0xf0, 0x2e6: 0xf1, 0x2e7: 0xf2, + 0x2e8: 0xf3, 0x2e9: 0xf4, 0x2ea: 0xf5, 0x2eb: 0xf6, 0x2ec: 0xf7, 0x2ed: 0xf8, 0x2ee: 0xf9, 0x2ef: 0xfa, 0x2f0: 0xa0, 0x2f1: 0xa0, 0x2f2: 0xa0, 0x2f3: 0xa0, 0x2f4: 0xa0, 0x2f5: 0xa0, 0x2f6: 0xa0, 0x2f7: 0xa0, 0x2f8: 0xa0, 0x2f9: 0xa0, 0x2fa: 0xa0, 0x2fb: 0xa0, 0x2fc: 0xa0, 0x2fd: 0xa0, 0x2fe: 0xa0, 0x2ff: 0xa0, // Block 0xc, offset 0x300 0x300: 0xa0, 0x301: 0xa0, 0x302: 0xa0, 0x303: 0xa0, 0x304: 0xa0, 0x305: 0xa0, 0x306: 0xa0, 0x307: 0xa0, 0x308: 0xa0, 0x309: 0xa0, 0x30a: 0xa0, 0x30b: 0xa0, 0x30c: 0xa0, 0x30d: 0xa0, 0x30e: 0xa0, 0x30f: 0xa0, 0x310: 0xa0, 0x311: 0xa0, 0x312: 0xa0, 0x313: 0xa0, 0x314: 0xa0, 0x315: 0xa0, 0x316: 0xa0, 0x317: 0xa0, - 0x318: 0xa0, 0x319: 0xa0, 0x31a: 0xa0, 0x31b: 0xa0, 0x31c: 0xa0, 0x31d: 0xa0, 0x31e: 0xf9, 0x31f: 0xfa, + 0x318: 0xa0, 0x319: 0xa0, 0x31a: 0xa0, 0x31b: 0xa0, 0x31c: 0xa0, 0x31d: 0xa0, 0x31e: 0xfb, 0x31f: 0xfc, // Block 0xd, offset 0x340 - 0x340: 0xfb, 0x341: 0xfb, 0x342: 0xfb, 0x343: 0xfb, 0x344: 0xfb, 0x345: 0xfb, 0x346: 0xfb, 0x347: 0xfb, - 0x348: 0xfb, 0x349: 0xfb, 0x34a: 0xfb, 0x34b: 0xfb, 0x34c: 0xfb, 0x34d: 0xfb, 0x34e: 0xfb, 0x34f: 0xfb, - 0x350: 0xfb, 0x351: 0xfb, 0x352: 0xfb, 0x353: 0xfb, 0x354: 0xfb, 0x355: 0xfb, 0x356: 0xfb, 0x357: 0xfb, - 0x358: 0xfb, 0x359: 0xfb, 0x35a: 0xfb, 0x35b: 0xfb, 0x35c: 0xfb, 0x35d: 0xfb, 0x35e: 0xfb, 0x35f: 0xfb, - 0x360: 0xfb, 0x361: 0xfb, 0x362: 0xfb, 0x363: 0xfb, 0x364: 0xfb, 0x365: 0xfb, 0x366: 0xfb, 0x367: 0xfb, - 0x368: 0xfb, 0x369: 0xfb, 0x36a: 0xfb, 0x36b: 0xfb, 0x36c: 0xfb, 0x36d: 0xfb, 0x36e: 0xfb, 0x36f: 0xfb, - 0x370: 0xfb, 0x371: 0xfb, 0x372: 0xfb, 0x373: 0xfb, 0x374: 0xfb, 0x375: 0xfb, 0x376: 0xfb, 0x377: 0xfb, - 0x378: 0xfb, 0x379: 0xfb, 0x37a: 0xfb, 0x37b: 0xfb, 0x37c: 0xfb, 0x37d: 0xfb, 0x37e: 0xfb, 0x37f: 0xfb, + 0x340: 0xfd, 0x341: 0xfd, 0x342: 0xfd, 0x343: 0xfd, 0x344: 0xfd, 0x345: 0xfd, 0x346: 0xfd, 0x347: 0xfd, + 0x348: 0xfd, 0x349: 0xfd, 0x34a: 0xfd, 0x34b: 0xfd, 0x34c: 0xfd, 0x34d: 0xfd, 0x34e: 0xfd, 0x34f: 0xfd, + 0x350: 0xfd, 0x351: 0xfd, 0x352: 0xfd, 0x353: 0xfd, 0x354: 0xfd, 0x355: 0xfd, 0x356: 0xfd, 0x357: 0xfd, + 0x358: 0xfd, 0x359: 0xfd, 0x35a: 0xfd, 0x35b: 0xfd, 0x35c: 0xfd, 0x35d: 0xfd, 0x35e: 0xfd, 0x35f: 0xfd, + 0x360: 0xfd, 0x361: 0xfd, 0x362: 0xfd, 0x363: 0xfd, 0x364: 0xfd, 0x365: 0xfd, 0x366: 0xfd, 0x367: 0xfd, + 0x368: 0xfd, 0x369: 0xfd, 0x36a: 0xfd, 0x36b: 0xfd, 0x36c: 0xfd, 0x36d: 0xfd, 0x36e: 0xfd, 0x36f: 0xfd, + 0x370: 0xfd, 0x371: 0xfd, 0x372: 0xfd, 0x373: 0xfd, 0x374: 0xfd, 0x375: 0xfd, 0x376: 0xfd, 0x377: 0xfd, + 0x378: 0xfd, 0x379: 0xfd, 0x37a: 0xfd, 0x37b: 0xfd, 0x37c: 0xfd, 0x37d: 0xfd, 0x37e: 0xfd, 0x37f: 0xfd, // Block 0xe, offset 0x380 - 0x380: 0xfb, 0x381: 0xfb, 0x382: 0xfb, 0x383: 0xfb, 0x384: 0xfb, 0x385: 0xfb, 0x386: 0xfb, 0x387: 0xfb, - 0x388: 0xfb, 0x389: 0xfb, 0x38a: 0xfb, 0x38b: 0xfb, 0x38c: 0xfb, 0x38d: 0xfb, 0x38e: 0xfb, 0x38f: 0xfb, - 0x390: 0xfb, 0x391: 0xfb, 0x392: 0xfb, 0x393: 0xfb, 0x394: 0xfb, 0x395: 0xfb, 0x396: 0xfb, 0x397: 0xfb, - 0x398: 0xfb, 0x399: 0xfb, 0x39a: 0xfb, 0x39b: 0xfb, 0x39c: 0xfb, 0x39d: 0xfb, 0x39e: 0xfb, 0x39f: 0xfb, - 0x3a0: 0xfb, 0x3a1: 0xfb, 0x3a2: 0xfb, 0x3a3: 0xfb, 0x3a4: 0xfc, 0x3a5: 0xfd, 0x3a6: 0xfe, 0x3a7: 0xff, - 0x3a8: 0x47, 0x3a9: 0x100, 0x3aa: 0x101, 0x3ab: 0x48, 0x3ac: 0x49, 0x3ad: 0x4a, 0x3ae: 0x4b, 0x3af: 0x4c, - 0x3b0: 0x102, 0x3b1: 0x4d, 0x3b2: 0x4e, 0x3b3: 0x4f, 0x3b4: 0x50, 0x3b5: 0x51, 0x3b6: 0x103, 0x3b7: 0x52, - 0x3b8: 0x53, 0x3b9: 0x54, 0x3ba: 0x55, 0x3bb: 0x56, 0x3bc: 0x57, 0x3bd: 0x58, 0x3be: 0x59, 0x3bf: 0x5a, + 0x380: 0xfd, 0x381: 0xfd, 0x382: 0xfd, 0x383: 0xfd, 0x384: 0xfd, 0x385: 0xfd, 0x386: 0xfd, 0x387: 0xfd, + 0x388: 0xfd, 0x389: 0xfd, 0x38a: 0xfd, 0x38b: 0xfd, 0x38c: 0xfd, 0x38d: 0xfd, 0x38e: 0xfd, 0x38f: 0xfd, + 0x390: 0xfd, 0x391: 0xfd, 0x392: 0xfd, 0x393: 0xfd, 0x394: 0xfd, 0x395: 0xfd, 0x396: 0xfd, 0x397: 0xfd, + 0x398: 0xfd, 0x399: 0xfd, 0x39a: 0xfd, 0x39b: 0xfd, 0x39c: 0xfd, 0x39d: 0xfd, 0x39e: 0xfd, 0x39f: 0xfd, + 0x3a0: 0xfd, 0x3a1: 0xfd, 0x3a2: 0xfd, 0x3a3: 0xfd, 0x3a4: 0xfe, 0x3a5: 0xff, 0x3a6: 0x100, 0x3a7: 0x101, + 0x3a8: 0x45, 0x3a9: 0x102, 0x3aa: 0x103, 0x3ab: 0x46, 0x3ac: 0x47, 0x3ad: 0x48, 0x3ae: 0x49, 0x3af: 0x4a, + 0x3b0: 0x104, 0x3b1: 0x4b, 0x3b2: 0x4c, 0x3b3: 0x4d, 0x3b4: 0x4e, 0x3b5: 0x4f, 0x3b6: 0x105, 0x3b7: 0x50, + 0x3b8: 0x51, 0x3b9: 0x52, 0x3ba: 0x53, 0x3bb: 0x54, 0x3bc: 0x55, 0x3bd: 0x56, 0x3be: 0x57, 0x3bf: 0x58, // Block 0xf, offset 0x3c0 - 0x3c0: 0x104, 0x3c1: 0x105, 0x3c2: 0xa0, 0x3c3: 0x106, 0x3c4: 0x107, 0x3c5: 0x9c, 0x3c6: 0x108, 0x3c7: 0x109, - 0x3c8: 0xfb, 0x3c9: 0xfb, 0x3ca: 0x10a, 0x3cb: 0x10b, 0x3cc: 0x10c, 0x3cd: 0x10d, 0x3ce: 0x10e, 0x3cf: 0x10f, - 0x3d0: 0x110, 0x3d1: 0xa0, 0x3d2: 0x111, 0x3d3: 0x112, 0x3d4: 0x113, 0x3d5: 0x114, 0x3d6: 0xfb, 0x3d7: 0xfb, - 0x3d8: 0xa0, 0x3d9: 0xa0, 0x3da: 0xa0, 0x3db: 0xa0, 0x3dc: 0x115, 0x3dd: 0x116, 0x3de: 0xfb, 0x3df: 0xfb, - 0x3e0: 0x117, 0x3e1: 0x118, 0x3e2: 0x119, 0x3e3: 0x11a, 0x3e4: 0x11b, 0x3e5: 0xfb, 0x3e6: 0x11c, 0x3e7: 0x11d, - 0x3e8: 0x11e, 0x3e9: 0x11f, 0x3ea: 0x120, 0x3eb: 0x5b, 0x3ec: 0x121, 0x3ed: 0x122, 0x3ee: 0x5c, 0x3ef: 0xfb, - 0x3f0: 0x123, 0x3f1: 0x124, 0x3f2: 0x125, 0x3f3: 0x126, 0x3f4: 0x127, 0x3f5: 0xfb, 0x3f6: 0xfb, 0x3f7: 0xfb, - 0x3f8: 0xfb, 0x3f9: 0x128, 0x3fa: 0x129, 0x3fb: 0xfb, 0x3fc: 0x12a, 0x3fd: 0x12b, 0x3fe: 0x12c, 0x3ff: 0x12d, + 0x3c0: 0x106, 0x3c1: 0x107, 0x3c2: 0xa0, 0x3c3: 0x108, 0x3c4: 0x109, 0x3c5: 0x9c, 0x3c6: 0x10a, 0x3c7: 0x10b, + 0x3c8: 0xfd, 0x3c9: 0xfd, 0x3ca: 0x10c, 0x3cb: 0x10d, 0x3cc: 0x10e, 0x3cd: 0x10f, 0x3ce: 0x110, 0x3cf: 0x111, + 0x3d0: 0x112, 0x3d1: 0xa0, 0x3d2: 0x113, 0x3d3: 0x114, 0x3d4: 0x115, 0x3d5: 0x116, 0x3d6: 0xfd, 0x3d7: 0xfd, + 0x3d8: 0xa0, 0x3d9: 0xa0, 0x3da: 0xa0, 0x3db: 0xa0, 0x3dc: 0x117, 0x3dd: 0x118, 0x3de: 0xfd, 0x3df: 0xfd, + 0x3e0: 0x119, 0x3e1: 0x11a, 0x3e2: 0x11b, 0x3e3: 0x11c, 0x3e4: 0x11d, 0x3e5: 0xfd, 0x3e6: 0x11e, 0x3e7: 0x11f, + 0x3e8: 0x120, 0x3e9: 0x121, 0x3ea: 0x122, 0x3eb: 0x59, 0x3ec: 0x123, 0x3ed: 0x124, 0x3ee: 0x5a, 0x3ef: 0xfd, + 0x3f0: 0x125, 0x3f1: 0x126, 0x3f2: 0x127, 0x3f3: 0x128, 0x3f4: 0x129, 0x3f5: 0xfd, 0x3f6: 0xfd, 0x3f7: 0xfd, + 0x3f8: 0xfd, 0x3f9: 0x12a, 0x3fa: 0x12b, 0x3fb: 0xfd, 0x3fc: 0x12c, 0x3fd: 0x12d, 0x3fe: 0x12e, 0x3ff: 0x12f, // Block 0x10, offset 0x400 - 0x400: 0x12e, 0x401: 0x12f, 0x402: 0x130, 0x403: 0x131, 0x404: 0x132, 0x405: 0x133, 0x406: 0x134, 0x407: 0x135, - 0x408: 0x136, 0x409: 0xfb, 0x40a: 0x137, 0x40b: 0x138, 0x40c: 0x5d, 0x40d: 0x5e, 0x40e: 0xfb, 0x40f: 0xfb, - 0x410: 0x139, 0x411: 0x13a, 0x412: 0x13b, 0x413: 0x13c, 0x414: 0xfb, 0x415: 0xfb, 0x416: 0x13d, 0x417: 0x13e, - 0x418: 0x13f, 0x419: 0x140, 0x41a: 0x141, 0x41b: 0x142, 0x41c: 0x143, 0x41d: 0xfb, 0x41e: 0xfb, 0x41f: 0xfb, - 0x420: 0x144, 0x421: 0xfb, 0x422: 0x145, 0x423: 0x146, 0x424: 0x5f, 0x425: 0x147, 0x426: 0x148, 0x427: 0x149, - 0x428: 0x14a, 0x429: 0x14b, 0x42a: 0x14c, 0x42b: 0x14d, 0x42c: 0xfb, 0x42d: 0xfb, 0x42e: 0xfb, 0x42f: 0xfb, - 0x430: 0x14e, 0x431: 0x14f, 0x432: 0x150, 0x433: 0xfb, 0x434: 0x151, 0x435: 0x152, 0x436: 0x153, 0x437: 0xfb, - 0x438: 0xfb, 0x439: 0xfb, 0x43a: 0xfb, 0x43b: 0x154, 0x43c: 0xfb, 0x43d: 0xfb, 0x43e: 0x155, 0x43f: 0x156, + 0x400: 0x130, 0x401: 0x131, 0x402: 0x132, 0x403: 0x133, 0x404: 0x134, 0x405: 0x135, 0x406: 0x136, 0x407: 0x137, + 0x408: 0x138, 0x409: 0xfd, 0x40a: 0x139, 0x40b: 0x13a, 0x40c: 0x5b, 0x40d: 0x5c, 0x40e: 0xfd, 0x40f: 0xfd, + 0x410: 0x13b, 0x411: 0x13c, 0x412: 0x13d, 0x413: 0x13e, 0x414: 0xfd, 0x415: 0xfd, 0x416: 0x13f, 0x417: 0x140, + 0x418: 0x141, 0x419: 0x142, 0x41a: 0x143, 0x41b: 0x144, 0x41c: 0x145, 0x41d: 0xfd, 0x41e: 0xfd, 0x41f: 0xfd, + 0x420: 0x146, 0x421: 0xfd, 0x422: 0x147, 0x423: 0x148, 0x424: 0x5d, 0x425: 0x149, 0x426: 0x14a, 0x427: 0x14b, + 0x428: 0x14c, 0x429: 0x14d, 0x42a: 0x14e, 0x42b: 0x14f, 0x42c: 0xfd, 0x42d: 0xfd, 0x42e: 0xfd, 0x42f: 0xfd, + 0x430: 0x150, 0x431: 0x151, 0x432: 0x152, 0x433: 0xfd, 0x434: 0x153, 0x435: 0x154, 0x436: 0x155, 0x437: 0xfd, + 0x438: 0xfd, 0x439: 0xfd, 0x43a: 0xfd, 0x43b: 0x156, 0x43c: 0xfd, 0x43d: 0xfd, 0x43e: 0x157, 0x43f: 0x158, // Block 0x11, offset 0x440 0x440: 0xa0, 0x441: 0xa0, 0x442: 0xa0, 0x443: 0xa0, 0x444: 0xa0, 0x445: 0xa0, 0x446: 0xa0, 0x447: 0xa0, - 0x448: 0xa0, 0x449: 0xa0, 0x44a: 0xa0, 0x44b: 0xa0, 0x44c: 0xa0, 0x44d: 0xa0, 0x44e: 0x157, 0x44f: 0xfb, - 0x450: 0x9c, 0x451: 0x158, 0x452: 0xa0, 0x453: 0xa0, 0x454: 0xa0, 0x455: 0x159, 0x456: 0xfb, 0x457: 0xfb, - 0x458: 0xfb, 0x459: 0xfb, 0x45a: 0xfb, 0x45b: 0xfb, 0x45c: 0xfb, 0x45d: 0xfb, 0x45e: 0xfb, 0x45f: 0xfb, - 0x460: 0xfb, 0x461: 0xfb, 0x462: 0xfb, 0x463: 0xfb, 0x464: 0xfb, 0x465: 0xfb, 0x466: 0xfb, 0x467: 0xfb, - 0x468: 0xfb, 0x469: 0xfb, 0x46a: 0xfb, 0x46b: 0xfb, 0x46c: 0xfb, 0x46d: 0xfb, 0x46e: 0xfb, 0x46f: 0xfb, - 0x470: 0xfb, 0x471: 0xfb, 0x472: 0xfb, 0x473: 0xfb, 0x474: 0xfb, 0x475: 0xfb, 0x476: 0xfb, 0x477: 0xfb, - 0x478: 0xfb, 0x479: 0xfb, 0x47a: 0xfb, 0x47b: 0xfb, 0x47c: 0xfb, 0x47d: 0xfb, 0x47e: 0xfb, 0x47f: 0xfb, + 0x448: 0xa0, 0x449: 0xa0, 0x44a: 0xa0, 0x44b: 0xa0, 0x44c: 0xa0, 0x44d: 0xa0, 0x44e: 0x159, 0x44f: 0xfd, + 0x450: 0x9c, 0x451: 0x15a, 0x452: 0xa0, 0x453: 0xa0, 0x454: 0xa0, 0x455: 0x15b, 0x456: 0xfd, 0x457: 0xfd, + 0x458: 0xfd, 0x459: 0xfd, 0x45a: 0xfd, 0x45b: 0xfd, 0x45c: 0xfd, 0x45d: 0xfd, 0x45e: 0xfd, 0x45f: 0xfd, + 0x460: 0xfd, 0x461: 0xfd, 0x462: 0xfd, 0x463: 0xfd, 0x464: 0xfd, 0x465: 0xfd, 0x466: 0xfd, 0x467: 0xfd, + 0x468: 0xfd, 0x469: 0xfd, 0x46a: 0xfd, 0x46b: 0xfd, 0x46c: 0xfd, 0x46d: 0xfd, 0x46e: 0xfd, 0x46f: 0xfd, + 0x470: 0xfd, 0x471: 0xfd, 0x472: 0xfd, 0x473: 0xfd, 0x474: 0xfd, 0x475: 0xfd, 0x476: 0xfd, 0x477: 0xfd, + 0x478: 0xfd, 0x479: 0xfd, 0x47a: 0xfd, 0x47b: 0xfd, 0x47c: 0xfd, 0x47d: 0xfd, 0x47e: 0xfd, 0x47f: 0xfd, // Block 0x12, offset 0x480 0x480: 0xa0, 0x481: 0xa0, 0x482: 0xa0, 0x483: 0xa0, 0x484: 0xa0, 0x485: 0xa0, 0x486: 0xa0, 0x487: 0xa0, 0x488: 0xa0, 0x489: 0xa0, 0x48a: 0xa0, 0x48b: 0xa0, 0x48c: 0xa0, 0x48d: 0xa0, 0x48e: 0xa0, 0x48f: 0xa0, - 0x490: 0x15a, 0x491: 0xfb, 0x492: 0xfb, 0x493: 0xfb, 0x494: 0xfb, 0x495: 0xfb, 0x496: 0xfb, 0x497: 0xfb, - 0x498: 0xfb, 0x499: 0xfb, 0x49a: 0xfb, 0x49b: 0xfb, 0x49c: 0xfb, 0x49d: 0xfb, 0x49e: 0xfb, 0x49f: 0xfb, - 0x4a0: 0xfb, 0x4a1: 0xfb, 0x4a2: 0xfb, 0x4a3: 0xfb, 0x4a4: 0xfb, 0x4a5: 0xfb, 0x4a6: 0xfb, 0x4a7: 0xfb, - 0x4a8: 0xfb, 0x4a9: 0xfb, 0x4aa: 0xfb, 0x4ab: 0xfb, 0x4ac: 0xfb, 0x4ad: 0xfb, 0x4ae: 0xfb, 0x4af: 0xfb, - 0x4b0: 0xfb, 0x4b1: 0xfb, 0x4b2: 0xfb, 0x4b3: 0xfb, 0x4b4: 0xfb, 0x4b5: 0xfb, 0x4b6: 0xfb, 0x4b7: 0xfb, - 0x4b8: 0xfb, 0x4b9: 0xfb, 0x4ba: 0xfb, 0x4bb: 0xfb, 0x4bc: 0xfb, 0x4bd: 0xfb, 0x4be: 0xfb, 0x4bf: 0xfb, + 0x490: 0x15c, 0x491: 0xfd, 0x492: 0xfd, 0x493: 0xfd, 0x494: 0xfd, 0x495: 0xfd, 0x496: 0xfd, 0x497: 0xfd, + 0x498: 0xfd, 0x499: 0xfd, 0x49a: 0xfd, 0x49b: 0xfd, 0x49c: 0xfd, 0x49d: 0xfd, 0x49e: 0xfd, 0x49f: 0xfd, + 0x4a0: 0xfd, 0x4a1: 0xfd, 0x4a2: 0xfd, 0x4a3: 0xfd, 0x4a4: 0xfd, 0x4a5: 0xfd, 0x4a6: 0xfd, 0x4a7: 0xfd, + 0x4a8: 0xfd, 0x4a9: 0xfd, 0x4aa: 0xfd, 0x4ab: 0xfd, 0x4ac: 0xfd, 0x4ad: 0xfd, 0x4ae: 0xfd, 0x4af: 0xfd, + 0x4b0: 0xfd, 0x4b1: 0xfd, 0x4b2: 0xfd, 0x4b3: 0xfd, 0x4b4: 0xfd, 0x4b5: 0xfd, 0x4b6: 0xfd, 0x4b7: 0xfd, + 0x4b8: 0xfd, 0x4b9: 0xfd, 0x4ba: 0xfd, 0x4bb: 0xfd, 0x4bc: 0xfd, 0x4bd: 0xfd, 0x4be: 0xfd, 0x4bf: 0xfd, // Block 0x13, offset 0x4c0 - 0x4c0: 0xfb, 0x4c1: 0xfb, 0x4c2: 0xfb, 0x4c3: 0xfb, 0x4c4: 0xfb, 0x4c5: 0xfb, 0x4c6: 0xfb, 0x4c7: 0xfb, - 0x4c8: 0xfb, 0x4c9: 0xfb, 0x4ca: 0xfb, 0x4cb: 0xfb, 0x4cc: 0xfb, 0x4cd: 0xfb, 0x4ce: 0xfb, 0x4cf: 0xfb, + 0x4c0: 0xfd, 0x4c1: 0xfd, 0x4c2: 0xfd, 0x4c3: 0xfd, 0x4c4: 0xfd, 0x4c5: 0xfd, 0x4c6: 0xfd, 0x4c7: 0xfd, + 0x4c8: 0xfd, 0x4c9: 0xfd, 0x4ca: 0xfd, 0x4cb: 0xfd, 0x4cc: 0xfd, 0x4cd: 0xfd, 0x4ce: 0xfd, 0x4cf: 0xfd, 0x4d0: 0xa0, 0x4d1: 0xa0, 0x4d2: 0xa0, 0x4d3: 0xa0, 0x4d4: 0xa0, 0x4d5: 0xa0, 0x4d6: 0xa0, 0x4d7: 0xa0, - 0x4d8: 0xa0, 0x4d9: 0x15b, 0x4da: 0xfb, 0x4db: 0xfb, 0x4dc: 0xfb, 0x4dd: 0xfb, 0x4de: 0xfb, 0x4df: 0xfb, - 0x4e0: 0xfb, 0x4e1: 0xfb, 0x4e2: 0xfb, 0x4e3: 0xfb, 0x4e4: 0xfb, 0x4e5: 0xfb, 0x4e6: 0xfb, 0x4e7: 0xfb, - 0x4e8: 0xfb, 0x4e9: 0xfb, 0x4ea: 0xfb, 0x4eb: 0xfb, 0x4ec: 0xfb, 0x4ed: 0xfb, 0x4ee: 0xfb, 0x4ef: 0xfb, - 0x4f0: 0xfb, 0x4f1: 0xfb, 0x4f2: 0xfb, 0x4f3: 0xfb, 0x4f4: 0xfb, 0x4f5: 0xfb, 0x4f6: 0xfb, 0x4f7: 0xfb, - 0x4f8: 0xfb, 0x4f9: 0xfb, 0x4fa: 0xfb, 0x4fb: 0xfb, 0x4fc: 0xfb, 0x4fd: 0xfb, 0x4fe: 0xfb, 0x4ff: 0xfb, + 0x4d8: 0xa0, 0x4d9: 0x15d, 0x4da: 0xfd, 0x4db: 0xfd, 0x4dc: 0xfd, 0x4dd: 0xfd, 0x4de: 0xfd, 0x4df: 0xfd, + 0x4e0: 0xfd, 0x4e1: 0xfd, 0x4e2: 0xfd, 0x4e3: 0xfd, 0x4e4: 0xfd, 0x4e5: 0xfd, 0x4e6: 0xfd, 0x4e7: 0xfd, + 0x4e8: 0xfd, 0x4e9: 0xfd, 0x4ea: 0xfd, 0x4eb: 0xfd, 0x4ec: 0xfd, 0x4ed: 0xfd, 0x4ee: 0xfd, 0x4ef: 0xfd, + 0x4f0: 0xfd, 0x4f1: 0xfd, 0x4f2: 0xfd, 0x4f3: 0xfd, 0x4f4: 0xfd, 0x4f5: 0xfd, 0x4f6: 0xfd, 0x4f7: 0xfd, + 0x4f8: 0xfd, 0x4f9: 0xfd, 0x4fa: 0xfd, 0x4fb: 0xfd, 0x4fc: 0xfd, 0x4fd: 0xfd, 0x4fe: 0xfd, 0x4ff: 0xfd, // Block 0x14, offset 0x500 - 0x500: 0xfb, 0x501: 0xfb, 0x502: 0xfb, 0x503: 0xfb, 0x504: 0xfb, 0x505: 0xfb, 0x506: 0xfb, 0x507: 0xfb, - 0x508: 0xfb, 0x509: 0xfb, 0x50a: 0xfb, 0x50b: 0xfb, 0x50c: 0xfb, 0x50d: 0xfb, 0x50e: 0xfb, 0x50f: 0xfb, - 0x510: 0xfb, 0x511: 0xfb, 0x512: 0xfb, 0x513: 0xfb, 0x514: 0xfb, 0x515: 0xfb, 0x516: 0xfb, 0x517: 0xfb, - 0x518: 0xfb, 0x519: 0xfb, 0x51a: 0xfb, 0x51b: 0xfb, 0x51c: 0xfb, 0x51d: 0xfb, 0x51e: 0xfb, 0x51f: 0xfb, + 0x500: 0xfd, 0x501: 0xfd, 0x502: 0xfd, 0x503: 0xfd, 0x504: 0xfd, 0x505: 0xfd, 0x506: 0xfd, 0x507: 0xfd, + 0x508: 0xfd, 0x509: 0xfd, 0x50a: 0xfd, 0x50b: 0xfd, 0x50c: 0xfd, 0x50d: 0xfd, 0x50e: 0xfd, 0x50f: 0xfd, + 0x510: 0xfd, 0x511: 0xfd, 0x512: 0xfd, 0x513: 0xfd, 0x514: 0xfd, 0x515: 0xfd, 0x516: 0xfd, 0x517: 0xfd, + 0x518: 0xfd, 0x519: 0xfd, 0x51a: 0xfd, 0x51b: 0xfd, 0x51c: 0xfd, 0x51d: 0xfd, 0x51e: 0xfd, 0x51f: 0xfd, 0x520: 0xa0, 0x521: 0xa0, 0x522: 0xa0, 0x523: 0xa0, 0x524: 0xa0, 0x525: 0xa0, 0x526: 0xa0, 0x527: 0xa0, - 0x528: 0x14d, 0x529: 0x15c, 0x52a: 0xfb, 0x52b: 0x15d, 0x52c: 0x15e, 0x52d: 0x15f, 0x52e: 0x160, 0x52f: 0xfb, - 0x530: 0xfb, 0x531: 0xfb, 0x532: 0xfb, 0x533: 0xfb, 0x534: 0xfb, 0x535: 0xfb, 0x536: 0xfb, 0x537: 0xfb, - 0x538: 0xfb, 0x539: 0x161, 0x53a: 0x162, 0x53b: 0xfb, 0x53c: 0xa0, 0x53d: 0x163, 0x53e: 0x164, 0x53f: 0x165, + 0x528: 0x14f, 0x529: 0x15e, 0x52a: 0xfd, 0x52b: 0x15f, 0x52c: 0x160, 0x52d: 0x161, 0x52e: 0x162, 0x52f: 0xfd, + 0x530: 0xfd, 0x531: 0xfd, 0x532: 0xfd, 0x533: 0xfd, 0x534: 0xfd, 0x535: 0xfd, 0x536: 0xfd, 0x537: 0xfd, + 0x538: 0xfd, 0x539: 0x163, 0x53a: 0x164, 0x53b: 0xfd, 0x53c: 0xa0, 0x53d: 0x165, 0x53e: 0x166, 0x53f: 0x167, // Block 0x15, offset 0x540 0x540: 0xa0, 0x541: 0xa0, 0x542: 0xa0, 0x543: 0xa0, 0x544: 0xa0, 0x545: 0xa0, 0x546: 0xa0, 0x547: 0xa0, 0x548: 0xa0, 0x549: 0xa0, 0x54a: 0xa0, 0x54b: 0xa0, 0x54c: 0xa0, 0x54d: 0xa0, 0x54e: 0xa0, 0x54f: 0xa0, 0x550: 0xa0, 0x551: 0xa0, 0x552: 0xa0, 0x553: 0xa0, 0x554: 0xa0, 0x555: 0xa0, 0x556: 0xa0, 0x557: 0xa0, - 0x558: 0xa0, 0x559: 0xa0, 0x55a: 0xa0, 0x55b: 0xa0, 0x55c: 0xa0, 0x55d: 0xa0, 0x55e: 0xa0, 0x55f: 0x166, + 0x558: 0xa0, 0x559: 0xa0, 0x55a: 0xa0, 0x55b: 0xa0, 0x55c: 0xa0, 0x55d: 0xa0, 0x55e: 0xa0, 0x55f: 0x168, 0x560: 0xa0, 0x561: 0xa0, 0x562: 0xa0, 0x563: 0xa0, 0x564: 0xa0, 0x565: 0xa0, 0x566: 0xa0, 0x567: 0xa0, 0x568: 0xa0, 0x569: 0xa0, 0x56a: 0xa0, 0x56b: 0xa0, 0x56c: 0xa0, 0x56d: 0xa0, 0x56e: 0xa0, 0x56f: 0xa0, - 0x570: 0xa0, 0x571: 0xa0, 0x572: 0xa0, 0x573: 0x167, 0x574: 0x168, 0x575: 0xfb, 0x576: 0xfb, 0x577: 0xfb, - 0x578: 0xfb, 0x579: 0xfb, 0x57a: 0xfb, 0x57b: 0xfb, 0x57c: 0xfb, 0x57d: 0xfb, 0x57e: 0xfb, 0x57f: 0xfb, + 0x570: 0xa0, 0x571: 0xa0, 0x572: 0xa0, 0x573: 0x169, 0x574: 0x16a, 0x575: 0xfd, 0x576: 0xfd, 0x577: 0xfd, + 0x578: 0xfd, 0x579: 0xfd, 0x57a: 0xfd, 0x57b: 0xfd, 0x57c: 0xfd, 0x57d: 0xfd, 0x57e: 0xfd, 0x57f: 0xfd, // Block 0x16, offset 0x580 - 0x580: 0xa0, 0x581: 0xa0, 0x582: 0xa0, 0x583: 0xa0, 0x584: 0x169, 0x585: 0x16a, 0x586: 0xa0, 0x587: 0xa0, - 0x588: 0xa0, 0x589: 0xa0, 0x58a: 0xa0, 0x58b: 0x16b, 0x58c: 0xfb, 0x58d: 0xfb, 0x58e: 0xfb, 0x58f: 0xfb, - 0x590: 0xfb, 0x591: 0xfb, 0x592: 0xfb, 0x593: 0xfb, 0x594: 0xfb, 0x595: 0xfb, 0x596: 0xfb, 0x597: 0xfb, - 0x598: 0xfb, 0x599: 0xfb, 0x59a: 0xfb, 0x59b: 0xfb, 0x59c: 0xfb, 0x59d: 0xfb, 0x59e: 0xfb, 0x59f: 0xfb, - 0x5a0: 0xfb, 0x5a1: 0xfb, 0x5a2: 0xfb, 0x5a3: 0xfb, 0x5a4: 0xfb, 0x5a5: 0xfb, 0x5a6: 0xfb, 0x5a7: 0xfb, - 0x5a8: 0xfb, 0x5a9: 0xfb, 0x5aa: 0xfb, 0x5ab: 0xfb, 0x5ac: 0xfb, 0x5ad: 0xfb, 0x5ae: 0xfb, 0x5af: 0xfb, - 0x5b0: 0xa0, 0x5b1: 0x16c, 0x5b2: 0x16d, 0x5b3: 0xfb, 0x5b4: 0xfb, 0x5b5: 0xfb, 0x5b6: 0xfb, 0x5b7: 0xfb, - 0x5b8: 0xfb, 0x5b9: 0xfb, 0x5ba: 0xfb, 0x5bb: 0xfb, 0x5bc: 0xfb, 0x5bd: 0xfb, 0x5be: 0xfb, 0x5bf: 0xfb, + 0x580: 0xa0, 0x581: 0xa0, 0x582: 0xa0, 0x583: 0xa0, 0x584: 0x16b, 0x585: 0x16c, 0x586: 0xa0, 0x587: 0xa0, + 0x588: 0xa0, 0x589: 0xa0, 0x58a: 0xa0, 0x58b: 0x16d, 0x58c: 0xfd, 0x58d: 0xfd, 0x58e: 0xfd, 0x58f: 0xfd, + 0x590: 0xfd, 0x591: 0xfd, 0x592: 0xfd, 0x593: 0xfd, 0x594: 0xfd, 0x595: 0xfd, 0x596: 0xfd, 0x597: 0xfd, + 0x598: 0xfd, 0x599: 0xfd, 0x59a: 0xfd, 0x59b: 0xfd, 0x59c: 0xfd, 0x59d: 0xfd, 0x59e: 0xfd, 0x59f: 0xfd, + 0x5a0: 0xfd, 0x5a1: 0xfd, 0x5a2: 0xfd, 0x5a3: 0xfd, 0x5a4: 0xfd, 0x5a5: 0xfd, 0x5a6: 0xfd, 0x5a7: 0xfd, + 0x5a8: 0xfd, 0x5a9: 0xfd, 0x5aa: 0xfd, 0x5ab: 0xfd, 0x5ac: 0xfd, 0x5ad: 0xfd, 0x5ae: 0xfd, 0x5af: 0xfd, + 0x5b0: 0xa0, 0x5b1: 0x16e, 0x5b2: 0x16f, 0x5b3: 0xfd, 0x5b4: 0xfd, 0x5b5: 0xfd, 0x5b6: 0xfd, 0x5b7: 0xfd, + 0x5b8: 0xfd, 0x5b9: 0xfd, 0x5ba: 0xfd, 0x5bb: 0xfd, 0x5bc: 0xfd, 0x5bd: 0xfd, 0x5be: 0xfd, 0x5bf: 0xfd, // Block 0x17, offset 0x5c0 - 0x5c0: 0x9c, 0x5c1: 0x9c, 0x5c2: 0x9c, 0x5c3: 0x16e, 0x5c4: 0x16f, 0x5c5: 0x170, 0x5c6: 0x171, 0x5c7: 0x172, - 0x5c8: 0x9c, 0x5c9: 0x173, 0x5ca: 0xfb, 0x5cb: 0x174, 0x5cc: 0x9c, 0x5cd: 0x175, 0x5ce: 0xfb, 0x5cf: 0xfb, - 0x5d0: 0x60, 0x5d1: 0x61, 0x5d2: 0x62, 0x5d3: 0x63, 0x5d4: 0x64, 0x5d5: 0x65, 0x5d6: 0x66, 0x5d7: 0x67, - 0x5d8: 0x68, 0x5d9: 0x69, 0x5da: 0x6a, 0x5db: 0x6b, 0x5dc: 0x6c, 0x5dd: 0x6d, 0x5de: 0x6e, 0x5df: 0x6f, + 0x5c0: 0x9c, 0x5c1: 0x9c, 0x5c2: 0x9c, 0x5c3: 0x170, 0x5c4: 0x171, 0x5c5: 0x172, 0x5c6: 0x173, 0x5c7: 0x174, + 0x5c8: 0x9c, 0x5c9: 0x175, 0x5ca: 0xfd, 0x5cb: 0x176, 0x5cc: 0x9c, 0x5cd: 0x177, 0x5ce: 0xfd, 0x5cf: 0xfd, + 0x5d0: 0x5e, 0x5d1: 0x5f, 0x5d2: 0x60, 0x5d3: 0x61, 0x5d4: 0x62, 0x5d5: 0x63, 0x5d6: 0x64, 0x5d7: 0x65, + 0x5d8: 0x66, 0x5d9: 0x67, 0x5da: 0x68, 0x5db: 0x69, 0x5dc: 0x6a, 0x5dd: 0x6b, 0x5de: 0x6c, 0x5df: 0x6d, 0x5e0: 0x9c, 0x5e1: 0x9c, 0x5e2: 0x9c, 0x5e3: 0x9c, 0x5e4: 0x9c, 0x5e5: 0x9c, 0x5e6: 0x9c, 0x5e7: 0x9c, - 0x5e8: 0x176, 0x5e9: 0x177, 0x5ea: 0x178, 0x5eb: 0xfb, 0x5ec: 0xfb, 0x5ed: 0xfb, 0x5ee: 0xfb, 0x5ef: 0xfb, - 0x5f0: 0xfb, 0x5f1: 0xfb, 0x5f2: 0xfb, 0x5f3: 0xfb, 0x5f4: 0xfb, 0x5f5: 0xfb, 0x5f6: 0xfb, 0x5f7: 0xfb, - 0x5f8: 0xfb, 0x5f9: 0xfb, 0x5fa: 0xfb, 0x5fb: 0xfb, 0x5fc: 0xfb, 0x5fd: 0xfb, 0x5fe: 0xfb, 0x5ff: 0xfb, + 0x5e8: 0x178, 0x5e9: 0x179, 0x5ea: 0x17a, 0x5eb: 0xfd, 0x5ec: 0xfd, 0x5ed: 0xfd, 0x5ee: 0xfd, 0x5ef: 0xfd, + 0x5f0: 0xfd, 0x5f1: 0xfd, 0x5f2: 0xfd, 0x5f3: 0xfd, 0x5f4: 0xfd, 0x5f5: 0xfd, 0x5f6: 0xfd, 0x5f7: 0xfd, + 0x5f8: 0xfd, 0x5f9: 0xfd, 0x5fa: 0xfd, 0x5fb: 0xfd, 0x5fc: 0xfd, 0x5fd: 0xfd, 0x5fe: 0xfd, 0x5ff: 0xfd, // Block 0x18, offset 0x600 - 0x600: 0x179, 0x601: 0xfb, 0x602: 0xfb, 0x603: 0xfb, 0x604: 0x17a, 0x605: 0x17b, 0x606: 0xfb, 0x607: 0xfb, - 0x608: 0xfb, 0x609: 0xfb, 0x60a: 0xfb, 0x60b: 0x17c, 0x60c: 0xfb, 0x60d: 0xfb, 0x60e: 0xfb, 0x60f: 0xfb, - 0x610: 0xfb, 0x611: 0xfb, 0x612: 0xfb, 0x613: 0xfb, 0x614: 0xfb, 0x615: 0xfb, 0x616: 0xfb, 0x617: 0xfb, - 0x618: 0xfb, 0x619: 0xfb, 0x61a: 0xfb, 0x61b: 0xfb, 0x61c: 0xfb, 0x61d: 0xfb, 0x61e: 0xfb, 0x61f: 0xfb, - 0x620: 0x123, 0x621: 0x123, 0x622: 0x123, 0x623: 0x17d, 0x624: 0x70, 0x625: 0x17e, 0x626: 0xfb, 0x627: 0xfb, - 0x628: 0xfb, 0x629: 0xfb, 0x62a: 0xfb, 0x62b: 0xfb, 0x62c: 0xfb, 0x62d: 0xfb, 0x62e: 0xfb, 0x62f: 0xfb, - 0x630: 0xfb, 0x631: 0x17f, 0x632: 0x180, 0x633: 0xfb, 0x634: 0x181, 0x635: 0xfb, 0x636: 0xfb, 0x637: 0xfb, - 0x638: 0x71, 0x639: 0x72, 0x63a: 0x73, 0x63b: 0x182, 0x63c: 0xfb, 0x63d: 0xfb, 0x63e: 0xfb, 0x63f: 0xfb, + 0x600: 0x17b, 0x601: 0xfd, 0x602: 0xfd, 0x603: 0xfd, 0x604: 0x17c, 0x605: 0x17d, 0x606: 0xfd, 0x607: 0xfd, + 0x608: 0xfd, 0x609: 0xfd, 0x60a: 0xfd, 0x60b: 0x17e, 0x60c: 0xfd, 0x60d: 0xfd, 0x60e: 0xfd, 0x60f: 0xfd, + 0x610: 0xfd, 0x611: 0xfd, 0x612: 0xfd, 0x613: 0xfd, 0x614: 0xfd, 0x615: 0xfd, 0x616: 0xfd, 0x617: 0xfd, + 0x618: 0xfd, 0x619: 0xfd, 0x61a: 0xfd, 0x61b: 0xfd, 0x61c: 0xfd, 0x61d: 0xfd, 0x61e: 0xfd, 0x61f: 0xfd, + 0x620: 0x125, 0x621: 0x125, 0x622: 0x125, 0x623: 0x17f, 0x624: 0x6e, 0x625: 0x180, 0x626: 0xfd, 0x627: 0xfd, + 0x628: 0xfd, 0x629: 0xfd, 0x62a: 0xfd, 0x62b: 0xfd, 0x62c: 0xfd, 0x62d: 0xfd, 0x62e: 0xfd, 0x62f: 0xfd, + 0x630: 0xfd, 0x631: 0x181, 0x632: 0x182, 0x633: 0xfd, 0x634: 0x183, 0x635: 0xfd, 0x636: 0xfd, 0x637: 0xfd, + 0x638: 0x6f, 0x639: 0x70, 0x63a: 0x71, 0x63b: 0x184, 0x63c: 0xfd, 0x63d: 0xfd, 0x63e: 0xfd, 0x63f: 0xfd, // Block 0x19, offset 0x640 - 0x640: 0x183, 0x641: 0x9c, 0x642: 0x184, 0x643: 0x185, 0x644: 0x74, 0x645: 0x75, 0x646: 0x186, 0x647: 0x187, - 0x648: 0x76, 0x649: 0x188, 0x64a: 0xfb, 0x64b: 0xfb, 0x64c: 0x9c, 0x64d: 0x9c, 0x64e: 0x9c, 0x64f: 0x9c, + 0x640: 0x185, 0x641: 0x9c, 0x642: 0x186, 0x643: 0x187, 0x644: 0x72, 0x645: 0x73, 0x646: 0x188, 0x647: 0x189, + 0x648: 0x74, 0x649: 0x18a, 0x64a: 0xfd, 0x64b: 0xfd, 0x64c: 0x9c, 0x64d: 0x9c, 0x64e: 0x9c, 0x64f: 0x9c, 0x650: 0x9c, 0x651: 0x9c, 0x652: 0x9c, 0x653: 0x9c, 0x654: 0x9c, 0x655: 0x9c, 0x656: 0x9c, 0x657: 0x9c, - 0x658: 0x9c, 0x659: 0x9c, 0x65a: 0x9c, 0x65b: 0x189, 0x65c: 0x9c, 0x65d: 0x18a, 0x65e: 0x9c, 0x65f: 0x18b, - 0x660: 0x18c, 0x661: 0x18d, 0x662: 0x18e, 0x663: 0xfb, 0x664: 0x9c, 0x665: 0x18f, 0x666: 0x9c, 0x667: 0x190, - 0x668: 0x9c, 0x669: 0x191, 0x66a: 0x192, 0x66b: 0x193, 0x66c: 0x9c, 0x66d: 0x9c, 0x66e: 0x194, 0x66f: 0x195, - 0x670: 0xfb, 0x671: 0xfb, 0x672: 0xfb, 0x673: 0xfb, 0x674: 0xfb, 0x675: 0xfb, 0x676: 0xfb, 0x677: 0xfb, - 0x678: 0xfb, 0x679: 0xfb, 0x67a: 0xfb, 0x67b: 0xfb, 0x67c: 0xfb, 0x67d: 0xfb, 0x67e: 0xfb, 0x67f: 0xfb, + 0x658: 0x9c, 0x659: 0x9c, 0x65a: 0x9c, 0x65b: 0x18b, 0x65c: 0x9c, 0x65d: 0x18c, 0x65e: 0x9c, 0x65f: 0x18d, + 0x660: 0x18e, 0x661: 0x18f, 0x662: 0x190, 0x663: 0xfd, 0x664: 0x9c, 0x665: 0x191, 0x666: 0x9c, 0x667: 0x192, + 0x668: 0x9c, 0x669: 0x193, 0x66a: 0x194, 0x66b: 0x195, 0x66c: 0x9c, 0x66d: 0x9c, 0x66e: 0x196, 0x66f: 0x197, + 0x670: 0xfd, 0x671: 0xfd, 0x672: 0xfd, 0x673: 0xfd, 0x674: 0xfd, 0x675: 0xfd, 0x676: 0xfd, 0x677: 0xfd, + 0x678: 0xfd, 0x679: 0xfd, 0x67a: 0xfd, 0x67b: 0xfd, 0x67c: 0xfd, 0x67d: 0xfd, 0x67e: 0xfd, 0x67f: 0xfd, // Block 0x1a, offset 0x680 0x680: 0xa0, 0x681: 0xa0, 0x682: 0xa0, 0x683: 0xa0, 0x684: 0xa0, 0x685: 0xa0, 0x686: 0xa0, 0x687: 0xa0, 0x688: 0xa0, 0x689: 0xa0, 0x68a: 0xa0, 0x68b: 0xa0, 0x68c: 0xa0, 0x68d: 0xa0, 0x68e: 0xa0, 0x68f: 0xa0, 0x690: 0xa0, 0x691: 0xa0, 0x692: 0xa0, 0x693: 0xa0, 0x694: 0xa0, 0x695: 0xa0, 0x696: 0xa0, 0x697: 0xa0, - 0x698: 0xa0, 0x699: 0xa0, 0x69a: 0xa0, 0x69b: 0x196, 0x69c: 0xa0, 0x69d: 0xa0, 0x69e: 0xa0, 0x69f: 0xa0, + 0x698: 0xa0, 0x699: 0xa0, 0x69a: 0xa0, 0x69b: 0x198, 0x69c: 0xa0, 0x69d: 0xa0, 0x69e: 0xa0, 0x69f: 0xa0, 0x6a0: 0xa0, 0x6a1: 0xa0, 0x6a2: 0xa0, 0x6a3: 0xa0, 0x6a4: 0xa0, 0x6a5: 0xa0, 0x6a6: 0xa0, 0x6a7: 0xa0, 0x6a8: 0xa0, 0x6a9: 0xa0, 0x6aa: 0xa0, 0x6ab: 0xa0, 0x6ac: 0xa0, 0x6ad: 0xa0, 0x6ae: 0xa0, 0x6af: 0xa0, 0x6b0: 0xa0, 0x6b1: 0xa0, 0x6b2: 0xa0, 0x6b3: 0xa0, 0x6b4: 0xa0, 0x6b5: 0xa0, 0x6b6: 0xa0, 0x6b7: 0xa0, @@ -2312,8 +2455,8 @@ var idnaIndex = [2368]uint16{ 0x6c0: 0xa0, 0x6c1: 0xa0, 0x6c2: 0xa0, 0x6c3: 0xa0, 0x6c4: 0xa0, 0x6c5: 0xa0, 0x6c6: 0xa0, 0x6c7: 0xa0, 0x6c8: 0xa0, 0x6c9: 0xa0, 0x6ca: 0xa0, 0x6cb: 0xa0, 0x6cc: 0xa0, 0x6cd: 0xa0, 0x6ce: 0xa0, 0x6cf: 0xa0, 0x6d0: 0xa0, 0x6d1: 0xa0, 0x6d2: 0xa0, 0x6d3: 0xa0, 0x6d4: 0xa0, 0x6d5: 0xa0, 0x6d6: 0xa0, 0x6d7: 0xa0, - 0x6d8: 0xa0, 0x6d9: 0xa0, 0x6da: 0xa0, 0x6db: 0xa0, 0x6dc: 0x197, 0x6dd: 0xa0, 0x6de: 0xa0, 0x6df: 0xa0, - 0x6e0: 0x198, 0x6e1: 0xa0, 0x6e2: 0xa0, 0x6e3: 0xa0, 0x6e4: 0xa0, 0x6e5: 0xa0, 0x6e6: 0xa0, 0x6e7: 0xa0, + 0x6d8: 0xa0, 0x6d9: 0xa0, 0x6da: 0xa0, 0x6db: 0xa0, 0x6dc: 0x199, 0x6dd: 0xa0, 0x6de: 0xa0, 0x6df: 0xa0, + 0x6e0: 0x19a, 0x6e1: 0xa0, 0x6e2: 0xa0, 0x6e3: 0xa0, 0x6e4: 0xa0, 0x6e5: 0xa0, 0x6e6: 0xa0, 0x6e7: 0xa0, 0x6e8: 0xa0, 0x6e9: 0xa0, 0x6ea: 0xa0, 0x6eb: 0xa0, 0x6ec: 0xa0, 0x6ed: 0xa0, 0x6ee: 0xa0, 0x6ef: 0xa0, 0x6f0: 0xa0, 0x6f1: 0xa0, 0x6f2: 0xa0, 0x6f3: 0xa0, 0x6f4: 0xa0, 0x6f5: 0xa0, 0x6f6: 0xa0, 0x6f7: 0xa0, 0x6f8: 0xa0, 0x6f9: 0xa0, 0x6fa: 0xa0, 0x6fb: 0xa0, 0x6fc: 0xa0, 0x6fd: 0xa0, 0x6fe: 0xa0, 0x6ff: 0xa0, @@ -2325,34 +2468,34 @@ var idnaIndex = [2368]uint16{ 0x720: 0xa0, 0x721: 0xa0, 0x722: 0xa0, 0x723: 0xa0, 0x724: 0xa0, 0x725: 0xa0, 0x726: 0xa0, 0x727: 0xa0, 0x728: 0xa0, 0x729: 0xa0, 0x72a: 0xa0, 0x72b: 0xa0, 0x72c: 0xa0, 0x72d: 0xa0, 0x72e: 0xa0, 0x72f: 0xa0, 0x730: 0xa0, 0x731: 0xa0, 0x732: 0xa0, 0x733: 0xa0, 0x734: 0xa0, 0x735: 0xa0, 0x736: 0xa0, 0x737: 0xa0, - 0x738: 0xa0, 0x739: 0xa0, 0x73a: 0x199, 0x73b: 0xa0, 0x73c: 0xa0, 0x73d: 0xa0, 0x73e: 0xa0, 0x73f: 0xa0, + 0x738: 0xa0, 0x739: 0xa0, 0x73a: 0x19b, 0x73b: 0xa0, 0x73c: 0xa0, 0x73d: 0xa0, 0x73e: 0xa0, 0x73f: 0xa0, // Block 0x1d, offset 0x740 0x740: 0xa0, 0x741: 0xa0, 0x742: 0xa0, 0x743: 0xa0, 0x744: 0xa0, 0x745: 0xa0, 0x746: 0xa0, 0x747: 0xa0, 0x748: 0xa0, 0x749: 0xa0, 0x74a: 0xa0, 0x74b: 0xa0, 0x74c: 0xa0, 0x74d: 0xa0, 0x74e: 0xa0, 0x74f: 0xa0, 0x750: 0xa0, 0x751: 0xa0, 0x752: 0xa0, 0x753: 0xa0, 0x754: 0xa0, 0x755: 0xa0, 0x756: 0xa0, 0x757: 0xa0, 0x758: 0xa0, 0x759: 0xa0, 0x75a: 0xa0, 0x75b: 0xa0, 0x75c: 0xa0, 0x75d: 0xa0, 0x75e: 0xa0, 0x75f: 0xa0, 0x760: 0xa0, 0x761: 0xa0, 0x762: 0xa0, 0x763: 0xa0, 0x764: 0xa0, 0x765: 0xa0, 0x766: 0xa0, 0x767: 0xa0, - 0x768: 0xa0, 0x769: 0xa0, 0x76a: 0xa0, 0x76b: 0xa0, 0x76c: 0xa0, 0x76d: 0xa0, 0x76e: 0xa0, 0x76f: 0x19a, - 0x770: 0xfb, 0x771: 0xfb, 0x772: 0xfb, 0x773: 0xfb, 0x774: 0xfb, 0x775: 0xfb, 0x776: 0xfb, 0x777: 0xfb, - 0x778: 0xfb, 0x779: 0xfb, 0x77a: 0xfb, 0x77b: 0xfb, 0x77c: 0xfb, 0x77d: 0xfb, 0x77e: 0xfb, 0x77f: 0xfb, + 0x768: 0xa0, 0x769: 0xa0, 0x76a: 0xa0, 0x76b: 0xa0, 0x76c: 0xa0, 0x76d: 0xa0, 0x76e: 0xa0, 0x76f: 0x19c, + 0x770: 0xfd, 0x771: 0xfd, 0x772: 0xfd, 0x773: 0xfd, 0x774: 0xfd, 0x775: 0xfd, 0x776: 0xfd, 0x777: 0xfd, + 0x778: 0xfd, 0x779: 0xfd, 0x77a: 0xfd, 0x77b: 0xfd, 0x77c: 0xfd, 0x77d: 0xfd, 0x77e: 0xfd, 0x77f: 0xfd, // Block 0x1e, offset 0x780 - 0x780: 0xfb, 0x781: 0xfb, 0x782: 0xfb, 0x783: 0xfb, 0x784: 0xfb, 0x785: 0xfb, 0x786: 0xfb, 0x787: 0xfb, - 0x788: 0xfb, 0x789: 0xfb, 0x78a: 0xfb, 0x78b: 0xfb, 0x78c: 0xfb, 0x78d: 0xfb, 0x78e: 0xfb, 0x78f: 0xfb, - 0x790: 0xfb, 0x791: 0xfb, 0x792: 0xfb, 0x793: 0xfb, 0x794: 0xfb, 0x795: 0xfb, 0x796: 0xfb, 0x797: 0xfb, - 0x798: 0xfb, 0x799: 0xfb, 0x79a: 0xfb, 0x79b: 0xfb, 0x79c: 0xfb, 0x79d: 0xfb, 0x79e: 0xfb, 0x79f: 0xfb, - 0x7a0: 0x77, 0x7a1: 0x78, 0x7a2: 0x79, 0x7a3: 0x19b, 0x7a4: 0x7a, 0x7a5: 0x7b, 0x7a6: 0x19c, 0x7a7: 0x7c, - 0x7a8: 0x7d, 0x7a9: 0xfb, 0x7aa: 0xfb, 0x7ab: 0xfb, 0x7ac: 0xfb, 0x7ad: 0xfb, 0x7ae: 0xfb, 0x7af: 0xfb, - 0x7b0: 0xfb, 0x7b1: 0xfb, 0x7b2: 0xfb, 0x7b3: 0xfb, 0x7b4: 0xfb, 0x7b5: 0xfb, 0x7b6: 0xfb, 0x7b7: 0xfb, - 0x7b8: 0xfb, 0x7b9: 0xfb, 0x7ba: 0xfb, 0x7bb: 0xfb, 0x7bc: 0xfb, 0x7bd: 0xfb, 0x7be: 0xfb, 0x7bf: 0xfb, + 0x780: 0xfd, 0x781: 0xfd, 0x782: 0xfd, 0x783: 0xfd, 0x784: 0xfd, 0x785: 0xfd, 0x786: 0xfd, 0x787: 0xfd, + 0x788: 0xfd, 0x789: 0xfd, 0x78a: 0xfd, 0x78b: 0xfd, 0x78c: 0xfd, 0x78d: 0xfd, 0x78e: 0xfd, 0x78f: 0xfd, + 0x790: 0xfd, 0x791: 0xfd, 0x792: 0xfd, 0x793: 0xfd, 0x794: 0xfd, 0x795: 0xfd, 0x796: 0xfd, 0x797: 0xfd, + 0x798: 0xfd, 0x799: 0xfd, 0x79a: 0xfd, 0x79b: 0xfd, 0x79c: 0xfd, 0x79d: 0xfd, 0x79e: 0xfd, 0x79f: 0xfd, + 0x7a0: 0x75, 0x7a1: 0x76, 0x7a2: 0x77, 0x7a3: 0x78, 0x7a4: 0x79, 0x7a5: 0x7a, 0x7a6: 0x7b, 0x7a7: 0x7c, + 0x7a8: 0x7d, 0x7a9: 0xfd, 0x7aa: 0xfd, 0x7ab: 0xfd, 0x7ac: 0xfd, 0x7ad: 0xfd, 0x7ae: 0xfd, 0x7af: 0xfd, + 0x7b0: 0xfd, 0x7b1: 0xfd, 0x7b2: 0xfd, 0x7b3: 0xfd, 0x7b4: 0xfd, 0x7b5: 0xfd, 0x7b6: 0xfd, 0x7b7: 0xfd, + 0x7b8: 0xfd, 0x7b9: 0xfd, 0x7ba: 0xfd, 0x7bb: 0xfd, 0x7bc: 0xfd, 0x7bd: 0xfd, 0x7be: 0xfd, 0x7bf: 0xfd, // Block 0x1f, offset 0x7c0 0x7c0: 0xa0, 0x7c1: 0xa0, 0x7c2: 0xa0, 0x7c3: 0xa0, 0x7c4: 0xa0, 0x7c5: 0xa0, 0x7c6: 0xa0, 0x7c7: 0xa0, - 0x7c8: 0xa0, 0x7c9: 0xa0, 0x7ca: 0xa0, 0x7cb: 0xa0, 0x7cc: 0xa0, 0x7cd: 0x19d, 0x7ce: 0xfb, 0x7cf: 0xfb, - 0x7d0: 0xfb, 0x7d1: 0xfb, 0x7d2: 0xfb, 0x7d3: 0xfb, 0x7d4: 0xfb, 0x7d5: 0xfb, 0x7d6: 0xfb, 0x7d7: 0xfb, - 0x7d8: 0xfb, 0x7d9: 0xfb, 0x7da: 0xfb, 0x7db: 0xfb, 0x7dc: 0xfb, 0x7dd: 0xfb, 0x7de: 0xfb, 0x7df: 0xfb, - 0x7e0: 0xfb, 0x7e1: 0xfb, 0x7e2: 0xfb, 0x7e3: 0xfb, 0x7e4: 0xfb, 0x7e5: 0xfb, 0x7e6: 0xfb, 0x7e7: 0xfb, - 0x7e8: 0xfb, 0x7e9: 0xfb, 0x7ea: 0xfb, 0x7eb: 0xfb, 0x7ec: 0xfb, 0x7ed: 0xfb, 0x7ee: 0xfb, 0x7ef: 0xfb, - 0x7f0: 0xfb, 0x7f1: 0xfb, 0x7f2: 0xfb, 0x7f3: 0xfb, 0x7f4: 0xfb, 0x7f5: 0xfb, 0x7f6: 0xfb, 0x7f7: 0xfb, - 0x7f8: 0xfb, 0x7f9: 0xfb, 0x7fa: 0xfb, 0x7fb: 0xfb, 0x7fc: 0xfb, 0x7fd: 0xfb, 0x7fe: 0xfb, 0x7ff: 0xfb, + 0x7c8: 0xa0, 0x7c9: 0xa0, 0x7ca: 0xa0, 0x7cb: 0xa0, 0x7cc: 0xa0, 0x7cd: 0x19d, 0x7ce: 0xfd, 0x7cf: 0xfd, + 0x7d0: 0xfd, 0x7d1: 0xfd, 0x7d2: 0xfd, 0x7d3: 0xfd, 0x7d4: 0xfd, 0x7d5: 0xfd, 0x7d6: 0xfd, 0x7d7: 0xfd, + 0x7d8: 0xfd, 0x7d9: 0xfd, 0x7da: 0xfd, 0x7db: 0xfd, 0x7dc: 0xfd, 0x7dd: 0xfd, 0x7de: 0xfd, 0x7df: 0xfd, + 0x7e0: 0xfd, 0x7e1: 0xfd, 0x7e2: 0xfd, 0x7e3: 0xfd, 0x7e4: 0xfd, 0x7e5: 0xfd, 0x7e6: 0xfd, 0x7e7: 0xfd, + 0x7e8: 0xfd, 0x7e9: 0xfd, 0x7ea: 0xfd, 0x7eb: 0xfd, 0x7ec: 0xfd, 0x7ed: 0xfd, 0x7ee: 0xfd, 0x7ef: 0xfd, + 0x7f0: 0xfd, 0x7f1: 0xfd, 0x7f2: 0xfd, 0x7f3: 0xfd, 0x7f4: 0xfd, 0x7f5: 0xfd, 0x7f6: 0xfd, 0x7f7: 0xfd, + 0x7f8: 0xfd, 0x7f9: 0xfd, 0x7fa: 0xfd, 0x7fb: 0xfd, 0x7fc: 0xfd, 0x7fd: 0xfd, 0x7fe: 0xfd, 0x7ff: 0xfd, // Block 0x20, offset 0x800 0x810: 0x0d, 0x811: 0x0e, 0x812: 0x0f, 0x813: 0x10, 0x814: 0x11, 0x815: 0x0b, 0x816: 0x12, 0x817: 0x07, 0x818: 0x13, 0x819: 0x0b, 0x81a: 0x0b, 0x81b: 0x14, 0x81c: 0x0b, 0x81d: 0x15, 0x81e: 0x16, 0x81f: 0x17, @@ -2370,14 +2513,14 @@ var idnaIndex = [2368]uint16{ 0x870: 0x0b, 0x871: 0x0b, 0x872: 0x0b, 0x873: 0x0b, 0x874: 0x0b, 0x875: 0x0b, 0x876: 0x0b, 0x877: 0x0b, 0x878: 0x0b, 0x879: 0x0b, 0x87a: 0x0b, 0x87b: 0x0b, 0x87c: 0x0b, 0x87d: 0x0b, 0x87e: 0x0b, 0x87f: 0x0b, // Block 0x22, offset 0x880 - 0x880: 0x19e, 0x881: 0x19f, 0x882: 0xfb, 0x883: 0xfb, 0x884: 0x1a0, 0x885: 0x1a0, 0x886: 0x1a0, 0x887: 0x1a1, - 0x888: 0xfb, 0x889: 0xfb, 0x88a: 0xfb, 0x88b: 0xfb, 0x88c: 0xfb, 0x88d: 0xfb, 0x88e: 0xfb, 0x88f: 0xfb, - 0x890: 0xfb, 0x891: 0xfb, 0x892: 0xfb, 0x893: 0xfb, 0x894: 0xfb, 0x895: 0xfb, 0x896: 0xfb, 0x897: 0xfb, - 0x898: 0xfb, 0x899: 0xfb, 0x89a: 0xfb, 0x89b: 0xfb, 0x89c: 0xfb, 0x89d: 0xfb, 0x89e: 0xfb, 0x89f: 0xfb, - 0x8a0: 0xfb, 0x8a1: 0xfb, 0x8a2: 0xfb, 0x8a3: 0xfb, 0x8a4: 0xfb, 0x8a5: 0xfb, 0x8a6: 0xfb, 0x8a7: 0xfb, - 0x8a8: 0xfb, 0x8a9: 0xfb, 0x8aa: 0xfb, 0x8ab: 0xfb, 0x8ac: 0xfb, 0x8ad: 0xfb, 0x8ae: 0xfb, 0x8af: 0xfb, - 0x8b0: 0xfb, 0x8b1: 0xfb, 0x8b2: 0xfb, 0x8b3: 0xfb, 0x8b4: 0xfb, 0x8b5: 0xfb, 0x8b6: 0xfb, 0x8b7: 0xfb, - 0x8b8: 0xfb, 0x8b9: 0xfb, 0x8ba: 0xfb, 0x8bb: 0xfb, 0x8bc: 0xfb, 0x8bd: 0xfb, 0x8be: 0xfb, 0x8bf: 0xfb, + 0x880: 0x19e, 0x881: 0x19f, 0x882: 0xfd, 0x883: 0xfd, 0x884: 0x1a0, 0x885: 0x1a0, 0x886: 0x1a0, 0x887: 0x1a1, + 0x888: 0xfd, 0x889: 0xfd, 0x88a: 0xfd, 0x88b: 0xfd, 0x88c: 0xfd, 0x88d: 0xfd, 0x88e: 0xfd, 0x88f: 0xfd, + 0x890: 0xfd, 0x891: 0xfd, 0x892: 0xfd, 0x893: 0xfd, 0x894: 0xfd, 0x895: 0xfd, 0x896: 0xfd, 0x897: 0xfd, + 0x898: 0xfd, 0x899: 0xfd, 0x89a: 0xfd, 0x89b: 0xfd, 0x89c: 0xfd, 0x89d: 0xfd, 0x89e: 0xfd, 0x89f: 0xfd, + 0x8a0: 0xfd, 0x8a1: 0xfd, 0x8a2: 0xfd, 0x8a3: 0xfd, 0x8a4: 0xfd, 0x8a5: 0xfd, 0x8a6: 0xfd, 0x8a7: 0xfd, + 0x8a8: 0xfd, 0x8a9: 0xfd, 0x8aa: 0xfd, 0x8ab: 0xfd, 0x8ac: 0xfd, 0x8ad: 0xfd, 0x8ae: 0xfd, 0x8af: 0xfd, + 0x8b0: 0xfd, 0x8b1: 0xfd, 0x8b2: 0xfd, 0x8b3: 0xfd, 0x8b4: 0xfd, 0x8b5: 0xfd, 0x8b6: 0xfd, 0x8b7: 0xfd, + 0x8b8: 0xfd, 0x8b9: 0xfd, 0x8ba: 0xfd, 0x8bb: 0xfd, 0x8bc: 0xfd, 0x8bd: 0xfd, 0x8be: 0xfd, 0x8bf: 0xfd, // Block 0x23, offset 0x8c0 0x8c0: 0x0b, 0x8c1: 0x0b, 0x8c2: 0x0b, 0x8c3: 0x0b, 0x8c4: 0x0b, 0x8c5: 0x0b, 0x8c6: 0x0b, 0x8c7: 0x0b, 0x8c8: 0x0b, 0x8c9: 0x0b, 0x8ca: 0x0b, 0x8cb: 0x0b, 0x8cc: 0x0b, 0x8cd: 0x0b, 0x8ce: 0x0b, 0x8cf: 0x0b, @@ -2393,10 +2536,10 @@ var idnaIndex = [2368]uint16{ } // idnaSparseOffset: 292 entries, 584 bytes -var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x85, 0x8b, 0x94, 0xa4, 0xb2, 0xbd, 0xca, 0xdb, 0xe5, 0xec, 0xf9, 0x10a, 0x111, 0x11c, 0x12b, 0x139, 0x143, 0x145, 0x14a, 0x14d, 0x150, 0x152, 0x15e, 0x169, 0x171, 0x177, 0x17d, 0x182, 0x187, 0x18a, 0x18e, 0x194, 0x199, 0x1a5, 0x1af, 0x1b5, 0x1c6, 0x1d0, 0x1d3, 0x1db, 0x1de, 0x1eb, 0x1f3, 0x1f7, 0x1fe, 0x206, 0x216, 0x222, 0x225, 0x22f, 0x23b, 0x247, 0x253, 0x25b, 0x260, 0x26d, 0x27e, 0x282, 0x28d, 0x291, 0x29a, 0x2a2, 0x2a8, 0x2ad, 0x2b0, 0x2b4, 0x2ba, 0x2be, 0x2c2, 0x2c6, 0x2cc, 0x2d4, 0x2db, 0x2e6, 0x2f0, 0x2f4, 0x2f7, 0x2fd, 0x301, 0x303, 0x306, 0x308, 0x30b, 0x315, 0x318, 0x327, 0x32b, 0x330, 0x333, 0x337, 0x33c, 0x341, 0x347, 0x358, 0x368, 0x36e, 0x372, 0x381, 0x386, 0x38e, 0x398, 0x3a3, 0x3ab, 0x3bc, 0x3c5, 0x3d5, 0x3e2, 0x3ee, 0x3f3, 0x400, 0x404, 0x409, 0x40b, 0x40d, 0x411, 0x413, 0x417, 0x420, 0x426, 0x42a, 0x43a, 0x444, 0x449, 0x44c, 0x452, 0x459, 0x45e, 0x462, 0x468, 0x46d, 0x476, 0x47b, 0x481, 0x488, 0x48f, 0x496, 0x49a, 0x49f, 0x4a2, 0x4a7, 0x4b3, 0x4b9, 0x4be, 0x4c5, 0x4cd, 0x4d2, 0x4d6, 0x4e6, 0x4ed, 0x4f1, 0x4f5, 0x4fc, 0x4fe, 0x501, 0x504, 0x508, 0x511, 0x515, 0x51d, 0x525, 0x52d, 0x539, 0x545, 0x54b, 0x554, 0x560, 0x567, 0x570, 0x57b, 0x582, 0x591, 0x59e, 0x5ab, 0x5b4, 0x5b8, 0x5c7, 0x5cf, 0x5da, 0x5e3, 0x5e9, 0x5f1, 0x5fa, 0x605, 0x608, 0x614, 0x61d, 0x620, 0x625, 0x62e, 0x633, 0x640, 0x64b, 0x654, 0x65e, 0x661, 0x66b, 0x674, 0x680, 0x68d, 0x69a, 0x6a8, 0x6af, 0x6b3, 0x6b7, 0x6ba, 0x6bf, 0x6c2, 0x6c7, 0x6ca, 0x6d1, 0x6d8, 0x6dc, 0x6e7, 0x6ea, 0x6ed, 0x6f0, 0x6f6, 0x6fc, 0x705, 0x708, 0x70b, 0x70e, 0x711, 0x718, 0x71b, 0x720, 0x72a, 0x72d, 0x731, 0x740, 0x74c, 0x750, 0x755, 0x759, 0x75e, 0x762, 0x767, 0x770, 0x77b, 0x781, 0x787, 0x78d, 0x793, 0x79c, 0x79f, 0x7a2, 0x7a6, 0x7aa, 0x7ae, 0x7b4, 0x7ba, 0x7bf, 0x7c2, 0x7d2, 0x7d9, 0x7dc, 0x7e1, 0x7e5, 0x7eb, 0x7f2, 0x7f6, 0x7fa, 0x803, 0x80a, 0x80f, 0x813, 0x821, 0x824, 0x827, 0x82b, 0x82f, 0x832, 0x842, 0x853, 0x856, 0x85b, 0x85d, 0x85f} +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x85, 0x8b, 0x94, 0xa4, 0xb2, 0xbd, 0xca, 0xdb, 0xe5, 0xec, 0xf9, 0x10a, 0x111, 0x11c, 0x12b, 0x139, 0x143, 0x145, 0x14a, 0x14d, 0x150, 0x152, 0x15e, 0x169, 0x171, 0x177, 0x17d, 0x182, 0x187, 0x18a, 0x18e, 0x194, 0x199, 0x1a5, 0x1af, 0x1b5, 0x1c6, 0x1d0, 0x1d3, 0x1db, 0x1de, 0x1eb, 0x1f3, 0x1f7, 0x1fe, 0x206, 0x216, 0x222, 0x225, 0x22f, 0x23b, 0x247, 0x253, 0x25b, 0x260, 0x26d, 0x27e, 0x282, 0x28d, 0x291, 0x29a, 0x2a2, 0x2a8, 0x2ad, 0x2b0, 0x2b4, 0x2ba, 0x2be, 0x2c2, 0x2c6, 0x2cc, 0x2d4, 0x2db, 0x2e6, 0x2f0, 0x2f4, 0x2f7, 0x2fd, 0x301, 0x303, 0x306, 0x308, 0x30b, 0x315, 0x318, 0x327, 0x32b, 0x32f, 0x331, 0x33a, 0x33d, 0x341, 0x346, 0x34b, 0x351, 0x362, 0x372, 0x378, 0x37c, 0x38b, 0x390, 0x398, 0x3a2, 0x3ad, 0x3b5, 0x3c6, 0x3cf, 0x3df, 0x3ec, 0x3f8, 0x3fd, 0x40a, 0x40e, 0x413, 0x415, 0x417, 0x41b, 0x41d, 0x421, 0x42a, 0x430, 0x434, 0x444, 0x44e, 0x453, 0x456, 0x45c, 0x463, 0x468, 0x46c, 0x472, 0x477, 0x480, 0x485, 0x48b, 0x492, 0x499, 0x4a0, 0x4a4, 0x4a9, 0x4ac, 0x4b1, 0x4bd, 0x4c3, 0x4c8, 0x4cf, 0x4d7, 0x4dc, 0x4e0, 0x4f0, 0x4f7, 0x4fb, 0x4ff, 0x506, 0x508, 0x50b, 0x50e, 0x512, 0x51b, 0x51f, 0x527, 0x52f, 0x537, 0x543, 0x54f, 0x555, 0x55e, 0x56a, 0x571, 0x57a, 0x585, 0x58c, 0x59b, 0x5a8, 0x5b5, 0x5be, 0x5c2, 0x5d1, 0x5d9, 0x5e4, 0x5ed, 0x5f3, 0x5fb, 0x604, 0x60f, 0x612, 0x61e, 0x627, 0x62a, 0x62f, 0x638, 0x63d, 0x64a, 0x655, 0x65e, 0x668, 0x66b, 0x675, 0x67e, 0x68a, 0x697, 0x6a4, 0x6b2, 0x6b9, 0x6bd, 0x6c1, 0x6c4, 0x6c9, 0x6cc, 0x6d1, 0x6d4, 0x6db, 0x6e2, 0x6e6, 0x6f1, 0x6f4, 0x6f7, 0x6fa, 0x700, 0x706, 0x70f, 0x712, 0x715, 0x718, 0x71b, 0x722, 0x725, 0x72a, 0x734, 0x737, 0x73b, 0x74a, 0x756, 0x75a, 0x75f, 0x763, 0x768, 0x76c, 0x771, 0x77a, 0x785, 0x78b, 0x791, 0x797, 0x79d, 0x7a6, 0x7a9, 0x7ac, 0x7b0, 0x7b4, 0x7b8, 0x7be, 0x7c4, 0x7c9, 0x7cc, 0x7dc, 0x7e3, 0x7e6, 0x7eb, 0x7ef, 0x7f5, 0x7fc, 0x800, 0x804, 0x80d, 0x814, 0x819, 0x81d, 0x82b, 0x82e, 0x831, 0x835, 0x839, 0x83c, 0x83f, 0x844, 0x846, 0x848} -// idnaSparseValues: 2146 entries, 8584 bytes -var idnaSparseValues = [2146]valueRange{ +// idnaSparseValues: 2123 entries, 8492 bytes +var idnaSparseValues = [2123]valueRange{ // Block 0x0, offset 0x0 {value: 0x0000, lo: 0x07}, {value: 0xe105, lo: 0x80, hi: 0x96}, @@ -2427,15 +2570,15 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x2, offset 0x19 {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0xaf}, - {value: 0x0249, lo: 0xb0, hi: 0xb0}, + {value: 0x00a9, lo: 0xb0, hi: 0xb0}, {value: 0x037d, lo: 0xb1, hi: 0xb1}, - {value: 0x0259, lo: 0xb2, hi: 0xb2}, - {value: 0x0269, lo: 0xb3, hi: 0xb3}, + {value: 0x00b1, lo: 0xb2, hi: 0xb2}, + {value: 0x00b9, lo: 0xb3, hi: 0xb3}, {value: 0x034d, lo: 0xb4, hi: 0xb4}, {value: 0x0395, lo: 0xb5, hi: 0xb5}, {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, - {value: 0x0279, lo: 0xb7, hi: 0xb7}, - {value: 0x0289, lo: 0xb8, hi: 0xb8}, + {value: 0x00c1, lo: 0xb7, hi: 0xb7}, + {value: 0x00c9, lo: 0xb8, hi: 0xb8}, {value: 0x0008, lo: 0xb9, hi: 0xbf}, // Block 0x3, offset 0x25 {value: 0x0000, lo: 0x01}, @@ -2457,7 +2600,7 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x6, offset 0x33 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x86}, - {value: 0x0401, lo: 0x87, hi: 0x87}, + {value: 0x0131, lo: 0x87, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x88}, {value: 0x0018, lo: 0x89, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0x8c}, @@ -2643,7 +2786,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x81, hi: 0xb0}, {value: 0x3308, lo: 0xb1, hi: 0xb1}, {value: 0x0008, lo: 0xb2, hi: 0xb2}, - {value: 0x08f1, lo: 0xb3, hi: 0xb3}, + {value: 0x01f1, lo: 0xb3, hi: 0xb3}, {value: 0x3308, lo: 0xb4, hi: 0xb9}, {value: 0x3b08, lo: 0xba, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbe}, @@ -2666,8 +2809,8 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8e, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0x9b}, - {value: 0x0961, lo: 0x9c, hi: 0x9c}, - {value: 0x0999, lo: 0x9d, hi: 0x9d}, + {value: 0x0201, lo: 0x9c, hi: 0x9c}, + {value: 0x0209, lo: 0x9d, hi: 0x9d}, {value: 0x0008, lo: 0x9e, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, // Block 0x18, offset 0xf9 @@ -3075,13 +3218,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbe, hi: 0xbf}, // Block 0x44, offset 0x260 {value: 0x0000, lo: 0x0c}, - {value: 0x0e29, lo: 0x80, hi: 0x80}, - {value: 0x0e41, lo: 0x81, hi: 0x81}, - {value: 0x0e59, lo: 0x82, hi: 0x82}, - {value: 0x0e71, lo: 0x83, hi: 0x83}, - {value: 0x0e89, lo: 0x84, hi: 0x85}, - {value: 0x0ea1, lo: 0x86, hi: 0x86}, - {value: 0x0eb9, lo: 0x87, hi: 0x87}, + {value: 0x02a9, lo: 0x80, hi: 0x80}, + {value: 0x02b1, lo: 0x81, hi: 0x81}, + {value: 0x02b9, lo: 0x82, hi: 0x82}, + {value: 0x02c1, lo: 0x83, hi: 0x83}, + {value: 0x02c9, lo: 0x84, hi: 0x85}, + {value: 0x02d1, lo: 0x86, hi: 0x86}, + {value: 0x02d9, lo: 0x87, hi: 0x87}, {value: 0x057d, lo: 0x88, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, {value: 0x059d, lo: 0x90, hi: 0xba}, @@ -3133,18 +3276,18 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x83, hi: 0x83}, {value: 0x0008, lo: 0x84, hi: 0x84}, {value: 0x0018, lo: 0x85, hi: 0x88}, - {value: 0x24c1, lo: 0x89, hi: 0x89}, + {value: 0x0851, lo: 0x89, hi: 0x89}, {value: 0x0018, lo: 0x8a, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, // Block 0x4a, offset 0x29a {value: 0x0000, lo: 0x07}, {value: 0x0018, lo: 0x80, hi: 0xab}, - {value: 0x24f1, lo: 0xac, hi: 0xac}, - {value: 0x2529, lo: 0xad, hi: 0xad}, + {value: 0x0859, lo: 0xac, hi: 0xac}, + {value: 0x0861, lo: 0xad, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xae}, - {value: 0x2579, lo: 0xaf, hi: 0xaf}, - {value: 0x25b1, lo: 0xb0, hi: 0xb0}, + {value: 0x0869, lo: 0xaf, hi: 0xaf}, + {value: 0x0871, lo: 0xb0, hi: 0xb0}, {value: 0x0018, lo: 0xb1, hi: 0xbf}, // Block 0x4b, offset 0x2a2 {value: 0x0000, lo: 0x05}, @@ -3166,19 +3309,19 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x4e, offset 0x2b0 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, - {value: 0x28c1, lo: 0x8c, hi: 0x8c}, + {value: 0x0929, lo: 0x8c, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0xbf}, // Block 0x4f, offset 0x2b4 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0xb3}, {value: 0x0e7e, lo: 0xb4, hi: 0xb4}, - {value: 0x292a, lo: 0xb5, hi: 0xb5}, + {value: 0x0932, lo: 0xb5, hi: 0xb5}, {value: 0x0e9e, lo: 0xb6, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, // Block 0x50, offset 0x2ba {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x9b}, - {value: 0x2941, lo: 0x9c, hi: 0x9c}, + {value: 0x0939, lo: 0x9c, hi: 0x9c}, {value: 0x0018, lo: 0x9d, hi: 0xbf}, // Block 0x51, offset 0x2be {value: 0x0000, lo: 0x03}, @@ -3277,16 +3420,16 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x80, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0x98}, {value: 0x3308, lo: 0x99, hi: 0x9a}, - {value: 0x29e2, lo: 0x9b, hi: 0x9b}, - {value: 0x2a0a, lo: 0x9c, hi: 0x9c}, + {value: 0x096a, lo: 0x9b, hi: 0x9b}, + {value: 0x0972, lo: 0x9c, hi: 0x9c}, {value: 0x0008, lo: 0x9d, hi: 0x9e}, - {value: 0x2a31, lo: 0x9f, hi: 0x9f}, + {value: 0x0979, lo: 0x9f, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa0}, {value: 0x0008, lo: 0xa1, hi: 0xbf}, // Block 0x61, offset 0x315 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbe}, - {value: 0x2a69, lo: 0xbf, hi: 0xbf}, + {value: 0x0981, lo: 0xbf, hi: 0xbf}, // Block 0x62, offset 0x318 {value: 0x0000, lo: 0x0e}, {value: 0x0040, lo: 0x80, hi: 0x84}, @@ -3309,46 +3452,58 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa4, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, // Block 0x64, offset 0x32b - {value: 0x0030, lo: 0x04}, - {value: 0x2aa2, lo: 0x80, hi: 0x9d}, - {value: 0x305a, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x03}, + {value: 0x098a, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0x9f}, - {value: 0x30a2, lo: 0xa0, hi: 0xbf}, - // Block 0x65, offset 0x330 + {value: 0x0a82, lo: 0xa0, hi: 0xbf}, + // Block 0x65, offset 0x32f + {value: 0x0008, lo: 0x01}, + {value: 0x0d19, lo: 0x80, hi: 0xbf}, + // Block 0x66, offset 0x331 + {value: 0x0008, lo: 0x08}, + {value: 0x0f19, lo: 0x80, hi: 0xb0}, + {value: 0x4045, lo: 0xb1, hi: 0xb1}, + {value: 0x10a1, lo: 0xb2, hi: 0xb3}, + {value: 0x4065, lo: 0xb4, hi: 0xb4}, + {value: 0x10b1, lo: 0xb5, hi: 0xb7}, + {value: 0x4085, lo: 0xb8, hi: 0xb8}, + {value: 0x4085, lo: 0xb9, hi: 0xb9}, + {value: 0x10c9, lo: 0xba, hi: 0xbf}, + // Block 0x67, offset 0x33a {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x66, offset 0x333 + // Block 0x68, offset 0x33d {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x8c}, {value: 0x0040, lo: 0x8d, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, - // Block 0x67, offset 0x337 + // Block 0x69, offset 0x341 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xbd}, {value: 0x0018, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x33c + // Block 0x6a, offset 0x346 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xbf}, - // Block 0x69, offset 0x341 + // Block 0x6b, offset 0x34b {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xa5}, {value: 0x0018, lo: 0xa6, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb1}, {value: 0x0018, lo: 0xb2, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0x6a, offset 0x347 + // Block 0x6c, offset 0x351 {value: 0x0000, lo: 0x10}, {value: 0x0040, lo: 0x80, hi: 0x81}, {value: 0xe00d, lo: 0x82, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0x83}, {value: 0x03f5, lo: 0x84, hi: 0x84}, - {value: 0x1329, lo: 0x85, hi: 0x85}, + {value: 0x0479, lo: 0x85, hi: 0x85}, {value: 0x447d, lo: 0x86, hi: 0x86}, {value: 0xe07d, lo: 0x87, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x88}, @@ -3357,10 +3512,10 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8b, hi: 0xb4}, {value: 0xe01d, lo: 0xb5, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xb7}, - {value: 0x2009, lo: 0xb8, hi: 0xb8}, - {value: 0x6ec1, lo: 0xb9, hi: 0xb9}, + {value: 0x0741, lo: 0xb8, hi: 0xb8}, + {value: 0x13f1, lo: 0xb9, hi: 0xb9}, {value: 0x0008, lo: 0xba, hi: 0xbf}, - // Block 0x6b, offset 0x358 + // Block 0x6d, offset 0x362 {value: 0x0000, lo: 0x0f}, {value: 0x0008, lo: 0x80, hi: 0x81}, {value: 0x3308, lo: 0x82, hi: 0x82}, @@ -3377,19 +3532,19 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x6c, offset 0x368 + // Block 0x6e, offset 0x372 {value: 0x0000, lo: 0x05}, {value: 0x0208, lo: 0x80, hi: 0xb1}, {value: 0x0108, lo: 0xb2, hi: 0xb2}, {value: 0x0008, lo: 0xb3, hi: 0xb3}, {value: 0x0018, lo: 0xb4, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0x6d, offset 0x36e + // Block 0x6f, offset 0x378 {value: 0x0000, lo: 0x03}, {value: 0x3008, lo: 0x80, hi: 0x81}, {value: 0x0008, lo: 0x82, hi: 0xb3}, {value: 0x3008, lo: 0xb4, hi: 0xbf}, - // Block 0x6e, offset 0x372 + // Block 0x70, offset 0x37c {value: 0x0000, lo: 0x0e}, {value: 0x3008, lo: 0x80, hi: 0x83}, {value: 0x3b08, lo: 0x84, hi: 0x84}, @@ -3405,13 +3560,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbc, hi: 0xbc}, {value: 0x0008, lo: 0xbd, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0x6f, offset 0x381 + // Block 0x71, offset 0x38b {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa5}, {value: 0x3308, lo: 0xa6, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x70, offset 0x386 + // Block 0x72, offset 0x390 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x3308, lo: 0x87, hi: 0x91}, @@ -3420,7 +3575,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x94, hi: 0x9e}, {value: 0x0018, lo: 0x9f, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x71, offset 0x38e + // Block 0x73, offset 0x398 {value: 0x0000, lo: 0x09}, {value: 0x3308, lo: 0x80, hi: 0x82}, {value: 0x3008, lo: 0x83, hi: 0x83}, @@ -3431,7 +3586,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xba, hi: 0xbb}, {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbf}, - // Block 0x72, offset 0x398 + // Block 0x74, offset 0x3a2 {value: 0x0000, lo: 0x0a}, {value: 0x3808, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x8d}, @@ -3443,7 +3598,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xa5, hi: 0xa5}, {value: 0x0008, lo: 0xa6, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0x73, offset 0x3a3 + // Block 0x75, offset 0x3ad {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xa8}, {value: 0x3308, lo: 0xa9, hi: 0xae}, @@ -3452,7 +3607,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb3, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x74, offset 0x3ab + // Block 0x76, offset 0x3b5 {value: 0x0000, lo: 0x10}, {value: 0x0008, lo: 0x80, hi: 0x82}, {value: 0x3308, lo: 0x83, hi: 0x83}, @@ -3470,7 +3625,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbc}, {value: 0x3008, lo: 0xbd, hi: 0xbd}, {value: 0x0008, lo: 0xbe, hi: 0xbf}, - // Block 0x75, offset 0x3bc + // Block 0x77, offset 0x3c6 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb0}, @@ -3480,7 +3635,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb7, hi: 0xb8}, {value: 0x0008, lo: 0xb9, hi: 0xbd}, {value: 0x3308, lo: 0xbe, hi: 0xbf}, - // Block 0x76, offset 0x3c5 + // Block 0x78, offset 0x3cf {value: 0x0000, lo: 0x0f}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x81}, @@ -3497,7 +3652,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb5, hi: 0xb5}, {value: 0x3b08, lo: 0xb6, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x77, offset 0x3d5 + // Block 0x79, offset 0x3df {value: 0x0000, lo: 0x0c}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x86}, @@ -3511,26 +3666,26 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa8, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x78, offset 0x3e2 + // Block 0x7a, offset 0x3ec {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x9a}, {value: 0x0018, lo: 0x9b, hi: 0x9b}, {value: 0x449d, lo: 0x9c, hi: 0x9c}, {value: 0x44b5, lo: 0x9d, hi: 0x9d}, - {value: 0x2971, lo: 0x9e, hi: 0x9e}, + {value: 0x0941, lo: 0x9e, hi: 0x9e}, {value: 0xe06d, lo: 0x9f, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa8}, - {value: 0x6ed9, lo: 0xa9, hi: 0xa9}, + {value: 0x13f9, lo: 0xa9, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x44cd, lo: 0xb0, hi: 0xbf}, - // Block 0x79, offset 0x3ee + // Block 0x7b, offset 0x3f8 {value: 0x0000, lo: 0x04}, {value: 0x44ed, lo: 0x80, hi: 0x8f}, {value: 0x450d, lo: 0x90, hi: 0x9f}, {value: 0x452d, lo: 0xa0, hi: 0xaf}, {value: 0x450d, lo: 0xb0, hi: 0xbf}, - // Block 0x7a, offset 0x3f3 + // Block 0x7c, offset 0x3fd {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0xa2}, {value: 0x3008, lo: 0xa3, hi: 0xa4}, @@ -3544,76 +3699,76 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x7b, offset 0x400 + // Block 0x7d, offset 0x40a {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbf}, - // Block 0x7c, offset 0x404 + // Block 0x7e, offset 0x40e {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8a}, {value: 0x0018, lo: 0x8b, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x7d, offset 0x409 + // Block 0x7f, offset 0x413 {value: 0x0000, lo: 0x01}, {value: 0x0040, lo: 0x80, hi: 0xbf}, - // Block 0x7e, offset 0x40b + // Block 0x80, offset 0x415 {value: 0x0020, lo: 0x01}, {value: 0x454d, lo: 0x80, hi: 0xbf}, - // Block 0x7f, offset 0x40d + // Block 0x81, offset 0x417 {value: 0x0020, lo: 0x03}, {value: 0x4d4d, lo: 0x80, hi: 0x94}, {value: 0x4b0d, lo: 0x95, hi: 0x95}, {value: 0x4fed, lo: 0x96, hi: 0xbf}, - // Block 0x80, offset 0x411 + // Block 0x82, offset 0x41b {value: 0x0020, lo: 0x01}, {value: 0x552d, lo: 0x80, hi: 0xbf}, - // Block 0x81, offset 0x413 + // Block 0x83, offset 0x41d {value: 0x0020, lo: 0x03}, {value: 0x5d2d, lo: 0x80, hi: 0x84}, {value: 0x568d, lo: 0x85, hi: 0x85}, {value: 0x5dcd, lo: 0x86, hi: 0xbf}, - // Block 0x82, offset 0x417 + // Block 0x84, offset 0x421 {value: 0x0020, lo: 0x08}, {value: 0x6b8d, lo: 0x80, hi: 0x8f}, {value: 0x6d4d, lo: 0x90, hi: 0x90}, {value: 0x6d8d, lo: 0x91, hi: 0xab}, - {value: 0x6ef1, lo: 0xac, hi: 0xac}, + {value: 0x1401, lo: 0xac, hi: 0xac}, {value: 0x70ed, lo: 0xad, hi: 0xad}, {value: 0x0040, lo: 0xae, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x710d, lo: 0xb0, hi: 0xbf}, - // Block 0x83, offset 0x420 + // Block 0x85, offset 0x42a {value: 0x0020, lo: 0x05}, {value: 0x730d, lo: 0x80, hi: 0xad}, {value: 0x656d, lo: 0xae, hi: 0xae}, {value: 0x78cd, lo: 0xaf, hi: 0xb5}, {value: 0x6f8d, lo: 0xb6, hi: 0xb6}, {value: 0x79ad, lo: 0xb7, hi: 0xbf}, - // Block 0x84, offset 0x426 - {value: 0x0028, lo: 0x03}, - {value: 0x7c71, lo: 0x80, hi: 0x82}, - {value: 0x7c31, lo: 0x83, hi: 0x83}, - {value: 0x7ce9, lo: 0x84, hi: 0xbf}, - // Block 0x85, offset 0x42a - {value: 0x0038, lo: 0x0f}, - {value: 0x9e01, lo: 0x80, hi: 0x83}, - {value: 0x9ea9, lo: 0x84, hi: 0x85}, - {value: 0x9ee1, lo: 0x86, hi: 0x87}, - {value: 0x9f19, lo: 0x88, hi: 0x8f}, + // Block 0x86, offset 0x430 + {value: 0x0008, lo: 0x03}, + {value: 0x1751, lo: 0x80, hi: 0x82}, + {value: 0x1741, lo: 0x83, hi: 0x83}, + {value: 0x1769, lo: 0x84, hi: 0xbf}, + // Block 0x87, offset 0x434 + {value: 0x0008, lo: 0x0f}, + {value: 0x1d81, lo: 0x80, hi: 0x83}, + {value: 0x1d99, lo: 0x84, hi: 0x85}, + {value: 0x1da1, lo: 0x86, hi: 0x87}, + {value: 0x1da9, lo: 0x88, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x90}, {value: 0x0040, lo: 0x91, hi: 0x91}, - {value: 0xa0d9, lo: 0x92, hi: 0x97}, - {value: 0xa1f1, lo: 0x98, hi: 0x9c}, - {value: 0xa2d1, lo: 0x9d, hi: 0xb3}, - {value: 0x9d91, lo: 0xb4, hi: 0xb4}, - {value: 0x9e01, lo: 0xb5, hi: 0xb5}, - {value: 0xa7d9, lo: 0xb6, hi: 0xbb}, - {value: 0xa8b9, lo: 0xbc, hi: 0xbc}, - {value: 0xa849, lo: 0xbd, hi: 0xbd}, - {value: 0xa929, lo: 0xbe, hi: 0xbf}, - // Block 0x86, offset 0x43a + {value: 0x1de9, lo: 0x92, hi: 0x97}, + {value: 0x1e11, lo: 0x98, hi: 0x9c}, + {value: 0x1e31, lo: 0x9d, hi: 0xb3}, + {value: 0x1d71, lo: 0xb4, hi: 0xb4}, + {value: 0x1d81, lo: 0xb5, hi: 0xb5}, + {value: 0x1ee9, lo: 0xb6, hi: 0xbb}, + {value: 0x1f09, lo: 0xbc, hi: 0xbc}, + {value: 0x1ef9, lo: 0xbd, hi: 0xbd}, + {value: 0x1f19, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x444 {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8c}, @@ -3624,24 +3779,24 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xbc, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbe}, {value: 0x0008, lo: 0xbf, hi: 0xbf}, - // Block 0x87, offset 0x444 + // Block 0x89, offset 0x44e {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x8d}, {value: 0x0040, lo: 0x8e, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0x88, offset 0x449 + // Block 0x8a, offset 0x453 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x89, offset 0x44c + // Block 0x8b, offset 0x456 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x82}, {value: 0x0040, lo: 0x83, hi: 0x86}, {value: 0x0018, lo: 0x87, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, - // Block 0x8a, offset 0x452 + // Block 0x8c, offset 0x45c {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x8e}, {value: 0x0040, lo: 0x8f, hi: 0x8f}, @@ -3649,31 +3804,31 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9d, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa0}, {value: 0x0040, lo: 0xa1, hi: 0xbf}, - // Block 0x8b, offset 0x459 + // Block 0x8d, offset 0x463 {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbc}, {value: 0x3308, lo: 0xbd, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0x8c, offset 0x45e + // Block 0x8e, offset 0x468 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x9c}, {value: 0x0040, lo: 0x9d, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x8d, offset 0x462 + // Block 0x8f, offset 0x46c {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x90}, {value: 0x0040, lo: 0x91, hi: 0x9f}, {value: 0x3308, lo: 0xa0, hi: 0xa0}, {value: 0x0018, lo: 0xa1, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x8e, offset 0x468 + // Block 0x90, offset 0x472 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xac}, {value: 0x0008, lo: 0xad, hi: 0xbf}, - // Block 0x8f, offset 0x46d + // Block 0x91, offset 0x477 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x81}, @@ -3683,20 +3838,20 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x90, hi: 0xb5}, {value: 0x3308, lo: 0xb6, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x90, offset 0x476 + // Block 0x92, offset 0x480 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9e}, {value: 0x0018, lo: 0x9f, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x91, offset 0x47b + // Block 0x93, offset 0x485 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0040, lo: 0x84, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0xbf}, - // Block 0x92, offset 0x481 + // Block 0x94, offset 0x48b {value: 0x0000, lo: 0x06}, {value: 0xe145, lo: 0x80, hi: 0x87}, {value: 0xe1c5, lo: 0x88, hi: 0x8f}, @@ -3704,7 +3859,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x8b0d, lo: 0x98, hi: 0x9f}, {value: 0x8b25, lo: 0xa0, hi: 0xa7}, {value: 0x0008, lo: 0xa8, hi: 0xbf}, - // Block 0x93, offset 0x488 + // Block 0x95, offset 0x492 {value: 0x0000, lo: 0x06}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9f}, @@ -3712,7 +3867,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xaa, hi: 0xaf}, {value: 0x8b25, lo: 0xb0, hi: 0xb7}, {value: 0x8b0d, lo: 0xb8, hi: 0xbf}, - // Block 0x94, offset 0x48f + // Block 0x96, offset 0x499 {value: 0x0000, lo: 0x06}, {value: 0xe145, lo: 0x80, hi: 0x87}, {value: 0xe1c5, lo: 0x88, hi: 0x8f}, @@ -3720,28 +3875,28 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x94, hi: 0x97}, {value: 0x0008, lo: 0x98, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x95, offset 0x496 + // Block 0x97, offset 0x4a0 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x96, offset 0x49a + // Block 0x98, offset 0x4a4 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xae}, {value: 0x0018, lo: 0xaf, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0x97, offset 0x49f + // Block 0x99, offset 0x4a9 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x98, offset 0x4a2 + // Block 0x9a, offset 0x4ac {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xbf}, - // Block 0x99, offset 0x4a7 + // Block 0x9b, offset 0x4b1 {value: 0x0000, lo: 0x0b}, {value: 0x0808, lo: 0x80, hi: 0x85}, {value: 0x0040, lo: 0x86, hi: 0x87}, @@ -3754,20 +3909,20 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xbc, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbe}, {value: 0x0808, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x4b3 + // Block 0x9c, offset 0x4bd {value: 0x0000, lo: 0x05}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x96}, {value: 0x0818, lo: 0x97, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb6}, {value: 0x0818, lo: 0xb7, hi: 0xbf}, - // Block 0x9b, offset 0x4b9 + // Block 0x9d, offset 0x4c3 {value: 0x0000, lo: 0x04}, {value: 0x0808, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0xa6}, {value: 0x0818, lo: 0xa7, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0x9c, offset 0x4be + // Block 0x9e, offset 0x4c8 {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb2}, @@ -3775,7 +3930,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xb4, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xba}, {value: 0x0818, lo: 0xbb, hi: 0xbf}, - // Block 0x9d, offset 0x4c5 + // Block 0x9f, offset 0x4cf {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0818, lo: 0x96, hi: 0x9b}, @@ -3784,18 +3939,18 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xa0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbe}, {value: 0x0818, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x4cd + // Block 0xa0, offset 0x4d7 {value: 0x0000, lo: 0x04}, {value: 0x0808, lo: 0x80, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbb}, {value: 0x0818, lo: 0xbc, hi: 0xbd}, {value: 0x0808, lo: 0xbe, hi: 0xbf}, - // Block 0x9f, offset 0x4d2 + // Block 0xa1, offset 0x4dc {value: 0x0000, lo: 0x03}, {value: 0x0818, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x91}, {value: 0x0818, lo: 0x92, hi: 0xbf}, - // Block 0xa0, offset 0x4d6 + // Block 0xa2, offset 0x4e0 {value: 0x0000, lo: 0x0f}, {value: 0x0808, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x83}, @@ -3812,7 +3967,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb8, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xa1, offset 0x4e6 + // Block 0xa3, offset 0x4f0 {value: 0x0000, lo: 0x06}, {value: 0x0818, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, @@ -3820,17 +3975,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xbc}, {value: 0x0818, lo: 0xbd, hi: 0xbf}, - // Block 0xa2, offset 0x4ed + // Block 0xa4, offset 0x4f7 {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0x9c}, {value: 0x0818, lo: 0x9d, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x4f1 + // Block 0xa5, offset 0x4fb {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xb8}, {value: 0x0018, lo: 0xb9, hi: 0xbf}, - // Block 0xa4, offset 0x4f5 + // Block 0xa6, offset 0x4ff {value: 0x0000, lo: 0x06}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x97}, @@ -3838,23 +3993,23 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xa0, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xb7}, {value: 0x0818, lo: 0xb8, hi: 0xbf}, - // Block 0xa5, offset 0x4fc + // Block 0xa7, offset 0x506 {value: 0x0000, lo: 0x01}, {value: 0x0808, lo: 0x80, hi: 0xbf}, - // Block 0xa6, offset 0x4fe + // Block 0xa8, offset 0x508 {value: 0x0000, lo: 0x02}, {value: 0x0808, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0xbf}, - // Block 0xa7, offset 0x501 + // Block 0xa9, offset 0x50b {value: 0x0000, lo: 0x02}, {value: 0x03dd, lo: 0x80, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xbf}, - // Block 0xa8, offset 0x504 + // Block 0xaa, offset 0x50e {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xb9}, {value: 0x0818, lo: 0xba, hi: 0xbf}, - // Block 0xa9, offset 0x508 + // Block 0xab, offset 0x512 {value: 0x0000, lo: 0x08}, {value: 0x0908, lo: 0x80, hi: 0x80}, {value: 0x0a08, lo: 0x81, hi: 0xa1}, @@ -3864,12 +4019,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0808, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xaa, offset 0x511 + // Block 0xac, offset 0x51b {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0818, lo: 0xa0, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0xab, offset 0x515 + // Block 0xad, offset 0x51f {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xaa}, @@ -3878,7 +4033,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0808, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0xac, offset 0x51d + // Block 0xae, offset 0x527 {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0x9c}, {value: 0x0818, lo: 0x9d, hi: 0xa6}, @@ -3887,7 +4042,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0a08, lo: 0xb0, hi: 0xb2}, {value: 0x0c08, lo: 0xb3, hi: 0xb3}, {value: 0x0a08, lo: 0xb4, hi: 0xbf}, - // Block 0xad, offset 0x525 + // Block 0xaf, offset 0x52f {value: 0x0000, lo: 0x07}, {value: 0x0a08, lo: 0x80, hi: 0x84}, {value: 0x0808, lo: 0x85, hi: 0x85}, @@ -3896,7 +4051,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0c18, lo: 0x94, hi: 0x94}, {value: 0x0818, lo: 0x95, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xae, offset 0x52d + // Block 0xb0, offset 0x537 {value: 0x0000, lo: 0x0b}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0a08, lo: 0xb0, hi: 0xb0}, @@ -3909,7 +4064,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0a08, lo: 0xbb, hi: 0xbc}, {value: 0x0c08, lo: 0xbd, hi: 0xbd}, {value: 0x0a08, lo: 0xbe, hi: 0xbf}, - // Block 0xaf, offset 0x539 + // Block 0xb1, offset 0x543 {value: 0x0000, lo: 0x0b}, {value: 0x0808, lo: 0x80, hi: 0x80}, {value: 0x0a08, lo: 0x81, hi: 0x81}, @@ -3922,14 +4077,14 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8c, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xb0, offset 0x545 + // Block 0xb2, offset 0x54f {value: 0x0000, lo: 0x05}, {value: 0x3008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0xb7}, {value: 0x3308, lo: 0xb8, hi: 0xbf}, - // Block 0xb1, offset 0x54b + // Block 0xb3, offset 0x555 {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x85}, {value: 0x3b08, lo: 0x86, hi: 0x86}, @@ -3939,7 +4094,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa6, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xb2, offset 0x554 + // Block 0xb4, offset 0x55e {value: 0x0000, lo: 0x0b}, {value: 0x3308, lo: 0x80, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, @@ -3952,7 +4107,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbb, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbd}, {value: 0x0018, lo: 0xbe, hi: 0xbf}, - // Block 0xb3, offset 0x560 + // Block 0xb5, offset 0x56a {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x81}, {value: 0x0040, lo: 0x82, hi: 0x8f}, @@ -3960,7 +4115,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa9, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xb4, offset 0x567 + // Block 0xb6, offset 0x571 {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0xa6}, @@ -3970,7 +4125,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3b08, lo: 0xb3, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xbf}, - // Block 0xb5, offset 0x570 + // Block 0xb7, offset 0x57a {value: 0x0000, lo: 0x0a}, {value: 0x0018, lo: 0x80, hi: 0x83}, {value: 0x0008, lo: 0x84, hi: 0x84}, @@ -3982,7 +4137,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xb4, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xb6, offset 0x57b + // Block 0xb8, offset 0x585 {value: 0x0000, lo: 0x06}, {value: 0x3308, lo: 0x80, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, @@ -3990,7 +4145,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb3, hi: 0xb5}, {value: 0x3308, lo: 0xb6, hi: 0xbe}, {value: 0x3008, lo: 0xbf, hi: 0xbf}, - // Block 0xb7, offset 0x582 + // Block 0xb9, offset 0x58c {value: 0x0000, lo: 0x0e}, {value: 0x3808, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x84}, @@ -4006,7 +4161,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa0, hi: 0xa0}, {value: 0x0018, lo: 0xa1, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0xb8, offset 0x591 + // Block 0xba, offset 0x59b {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x91}, {value: 0x0040, lo: 0x92, hi: 0x92}, @@ -4020,7 +4175,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xb8, hi: 0xbd}, {value: 0x3308, lo: 0xbe, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x59e + // Block 0xbb, offset 0x5a8 {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4034,7 +4189,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xa9, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0xba, offset 0x5ab + // Block 0xbc, offset 0x5b5 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x3308, lo: 0x9f, hi: 0x9f}, @@ -4044,12 +4199,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xab, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xbb, offset 0x5b4 + // Block 0xbd, offset 0x5be {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xb4}, {value: 0x3008, lo: 0xb5, hi: 0xb7}, {value: 0x3308, lo: 0xb8, hi: 0xbf}, - // Block 0xbc, offset 0x5b8 + // Block 0xbe, offset 0x5c2 {value: 0x0000, lo: 0x0e}, {value: 0x3008, lo: 0x80, hi: 0x81}, {value: 0x3b08, lo: 0x82, hi: 0x82}, @@ -4065,7 +4220,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0x9e, hi: 0x9e}, {value: 0x0008, lo: 0x9f, hi: 0xa1}, {value: 0x0040, lo: 0xa2, hi: 0xbf}, - // Block 0xbd, offset 0x5c7 + // Block 0xbf, offset 0x5d1 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb2}, @@ -4074,7 +4229,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xba, hi: 0xba}, {value: 0x3008, lo: 0xbb, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0xbe, offset 0x5cf + // Block 0xc0, offset 0x5d9 {value: 0x0000, lo: 0x0a}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x3008, lo: 0x81, hi: 0x81}, @@ -4086,7 +4241,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x88, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xbf, offset 0x5da + // Block 0xc1, offset 0x5e4 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xae}, {value: 0x3008, lo: 0xaf, hi: 0xb1}, @@ -4096,14 +4251,14 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xc0, offset 0x5e3 + // Block 0xc2, offset 0x5ed {value: 0x0000, lo: 0x05}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x97}, {value: 0x0008, lo: 0x98, hi: 0x9b}, {value: 0x3308, lo: 0x9c, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0xc1, offset 0x5e9 + // Block 0xc3, offset 0x5f3 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb2}, @@ -4112,7 +4267,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbd, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xc2, offset 0x5f1 + // Block 0xc4, offset 0x5fb {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x83}, @@ -4122,7 +4277,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9a, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xac}, {value: 0x0040, lo: 0xad, hi: 0xbf}, - // Block 0xc3, offset 0x5fa + // Block 0xc5, offset 0x604 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0xaa}, {value: 0x3308, lo: 0xab, hi: 0xab}, @@ -4134,11 +4289,11 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb7, hi: 0xb7}, {value: 0x0008, lo: 0xb8, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xc4, offset 0x605 + // Block 0xc6, offset 0x60f {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x0040, lo: 0x8a, hi: 0xbf}, - // Block 0xc5, offset 0x608 + // Block 0xc7, offset 0x612 {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x9a}, {value: 0x0040, lo: 0x9b, hi: 0x9c}, @@ -4151,7 +4306,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0018, lo: 0xba, hi: 0xbf}, - // Block 0xc6, offset 0x614 + // Block 0xc8, offset 0x61e {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xab}, {value: 0x3008, lo: 0xac, hi: 0xae}, @@ -4161,17 +4316,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xba, hi: 0xba}, {value: 0x0018, lo: 0xbb, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0xc7, offset 0x61d + // Block 0xc9, offset 0x627 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x049d, lo: 0xa0, hi: 0xbf}, - // Block 0xc8, offset 0x620 + // Block 0xca, offset 0x62a {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xbe}, {value: 0x0008, lo: 0xbf, hi: 0xbf}, - // Block 0xc9, offset 0x625 + // Block 0xcb, offset 0x62f {value: 0x0000, lo: 0x08}, {value: 0x3008, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x81}, @@ -4181,13 +4336,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x87, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xca, offset 0x62e + // Block 0xcc, offset 0x638 {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xa9}, {value: 0x0008, lo: 0xaa, hi: 0xbf}, - // Block 0xcb, offset 0x633 + // Block 0xcd, offset 0x63d {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x90}, {value: 0x3008, lo: 0x91, hi: 0x93}, @@ -4201,7 +4356,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa3, hi: 0xa3}, {value: 0x3008, lo: 0xa4, hi: 0xa4}, {value: 0x0040, lo: 0xa5, hi: 0xbf}, - // Block 0xcc, offset 0x640 + // Block 0xce, offset 0x64a {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x8a}, @@ -4213,7 +4368,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xba, hi: 0xba}, {value: 0x3308, lo: 0xbb, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xcd, offset 0x64b + // Block 0xcf, offset 0x655 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x3b08, lo: 0x87, hi: 0x87}, @@ -4223,7 +4378,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0x97, hi: 0x98}, {value: 0x3308, lo: 0x99, hi: 0x9b}, {value: 0x0008, lo: 0x9c, hi: 0xbf}, - // Block 0xce, offset 0x654 + // Block 0xd0, offset 0x65e {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x3308, lo: 0x8a, hi: 0x96}, @@ -4234,11 +4389,11 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x9d, hi: 0x9d}, {value: 0x0018, lo: 0x9e, hi: 0xa2}, {value: 0x0040, lo: 0xa3, hi: 0xbf}, - // Block 0xcf, offset 0x65e + // Block 0xd1, offset 0x668 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xd0, offset 0x661 + // Block 0xd2, offset 0x66b {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x89}, @@ -4249,7 +4404,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb8, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x66b + // Block 0xd3, offset 0x675 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x85}, @@ -4259,7 +4414,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0008, lo: 0xb2, hi: 0xbf}, - // Block 0xd2, offset 0x674 + // Block 0xd4, offset 0x67e {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x91}, @@ -4272,7 +4427,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb4, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xd3, offset 0x680 + // Block 0xd5, offset 0x68a {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4286,7 +4441,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0xd4, offset 0x68d + // Block 0xd6, offset 0x697 {value: 0x0000, lo: 0x0c}, {value: 0x3308, lo: 0x80, hi: 0x83}, {value: 0x3b08, lo: 0x84, hi: 0x85}, @@ -4300,7 +4455,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa7, hi: 0xa8}, {value: 0x0040, lo: 0xa9, hi: 0xa9}, {value: 0x0008, lo: 0xaa, hi: 0xbf}, - // Block 0xd5, offset 0x69a + // Block 0xd7, offset 0x6a4 {value: 0x0000, lo: 0x0d}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x3008, lo: 0x8a, hi: 0x8e}, @@ -4315,7 +4470,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xbf}, - // Block 0xd6, offset 0x6a8 + // Block 0xd8, offset 0x6b2 {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xb2}, @@ -4323,41 +4478,41 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb5, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xd7, offset 0x6af + // Block 0xd9, offset 0x6b9 {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb0}, {value: 0x0040, lo: 0xb1, hi: 0xbf}, - // Block 0xd8, offset 0x6b3 + // Block 0xda, offset 0x6bd {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xd9, offset 0x6b7 + // Block 0xdb, offset 0x6c1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xda, offset 0x6ba + // Block 0xdc, offset 0x6c4 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0xdb, offset 0x6bf + // Block 0xdd, offset 0x6c9 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0040, lo: 0x84, hi: 0xbf}, - // Block 0xdc, offset 0x6c2 + // Block 0xde, offset 0x6cc {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0340, lo: 0xb0, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xdd, offset 0x6c7 + // Block 0xdf, offset 0x6d1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0xbf}, - // Block 0xde, offset 0x6ca + // Block 0xe0, offset 0x6d4 {value: 0x0000, lo: 0x06}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0x9f}, @@ -4365,7 +4520,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xaa, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0xdf, offset 0x6d1 + // Block 0xe1, offset 0x6db {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xad}, @@ -4373,12 +4528,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb0, hi: 0xb4}, {value: 0x0018, lo: 0xb5, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0xe0, offset 0x6d8 + // Block 0xe2, offset 0x6e2 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, - // Block 0xe1, offset 0x6dc + // Block 0xe3, offset 0x6e6 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0018, lo: 0x84, hi: 0x85}, @@ -4390,33 +4545,33 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa3, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbc}, {value: 0x0008, lo: 0xbd, hi: 0xbf}, - // Block 0xe2, offset 0x6e7 + // Block 0xe4, offset 0x6f1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0xbf}, - // Block 0xe3, offset 0x6ea + // Block 0xe5, offset 0x6f4 {value: 0x0000, lo: 0x02}, {value: 0xe105, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0xe4, offset 0x6ed + // Block 0xe6, offset 0x6f7 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0x9a}, {value: 0x0040, lo: 0x9b, hi: 0xbf}, - // Block 0xe5, offset 0x6f0 + // Block 0xe7, offset 0x6fa {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0x8e}, {value: 0x3308, lo: 0x8f, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x90}, {value: 0x3008, lo: 0x91, hi: 0xbf}, - // Block 0xe6, offset 0x6f6 + // Block 0xe8, offset 0x700 {value: 0x0000, lo: 0x05}, {value: 0x3008, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8e}, {value: 0x3308, lo: 0x8f, hi: 0x92}, {value: 0x0008, lo: 0x93, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0xe7, offset 0x6fc + // Block 0xe9, offset 0x706 {value: 0x0000, lo: 0x08}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa1}, @@ -4426,23 +4581,23 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa5, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0xe8, offset 0x705 + // Block 0xea, offset 0x70f {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0xe9, offset 0x708 + // Block 0xeb, offset 0x712 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0xbf}, - // Block 0xea, offset 0x70b + // Block 0xec, offset 0x715 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0xbf}, - // Block 0xeb, offset 0x70e + // Block 0xed, offset 0x718 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0xbf}, - // Block 0xec, offset 0x711 + // Block 0xee, offset 0x71b {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x92}, @@ -4450,17 +4605,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa4, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0xed, offset 0x718 + // Block 0xef, offset 0x722 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0xee, offset 0x71b + // Block 0xf0, offset 0x725 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xaa}, {value: 0x0040, lo: 0xab, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0xef, offset 0x720 + // Block 0xf1, offset 0x72a {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, @@ -4471,32 +4626,32 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0x9f, hi: 0x9f}, {value: 0x03c0, lo: 0xa0, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xbf}, - // Block 0xf0, offset 0x72a + // Block 0xf2, offset 0x734 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0xf1, offset 0x72d + // Block 0xf3, offset 0x737 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xa6}, {value: 0x0040, lo: 0xa7, hi: 0xa8}, {value: 0x0018, lo: 0xa9, hi: 0xbf}, - // Block 0xf2, offset 0x731 + // Block 0xf4, offset 0x73b {value: 0x0000, lo: 0x0e}, {value: 0x0018, lo: 0x80, hi: 0x9d}, - {value: 0xb609, lo: 0x9e, hi: 0x9e}, - {value: 0xb651, lo: 0x9f, hi: 0x9f}, - {value: 0xb699, lo: 0xa0, hi: 0xa0}, - {value: 0xb701, lo: 0xa1, hi: 0xa1}, - {value: 0xb769, lo: 0xa2, hi: 0xa2}, - {value: 0xb7d1, lo: 0xa3, hi: 0xa3}, - {value: 0xb839, lo: 0xa4, hi: 0xa4}, + {value: 0x2211, lo: 0x9e, hi: 0x9e}, + {value: 0x2219, lo: 0x9f, hi: 0x9f}, + {value: 0x2221, lo: 0xa0, hi: 0xa0}, + {value: 0x2229, lo: 0xa1, hi: 0xa1}, + {value: 0x2231, lo: 0xa2, hi: 0xa2}, + {value: 0x2239, lo: 0xa3, hi: 0xa3}, + {value: 0x2241, lo: 0xa4, hi: 0xa4}, {value: 0x3018, lo: 0xa5, hi: 0xa6}, {value: 0x3318, lo: 0xa7, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xac}, {value: 0x3018, lo: 0xad, hi: 0xb2}, {value: 0x0340, lo: 0xb3, hi: 0xba}, {value: 0x3318, lo: 0xbb, hi: 0xbf}, - // Block 0xf3, offset 0x740 + // Block 0xf5, offset 0x74a {value: 0x0000, lo: 0x0b}, {value: 0x3318, lo: 0x80, hi: 0x82}, {value: 0x0018, lo: 0x83, hi: 0x84}, @@ -4504,45 +4659,45 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0x8c, hi: 0xa9}, {value: 0x3318, lo: 0xaa, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xba}, - {value: 0xb8a1, lo: 0xbb, hi: 0xbb}, - {value: 0xb8e9, lo: 0xbc, hi: 0xbc}, - {value: 0xb931, lo: 0xbd, hi: 0xbd}, - {value: 0xb999, lo: 0xbe, hi: 0xbe}, - {value: 0xba01, lo: 0xbf, hi: 0xbf}, - // Block 0xf4, offset 0x74c + {value: 0x2249, lo: 0xbb, hi: 0xbb}, + {value: 0x2251, lo: 0xbc, hi: 0xbc}, + {value: 0x2259, lo: 0xbd, hi: 0xbd}, + {value: 0x2261, lo: 0xbe, hi: 0xbe}, + {value: 0x2269, lo: 0xbf, hi: 0xbf}, + // Block 0xf6, offset 0x756 {value: 0x0000, lo: 0x03}, - {value: 0xba69, lo: 0x80, hi: 0x80}, + {value: 0x2271, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0xa8}, {value: 0x0040, lo: 0xa9, hi: 0xbf}, - // Block 0xf5, offset 0x750 + // Block 0xf7, offset 0x75a {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x81}, {value: 0x3318, lo: 0x82, hi: 0x84}, {value: 0x0018, lo: 0x85, hi: 0x85}, {value: 0x0040, lo: 0x86, hi: 0xbf}, - // Block 0xf6, offset 0x755 + // Block 0xf8, offset 0x75f {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xbf}, - // Block 0xf7, offset 0x759 + // Block 0xf9, offset 0x763 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xf8, offset 0x75e + // Block 0xfa, offset 0x768 {value: 0x0000, lo: 0x03}, {value: 0x3308, lo: 0x80, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xba}, {value: 0x3308, lo: 0xbb, hi: 0xbf}, - // Block 0xf9, offset 0x762 + // Block 0xfb, offset 0x76c {value: 0x0000, lo: 0x04}, {value: 0x3308, lo: 0x80, hi: 0xac}, {value: 0x0018, lo: 0xad, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb5}, {value: 0x0018, lo: 0xb6, hi: 0xbf}, - // Block 0xfa, offset 0x767 + // Block 0xfc, offset 0x771 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x83}, {value: 0x3308, lo: 0x84, hi: 0x84}, @@ -4552,7 +4707,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa0, hi: 0xa0}, {value: 0x3308, lo: 0xa1, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0xfb, offset 0x770 + // Block 0xfd, offset 0x77a {value: 0x0000, lo: 0x0a}, {value: 0x3308, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4564,35 +4719,35 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa5, hi: 0xa5}, {value: 0x3308, lo: 0xa6, hi: 0xaa}, {value: 0x0040, lo: 0xab, hi: 0xbf}, - // Block 0xfc, offset 0x77b + // Block 0xfe, offset 0x785 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xac}, {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb6}, {value: 0x0008, lo: 0xb7, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0xfd, offset 0x781 + // Block 0xff, offset 0x78b {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x0040, lo: 0x8a, hi: 0x8d}, {value: 0x0008, lo: 0x8e, hi: 0x8e}, {value: 0x0018, lo: 0x8f, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0xbf}, - // Block 0xfe, offset 0x787 + // Block 0x100, offset 0x791 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xab}, {value: 0x3308, lo: 0xac, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xff, offset 0x78d + // Block 0x101, offset 0x797 {value: 0x0000, lo: 0x05}, {value: 0x0808, lo: 0x80, hi: 0x84}, {value: 0x0040, lo: 0x85, hi: 0x86}, {value: 0x0818, lo: 0x87, hi: 0x8f}, {value: 0x3308, lo: 0x90, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0xbf}, - // Block 0x100, offset 0x793 + // Block 0x102, offset 0x79d {value: 0x0000, lo: 0x08}, {value: 0x0a08, lo: 0x80, hi: 0x83}, {value: 0x3308, lo: 0x84, hi: 0x8a}, @@ -4602,71 +4757,71 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9a, hi: 0x9d}, {value: 0x0818, lo: 0x9e, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0x101, offset 0x79c + // Block 0x103, offset 0x7a6 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0xb0}, {value: 0x0818, lo: 0xb1, hi: 0xbf}, - // Block 0x102, offset 0x79f + // Block 0x104, offset 0x7a9 {value: 0x0000, lo: 0x02}, {value: 0x0818, lo: 0x80, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0x103, offset 0x7a2 + // Block 0x105, offset 0x7ac {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0818, lo: 0x81, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0x104, offset 0x7a6 + // Block 0x106, offset 0x7b0 {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0x105, offset 0x7aa + // Block 0x107, offset 0x7b4 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbf}, - // Block 0x106, offset 0x7ae + // Block 0x108, offset 0x7b8 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x93}, {value: 0x0040, lo: 0x94, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xb0}, {value: 0x0018, lo: 0xb1, hi: 0xbf}, - // Block 0x107, offset 0x7b4 + // Block 0x109, offset 0x7be {value: 0x0000, lo: 0x05}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x90}, {value: 0x0018, lo: 0x91, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0x108, offset 0x7ba + // Block 0x10a, offset 0x7c4 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x8f}, - {value: 0xc229, lo: 0x90, hi: 0x90}, + {value: 0x2491, lo: 0x90, hi: 0x90}, {value: 0x0018, lo: 0x91, hi: 0xad}, {value: 0x0040, lo: 0xae, hi: 0xbf}, - // Block 0x109, offset 0x7bf + // Block 0x10b, offset 0x7c9 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0xa5}, {value: 0x0018, lo: 0xa6, hi: 0xbf}, - // Block 0x10a, offset 0x7c2 + // Block 0x10c, offset 0x7cc {value: 0x0000, lo: 0x0f}, - {value: 0xc851, lo: 0x80, hi: 0x80}, - {value: 0xc8a1, lo: 0x81, hi: 0x81}, - {value: 0xc8f1, lo: 0x82, hi: 0x82}, - {value: 0xc941, lo: 0x83, hi: 0x83}, - {value: 0xc991, lo: 0x84, hi: 0x84}, - {value: 0xc9e1, lo: 0x85, hi: 0x85}, - {value: 0xca31, lo: 0x86, hi: 0x86}, - {value: 0xca81, lo: 0x87, hi: 0x87}, - {value: 0xcad1, lo: 0x88, hi: 0x88}, + {value: 0x2611, lo: 0x80, hi: 0x80}, + {value: 0x2619, lo: 0x81, hi: 0x81}, + {value: 0x2621, lo: 0x82, hi: 0x82}, + {value: 0x2629, lo: 0x83, hi: 0x83}, + {value: 0x2631, lo: 0x84, hi: 0x84}, + {value: 0x2639, lo: 0x85, hi: 0x85}, + {value: 0x2641, lo: 0x86, hi: 0x86}, + {value: 0x2649, lo: 0x87, hi: 0x87}, + {value: 0x2651, lo: 0x88, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, - {value: 0xcb21, lo: 0x90, hi: 0x90}, - {value: 0xcb41, lo: 0x91, hi: 0x91}, + {value: 0x2659, lo: 0x90, hi: 0x90}, + {value: 0x2661, lo: 0x91, hi: 0x91}, {value: 0x0040, lo: 0x92, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa5}, {value: 0x0040, lo: 0xa6, hi: 0xbf}, - // Block 0x10b, offset 0x7d2 + // Block 0x10d, offset 0x7dc {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x97}, {value: 0x0040, lo: 0x98, hi: 0x9f}, @@ -4674,29 +4829,29 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x10c, offset 0x7d9 + // Block 0x10e, offset 0x7e3 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xbf}, - // Block 0x10d, offset 0x7dc + // Block 0x10f, offset 0x7e6 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x98}, {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xbf}, - // Block 0x10e, offset 0x7e1 + // Block 0x110, offset 0x7eb {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, - // Block 0x10f, offset 0x7e5 + // Block 0x111, offset 0x7ef {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xbf}, - // Block 0x110, offset 0x7eb + // Block 0x112, offset 0x7f5 {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8f}, @@ -4704,17 +4859,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0x111, offset 0x7f2 + // Block 0x113, offset 0x7fc {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xb9}, {value: 0x0018, lo: 0xba, hi: 0xbf}, - // Block 0x112, offset 0x7f6 + // Block 0x114, offset 0x800 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0xbf}, - // Block 0x113, offset 0x7fa + // Block 0x115, offset 0x804 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x93}, {value: 0x0040, lo: 0x94, hi: 0x9f}, @@ -4724,7 +4879,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xb5, hi: 0xb7}, {value: 0x0018, lo: 0xb8, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x114, offset 0x803 + // Block 0x116, offset 0x80d {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8f}, @@ -4732,109 +4887,74 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa9, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x115, offset 0x80a + // Block 0x117, offset 0x814 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x82}, {value: 0x0040, lo: 0x83, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0xbf}, - // Block 0x116, offset 0x80f + // Block 0x118, offset 0x819 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x92}, {value: 0x0040, lo: 0x93, hi: 0x93}, {value: 0x0018, lo: 0x94, hi: 0xbf}, - // Block 0x117, offset 0x813 + // Block 0x119, offset 0x81d {value: 0x0000, lo: 0x0d}, {value: 0x0018, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0xaf}, - {value: 0x1f41, lo: 0xb0, hi: 0xb0}, - {value: 0x00c9, lo: 0xb1, hi: 0xb1}, - {value: 0x0069, lo: 0xb2, hi: 0xb2}, - {value: 0x0079, lo: 0xb3, hi: 0xb3}, - {value: 0x1f51, lo: 0xb4, hi: 0xb4}, - {value: 0x1f61, lo: 0xb5, hi: 0xb5}, - {value: 0x1f71, lo: 0xb6, hi: 0xb6}, - {value: 0x1f81, lo: 0xb7, hi: 0xb7}, - {value: 0x1f91, lo: 0xb8, hi: 0xb8}, - {value: 0x1fa1, lo: 0xb9, hi: 0xb9}, + {value: 0x06e1, lo: 0xb0, hi: 0xb0}, + {value: 0x0049, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb2, hi: 0xb2}, + {value: 0x0031, lo: 0xb3, hi: 0xb3}, + {value: 0x06e9, lo: 0xb4, hi: 0xb4}, + {value: 0x06f1, lo: 0xb5, hi: 0xb5}, + {value: 0x06f9, lo: 0xb6, hi: 0xb6}, + {value: 0x0701, lo: 0xb7, hi: 0xb7}, + {value: 0x0709, lo: 0xb8, hi: 0xb8}, + {value: 0x0711, lo: 0xb9, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x118, offset 0x821 + // Block 0x11a, offset 0x82b {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0x119, offset 0x824 + // Block 0x11b, offset 0x82e {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0x11a, offset 0x827 + // Block 0x11c, offset 0x831 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x11b, offset 0x82b + // Block 0x11d, offset 0x835 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa1}, {value: 0x0040, lo: 0xa2, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x11c, offset 0x82f + // Block 0x11e, offset 0x839 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xa0}, {value: 0x0040, lo: 0xa1, hi: 0xbf}, - // Block 0x11d, offset 0x832 - {value: 0x0020, lo: 0x0f}, - {value: 0xdf21, lo: 0x80, hi: 0x89}, - {value: 0x8e35, lo: 0x8a, hi: 0x8a}, - {value: 0xe061, lo: 0x8b, hi: 0x9c}, - {value: 0x8e55, lo: 0x9d, hi: 0x9d}, - {value: 0xe2a1, lo: 0x9e, hi: 0xa2}, - {value: 0x8e75, lo: 0xa3, hi: 0xa3}, - {value: 0xe341, lo: 0xa4, hi: 0xab}, - {value: 0x7f0d, lo: 0xac, hi: 0xac}, - {value: 0xe441, lo: 0xad, hi: 0xaf}, - {value: 0x8e95, lo: 0xb0, hi: 0xb0}, - {value: 0xe4a1, lo: 0xb1, hi: 0xb6}, - {value: 0x8eb5, lo: 0xb7, hi: 0xb9}, - {value: 0xe561, lo: 0xba, hi: 0xba}, - {value: 0x8f15, lo: 0xbb, hi: 0xbb}, - {value: 0xe581, lo: 0xbc, hi: 0xbf}, - // Block 0x11e, offset 0x842 - {value: 0x0020, lo: 0x10}, - {value: 0x93b5, lo: 0x80, hi: 0x80}, - {value: 0xf101, lo: 0x81, hi: 0x86}, - {value: 0x93d5, lo: 0x87, hi: 0x8a}, - {value: 0xda61, lo: 0x8b, hi: 0x8b}, - {value: 0xf1c1, lo: 0x8c, hi: 0x96}, - {value: 0x9455, lo: 0x97, hi: 0x97}, - {value: 0xf321, lo: 0x98, hi: 0xa3}, - {value: 0x9475, lo: 0xa4, hi: 0xa6}, - {value: 0xf4a1, lo: 0xa7, hi: 0xaa}, - {value: 0x94d5, lo: 0xab, hi: 0xab}, - {value: 0xf521, lo: 0xac, hi: 0xac}, - {value: 0x94f5, lo: 0xad, hi: 0xad}, - {value: 0xf541, lo: 0xae, hi: 0xaf}, - {value: 0x9515, lo: 0xb0, hi: 0xb1}, - {value: 0xf581, lo: 0xb2, hi: 0xbe}, - {value: 0x2040, lo: 0xbf, hi: 0xbf}, - // Block 0x11f, offset 0x853 + // Block 0x11f, offset 0x83c {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0xbf}, - // Block 0x120, offset 0x856 + // Block 0x120, offset 0x83f {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0340, lo: 0x81, hi: 0x81}, {value: 0x0040, lo: 0x82, hi: 0x9f}, {value: 0x0340, lo: 0xa0, hi: 0xbf}, - // Block 0x121, offset 0x85b + // Block 0x121, offset 0x844 {value: 0x0000, lo: 0x01}, {value: 0x0340, lo: 0x80, hi: 0xbf}, - // Block 0x122, offset 0x85d + // Block 0x122, offset 0x846 {value: 0x0000, lo: 0x01}, {value: 0x33c0, lo: 0x80, hi: 0xbf}, - // Block 0x123, offset 0x85f + // Block 0x123, offset 0x848 {value: 0x0000, lo: 0x02}, {value: 0x33c0, lo: 0x80, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, } -// Total table size 43370 bytes (42KiB); checksum: EBD909C0 +// Total table size 44953 bytes (43KiB); checksum: D51909DD diff --git a/vendor/golang.org/x/net/idna/tables15.0.0.go b/vendor/golang.org/x/net/idna/tables15.0.0.go new file mode 100644 index 000000000..40033778f --- /dev/null +++ b/vendor/golang.org/x/net/idna/tables15.0.0.go @@ -0,0 +1,5145 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package idna + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +var mappings string = "" + // Size: 6704 bytes + " ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक" + + "़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱ" + + "ཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳ" + + "ɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧ" + + "ιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?" + + "′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83" + + "⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12" + + ")(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)" + + "(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전" + + ")(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(" + + "財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)21222324252627282930313233343" + + "5참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパート" + + "アルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキロ" + + "グラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノ" + + "ノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポ" + + "イントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリ" + + "ラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20" + + "点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlk" + + "lfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhah" + + "pinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日1" + + "8日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմ" + + "խיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּו" + + "ֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئم" + + "ئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحط" + + "مظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمي" + + "نجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترت" + + "زتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيس" + + "ىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميح" + + "مىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمى" + + "فخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنم" + + "ينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمين" + + "حيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليه" + + "وسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\\$%@ـًـَـُـِـّـْءآ" + + "أؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا\x22'/^|~¢£¬¦¥ːˑʙɓʣꭦʥʤɖɗᶑɘɞʩɤɢ" + + "ɠʛʜɧʄʪʫꞎɮʎøɶɷɺɾʀʨʦꭧʧʈⱱʏʡʢʘǀǁǂ𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκ" + + "λμνξοστυψ∇∂ϝабгежзиклмпруфхцчшыэюꚉәіјөүӏґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a" + + ")(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y" + + ")(z)〔s〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申" + + "割営配〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉" + + "卑博即卽卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢" + + "㠯巽帨帽幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最" + + "暜肭䏙朗望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸" + + "瑇瑜瑱璅瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦" + + "若茝荣莭茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷" + + "䧦雃嶲霣䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻" + +var mappingIndex = []uint16{ // 1729 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0004, 0x0005, 0x0008, 0x0009, 0x000a, + 0x000d, 0x0010, 0x0011, 0x0012, 0x0017, 0x001c, 0x0021, 0x0024, + 0x0027, 0x002a, 0x002b, 0x002e, 0x0031, 0x0034, 0x0035, 0x0036, + 0x0037, 0x0038, 0x0039, 0x003c, 0x003f, 0x0042, 0x0045, 0x0048, + 0x004b, 0x004c, 0x004d, 0x0051, 0x0054, 0x0055, 0x005a, 0x005e, + 0x0062, 0x0066, 0x006a, 0x006e, 0x0074, 0x007a, 0x0080, 0x0086, + 0x008c, 0x0092, 0x0098, 0x009e, 0x00a4, 0x00aa, 0x00b0, 0x00b6, + 0x00bc, 0x00c2, 0x00c8, 0x00ce, 0x00d4, 0x00da, 0x00e0, 0x00e6, + // Entry 40 - 7F + 0x00ec, 0x00f2, 0x00f8, 0x00fe, 0x0104, 0x010a, 0x0110, 0x0116, + 0x011c, 0x0122, 0x0128, 0x012e, 0x0137, 0x013d, 0x0146, 0x014c, + 0x0152, 0x0158, 0x015e, 0x0164, 0x016a, 0x0170, 0x0172, 0x0174, + 0x0176, 0x0178, 0x017a, 0x017c, 0x017e, 0x0180, 0x0181, 0x0182, + 0x0183, 0x0185, 0x0186, 0x0187, 0x0188, 0x0189, 0x018a, 0x018c, + 0x018d, 0x018e, 0x018f, 0x0191, 0x0193, 0x0195, 0x0197, 0x0199, + 0x019b, 0x019d, 0x019f, 0x01a0, 0x01a2, 0x01a4, 0x01a6, 0x01a8, + 0x01aa, 0x01ac, 0x01ae, 0x01b0, 0x01b1, 0x01b3, 0x01b5, 0x01b6, + // Entry 80 - BF + 0x01b8, 0x01ba, 0x01bc, 0x01be, 0x01c0, 0x01c2, 0x01c4, 0x01c6, + 0x01c8, 0x01ca, 0x01cc, 0x01ce, 0x01d0, 0x01d2, 0x01d4, 0x01d6, + 0x01d8, 0x01da, 0x01dc, 0x01de, 0x01e0, 0x01e2, 0x01e4, 0x01e5, + 0x01e7, 0x01e9, 0x01eb, 0x01ed, 0x01ef, 0x01f1, 0x01f3, 0x01f5, + 0x01f7, 0x01f9, 0x01fb, 0x01fd, 0x0202, 0x0207, 0x020c, 0x0211, + 0x0216, 0x021b, 0x0220, 0x0225, 0x022a, 0x022f, 0x0234, 0x0239, + 0x023e, 0x0243, 0x0248, 0x024d, 0x0252, 0x0257, 0x025c, 0x0261, + 0x0266, 0x026b, 0x0270, 0x0275, 0x027a, 0x027e, 0x0282, 0x0287, + // Entry C0 - FF + 0x0289, 0x028e, 0x0293, 0x0297, 0x029b, 0x02a0, 0x02a5, 0x02aa, + 0x02af, 0x02b1, 0x02b6, 0x02bb, 0x02c0, 0x02c2, 0x02c7, 0x02c8, + 0x02cd, 0x02d1, 0x02d5, 0x02da, 0x02e0, 0x02e9, 0x02ef, 0x02f8, + 0x02fa, 0x02fc, 0x02fe, 0x0300, 0x030c, 0x030d, 0x030e, 0x030f, + 0x0310, 0x0311, 0x0312, 0x0313, 0x0314, 0x0315, 0x0316, 0x0317, + 0x0319, 0x031b, 0x031d, 0x031e, 0x0320, 0x0322, 0x0324, 0x0326, + 0x0328, 0x032a, 0x032c, 0x032e, 0x0330, 0x0335, 0x033a, 0x0340, + 0x0345, 0x034a, 0x034f, 0x0354, 0x0359, 0x035e, 0x0363, 0x0368, + // Entry 100 - 13F + 0x036d, 0x0372, 0x0377, 0x037c, 0x0380, 0x0382, 0x0384, 0x0386, + 0x038a, 0x038c, 0x038e, 0x0393, 0x0399, 0x03a2, 0x03a8, 0x03b1, + 0x03b3, 0x03b5, 0x03b7, 0x03b9, 0x03bb, 0x03bd, 0x03bf, 0x03c1, + 0x03c3, 0x03c5, 0x03c7, 0x03cb, 0x03cf, 0x03d3, 0x03d7, 0x03db, + 0x03df, 0x03e3, 0x03e7, 0x03eb, 0x03ef, 0x03f3, 0x03ff, 0x0401, + 0x0406, 0x0408, 0x040a, 0x040c, 0x040e, 0x040f, 0x0413, 0x0417, + 0x041d, 0x0423, 0x0428, 0x042d, 0x0432, 0x0437, 0x043c, 0x0441, + 0x0446, 0x044b, 0x0450, 0x0455, 0x045a, 0x045f, 0x0464, 0x0469, + // Entry 140 - 17F + 0x046e, 0x0473, 0x0478, 0x047d, 0x0482, 0x0487, 0x048c, 0x0491, + 0x0496, 0x049b, 0x04a0, 0x04a5, 0x04aa, 0x04af, 0x04b4, 0x04bc, + 0x04c4, 0x04c9, 0x04ce, 0x04d3, 0x04d8, 0x04dd, 0x04e2, 0x04e7, + 0x04ec, 0x04f1, 0x04f6, 0x04fb, 0x0500, 0x0505, 0x050a, 0x050f, + 0x0514, 0x0519, 0x051e, 0x0523, 0x0528, 0x052d, 0x0532, 0x0537, + 0x053c, 0x0541, 0x0546, 0x054b, 0x0550, 0x0555, 0x055a, 0x055f, + 0x0564, 0x0569, 0x056e, 0x0573, 0x0578, 0x057a, 0x057c, 0x057e, + 0x0580, 0x0582, 0x0584, 0x0586, 0x0588, 0x058a, 0x058c, 0x058e, + // Entry 180 - 1BF + 0x0590, 0x0592, 0x0594, 0x0596, 0x059c, 0x05a2, 0x05a4, 0x05a6, + 0x05a8, 0x05aa, 0x05ac, 0x05ae, 0x05b0, 0x05b2, 0x05b4, 0x05b6, + 0x05b8, 0x05ba, 0x05bc, 0x05be, 0x05c0, 0x05c4, 0x05c8, 0x05cc, + 0x05d0, 0x05d4, 0x05d8, 0x05dc, 0x05e0, 0x05e4, 0x05e9, 0x05ee, + 0x05f3, 0x05f5, 0x05f7, 0x05fd, 0x0609, 0x0615, 0x0621, 0x062a, + 0x0636, 0x063f, 0x0648, 0x0657, 0x0663, 0x066c, 0x0675, 0x067e, + 0x068a, 0x0696, 0x069f, 0x06a8, 0x06ae, 0x06b7, 0x06c3, 0x06cf, + 0x06d5, 0x06e4, 0x06f6, 0x0705, 0x070e, 0x071d, 0x072c, 0x0738, + // Entry 1C0 - 1FF + 0x0741, 0x074a, 0x0753, 0x075f, 0x076e, 0x077a, 0x0783, 0x078c, + 0x0795, 0x079b, 0x07a1, 0x07a7, 0x07ad, 0x07b6, 0x07bf, 0x07ce, + 0x07d7, 0x07e3, 0x07f2, 0x07fb, 0x0801, 0x0807, 0x0816, 0x0822, + 0x0831, 0x083a, 0x0849, 0x084f, 0x0858, 0x0861, 0x086a, 0x0873, + 0x087c, 0x0888, 0x0891, 0x0897, 0x08a0, 0x08a9, 0x08b2, 0x08be, + 0x08c7, 0x08d0, 0x08d9, 0x08e8, 0x08f4, 0x08fa, 0x0909, 0x090f, + 0x091b, 0x0927, 0x0930, 0x0939, 0x0942, 0x094e, 0x0954, 0x095d, + 0x0969, 0x096f, 0x097e, 0x0987, 0x098b, 0x098f, 0x0993, 0x0997, + // Entry 200 - 23F + 0x099b, 0x099f, 0x09a3, 0x09a7, 0x09ab, 0x09af, 0x09b4, 0x09b9, + 0x09be, 0x09c3, 0x09c8, 0x09cd, 0x09d2, 0x09d7, 0x09dc, 0x09e1, + 0x09e6, 0x09eb, 0x09f0, 0x09f5, 0x09fa, 0x09fc, 0x09fe, 0x0a00, + 0x0a02, 0x0a04, 0x0a06, 0x0a0c, 0x0a12, 0x0a18, 0x0a1e, 0x0a2a, + 0x0a2c, 0x0a2e, 0x0a30, 0x0a32, 0x0a34, 0x0a36, 0x0a38, 0x0a3c, + 0x0a3e, 0x0a40, 0x0a42, 0x0a44, 0x0a46, 0x0a48, 0x0a4a, 0x0a4c, + 0x0a4e, 0x0a50, 0x0a52, 0x0a54, 0x0a56, 0x0a58, 0x0a5a, 0x0a5f, + 0x0a65, 0x0a6c, 0x0a74, 0x0a76, 0x0a78, 0x0a7a, 0x0a7c, 0x0a7e, + // Entry 240 - 27F + 0x0a80, 0x0a82, 0x0a84, 0x0a86, 0x0a88, 0x0a8a, 0x0a8c, 0x0a8e, + 0x0a90, 0x0a96, 0x0a98, 0x0a9a, 0x0a9c, 0x0a9e, 0x0aa0, 0x0aa2, + 0x0aa4, 0x0aa6, 0x0aa8, 0x0aaa, 0x0aac, 0x0aae, 0x0ab0, 0x0ab2, + 0x0ab4, 0x0ab9, 0x0abe, 0x0ac2, 0x0ac6, 0x0aca, 0x0ace, 0x0ad2, + 0x0ad6, 0x0ada, 0x0ade, 0x0ae2, 0x0ae7, 0x0aec, 0x0af1, 0x0af6, + 0x0afb, 0x0b00, 0x0b05, 0x0b0a, 0x0b0f, 0x0b14, 0x0b19, 0x0b1e, + 0x0b23, 0x0b28, 0x0b2d, 0x0b32, 0x0b37, 0x0b3c, 0x0b41, 0x0b46, + 0x0b4b, 0x0b50, 0x0b52, 0x0b54, 0x0b56, 0x0b58, 0x0b5a, 0x0b5c, + // Entry 280 - 2BF + 0x0b5e, 0x0b62, 0x0b66, 0x0b6a, 0x0b6e, 0x0b72, 0x0b76, 0x0b7a, + 0x0b7c, 0x0b7e, 0x0b80, 0x0b82, 0x0b86, 0x0b8a, 0x0b8e, 0x0b92, + 0x0b96, 0x0b9a, 0x0b9e, 0x0ba0, 0x0ba2, 0x0ba4, 0x0ba6, 0x0ba8, + 0x0baa, 0x0bac, 0x0bb0, 0x0bb4, 0x0bba, 0x0bc0, 0x0bc4, 0x0bc8, + 0x0bcc, 0x0bd0, 0x0bd4, 0x0bd8, 0x0bdc, 0x0be0, 0x0be4, 0x0be8, + 0x0bec, 0x0bf0, 0x0bf4, 0x0bf8, 0x0bfc, 0x0c00, 0x0c04, 0x0c08, + 0x0c0c, 0x0c10, 0x0c14, 0x0c18, 0x0c1c, 0x0c20, 0x0c24, 0x0c28, + 0x0c2c, 0x0c30, 0x0c34, 0x0c36, 0x0c38, 0x0c3a, 0x0c3c, 0x0c3e, + // Entry 2C0 - 2FF + 0x0c40, 0x0c42, 0x0c44, 0x0c46, 0x0c48, 0x0c4a, 0x0c4c, 0x0c4e, + 0x0c50, 0x0c52, 0x0c54, 0x0c56, 0x0c58, 0x0c5a, 0x0c5c, 0x0c5e, + 0x0c60, 0x0c62, 0x0c64, 0x0c66, 0x0c68, 0x0c6a, 0x0c6c, 0x0c6e, + 0x0c70, 0x0c72, 0x0c74, 0x0c76, 0x0c78, 0x0c7a, 0x0c7c, 0x0c7e, + 0x0c80, 0x0c82, 0x0c86, 0x0c8a, 0x0c8e, 0x0c92, 0x0c96, 0x0c9a, + 0x0c9e, 0x0ca2, 0x0ca4, 0x0ca8, 0x0cac, 0x0cb0, 0x0cb4, 0x0cb8, + 0x0cbc, 0x0cc0, 0x0cc4, 0x0cc8, 0x0ccc, 0x0cd0, 0x0cd4, 0x0cd8, + 0x0cdc, 0x0ce0, 0x0ce4, 0x0ce8, 0x0cec, 0x0cf0, 0x0cf4, 0x0cf8, + // Entry 300 - 33F + 0x0cfc, 0x0d00, 0x0d04, 0x0d08, 0x0d0c, 0x0d10, 0x0d14, 0x0d18, + 0x0d1c, 0x0d20, 0x0d24, 0x0d28, 0x0d2c, 0x0d30, 0x0d34, 0x0d38, + 0x0d3c, 0x0d40, 0x0d44, 0x0d48, 0x0d4c, 0x0d50, 0x0d54, 0x0d58, + 0x0d5c, 0x0d60, 0x0d64, 0x0d68, 0x0d6c, 0x0d70, 0x0d74, 0x0d78, + 0x0d7c, 0x0d80, 0x0d84, 0x0d88, 0x0d8c, 0x0d90, 0x0d94, 0x0d98, + 0x0d9c, 0x0da0, 0x0da4, 0x0da8, 0x0dac, 0x0db0, 0x0db4, 0x0db8, + 0x0dbc, 0x0dc0, 0x0dc4, 0x0dc8, 0x0dcc, 0x0dd0, 0x0dd4, 0x0dd8, + 0x0ddc, 0x0de0, 0x0de4, 0x0de8, 0x0dec, 0x0df0, 0x0df4, 0x0df8, + // Entry 340 - 37F + 0x0dfc, 0x0e00, 0x0e04, 0x0e08, 0x0e0c, 0x0e10, 0x0e14, 0x0e18, + 0x0e1d, 0x0e22, 0x0e27, 0x0e2c, 0x0e31, 0x0e36, 0x0e3a, 0x0e3e, + 0x0e42, 0x0e46, 0x0e4a, 0x0e4e, 0x0e52, 0x0e56, 0x0e5a, 0x0e5e, + 0x0e62, 0x0e66, 0x0e6a, 0x0e6e, 0x0e72, 0x0e76, 0x0e7a, 0x0e7e, + 0x0e82, 0x0e86, 0x0e8a, 0x0e8e, 0x0e92, 0x0e96, 0x0e9a, 0x0e9e, + 0x0ea2, 0x0ea6, 0x0eaa, 0x0eae, 0x0eb2, 0x0eb6, 0x0ebc, 0x0ec2, + 0x0ec8, 0x0ecc, 0x0ed0, 0x0ed4, 0x0ed8, 0x0edc, 0x0ee0, 0x0ee4, + 0x0ee8, 0x0eec, 0x0ef0, 0x0ef4, 0x0ef8, 0x0efc, 0x0f00, 0x0f04, + // Entry 380 - 3BF + 0x0f08, 0x0f0c, 0x0f10, 0x0f14, 0x0f18, 0x0f1c, 0x0f20, 0x0f24, + 0x0f28, 0x0f2c, 0x0f30, 0x0f34, 0x0f38, 0x0f3e, 0x0f44, 0x0f4a, + 0x0f50, 0x0f56, 0x0f5c, 0x0f62, 0x0f68, 0x0f6e, 0x0f74, 0x0f7a, + 0x0f80, 0x0f86, 0x0f8c, 0x0f92, 0x0f98, 0x0f9e, 0x0fa4, 0x0faa, + 0x0fb0, 0x0fb6, 0x0fbc, 0x0fc2, 0x0fc8, 0x0fce, 0x0fd4, 0x0fda, + 0x0fe0, 0x0fe6, 0x0fec, 0x0ff2, 0x0ff8, 0x0ffe, 0x1004, 0x100a, + 0x1010, 0x1016, 0x101c, 0x1022, 0x1028, 0x102e, 0x1034, 0x103a, + 0x1040, 0x1046, 0x104c, 0x1052, 0x1058, 0x105e, 0x1064, 0x106a, + // Entry 3C0 - 3FF + 0x1070, 0x1076, 0x107c, 0x1082, 0x1088, 0x108e, 0x1094, 0x109a, + 0x10a0, 0x10a6, 0x10ac, 0x10b2, 0x10b8, 0x10be, 0x10c4, 0x10ca, + 0x10d0, 0x10d6, 0x10dc, 0x10e2, 0x10e8, 0x10ee, 0x10f4, 0x10fa, + 0x1100, 0x1106, 0x110c, 0x1112, 0x1118, 0x111e, 0x1124, 0x112a, + 0x1130, 0x1136, 0x113c, 0x1142, 0x1148, 0x114e, 0x1154, 0x115a, + 0x1160, 0x1166, 0x116c, 0x1172, 0x1178, 0x1180, 0x1188, 0x1190, + 0x1198, 0x11a0, 0x11a8, 0x11b0, 0x11b6, 0x11d7, 0x11e6, 0x11ee, + 0x11ef, 0x11f0, 0x11f1, 0x11f2, 0x11f3, 0x11f4, 0x11f5, 0x11f6, + // Entry 400 - 43F + 0x11f7, 0x11f8, 0x11f9, 0x11fa, 0x11fb, 0x11fc, 0x11fd, 0x11fe, + 0x11ff, 0x1200, 0x1201, 0x1205, 0x1209, 0x120d, 0x1211, 0x1215, + 0x1219, 0x121b, 0x121d, 0x121f, 0x1221, 0x1223, 0x1225, 0x1227, + 0x1229, 0x122b, 0x122d, 0x122f, 0x1231, 0x1233, 0x1235, 0x1237, + 0x1239, 0x123b, 0x123d, 0x123f, 0x1241, 0x1243, 0x1245, 0x1247, + 0x1249, 0x124b, 0x124d, 0x124f, 0x1251, 0x1253, 0x1255, 0x1257, + 0x1259, 0x125b, 0x125d, 0x125f, 0x1263, 0x1267, 0x126b, 0x126f, + 0x1270, 0x1271, 0x1272, 0x1273, 0x1274, 0x1275, 0x1277, 0x1279, + // Entry 440 - 47F + 0x127b, 0x127d, 0x127f, 0x1281, 0x1283, 0x1285, 0x1287, 0x1289, + 0x128c, 0x128e, 0x1290, 0x1292, 0x1294, 0x1297, 0x1299, 0x129b, + 0x129d, 0x129f, 0x12a1, 0x12a3, 0x12a5, 0x12a7, 0x12a9, 0x12ab, + 0x12ad, 0x12af, 0x12b2, 0x12b4, 0x12b6, 0x12b8, 0x12ba, 0x12bc, + 0x12be, 0x12c0, 0x12c2, 0x12c4, 0x12c6, 0x12c9, 0x12cb, 0x12cd, + 0x12d0, 0x12d2, 0x12d4, 0x12d6, 0x12d8, 0x12da, 0x12dc, 0x12de, + 0x12e6, 0x12ee, 0x12fa, 0x1306, 0x1312, 0x131e, 0x132a, 0x1332, + 0x133a, 0x1346, 0x1352, 0x135e, 0x136a, 0x136c, 0x136e, 0x1370, + // Entry 480 - 4BF + 0x1372, 0x1374, 0x1376, 0x1378, 0x137a, 0x137c, 0x137e, 0x1380, + 0x1382, 0x1384, 0x1386, 0x1388, 0x138a, 0x138d, 0x1390, 0x1392, + 0x1394, 0x1396, 0x1398, 0x139a, 0x139c, 0x139e, 0x13a0, 0x13a2, + 0x13a4, 0x13a6, 0x13a8, 0x13aa, 0x13ac, 0x13ae, 0x13b0, 0x13b2, + 0x13b4, 0x13b6, 0x13b8, 0x13ba, 0x13bc, 0x13bf, 0x13c1, 0x13c3, + 0x13c5, 0x13c7, 0x13c9, 0x13cb, 0x13cd, 0x13cf, 0x13d1, 0x13d3, + 0x13d6, 0x13d8, 0x13da, 0x13dc, 0x13de, 0x13e0, 0x13e2, 0x13e4, + 0x13e6, 0x13e8, 0x13ea, 0x13ec, 0x13ee, 0x13f0, 0x13f2, 0x13f5, + // Entry 4C0 - 4FF + 0x13f8, 0x13fb, 0x13fe, 0x1401, 0x1404, 0x1407, 0x140a, 0x140d, + 0x1410, 0x1413, 0x1416, 0x1419, 0x141c, 0x141f, 0x1422, 0x1425, + 0x1428, 0x142b, 0x142e, 0x1431, 0x1434, 0x1437, 0x143a, 0x143d, + 0x1440, 0x1447, 0x1449, 0x144b, 0x144d, 0x1450, 0x1452, 0x1454, + 0x1456, 0x1458, 0x145a, 0x1460, 0x1466, 0x1469, 0x146c, 0x146f, + 0x1472, 0x1475, 0x1478, 0x147b, 0x147e, 0x1481, 0x1484, 0x1487, + 0x148a, 0x148d, 0x1490, 0x1493, 0x1496, 0x1499, 0x149c, 0x149f, + 0x14a2, 0x14a5, 0x14a8, 0x14ab, 0x14ae, 0x14b1, 0x14b4, 0x14b7, + // Entry 500 - 53F + 0x14ba, 0x14bd, 0x14c0, 0x14c3, 0x14c6, 0x14c9, 0x14cc, 0x14cf, + 0x14d2, 0x14d5, 0x14d8, 0x14db, 0x14de, 0x14e1, 0x14e4, 0x14e7, + 0x14ea, 0x14ed, 0x14f6, 0x14ff, 0x1508, 0x1511, 0x151a, 0x1523, + 0x152c, 0x1535, 0x153e, 0x1541, 0x1544, 0x1547, 0x154a, 0x154d, + 0x1550, 0x1553, 0x1556, 0x1559, 0x155c, 0x155f, 0x1562, 0x1565, + 0x1568, 0x156b, 0x156e, 0x1571, 0x1574, 0x1577, 0x157a, 0x157d, + 0x1580, 0x1583, 0x1586, 0x1589, 0x158c, 0x158f, 0x1592, 0x1595, + 0x1598, 0x159b, 0x159e, 0x15a1, 0x15a4, 0x15a7, 0x15aa, 0x15ad, + // Entry 540 - 57F + 0x15b0, 0x15b3, 0x15b6, 0x15b9, 0x15bc, 0x15bf, 0x15c2, 0x15c5, + 0x15c8, 0x15cb, 0x15ce, 0x15d1, 0x15d4, 0x15d7, 0x15da, 0x15dd, + 0x15e0, 0x15e3, 0x15e6, 0x15e9, 0x15ec, 0x15ef, 0x15f2, 0x15f5, + 0x15f8, 0x15fb, 0x15fe, 0x1601, 0x1604, 0x1607, 0x160a, 0x160d, + 0x1610, 0x1613, 0x1616, 0x1619, 0x161c, 0x161f, 0x1622, 0x1625, + 0x1628, 0x162b, 0x162e, 0x1631, 0x1634, 0x1637, 0x163a, 0x163d, + 0x1640, 0x1643, 0x1646, 0x1649, 0x164c, 0x164f, 0x1652, 0x1655, + 0x1658, 0x165b, 0x165e, 0x1661, 0x1664, 0x1667, 0x166a, 0x166d, + // Entry 580 - 5BF + 0x1670, 0x1673, 0x1676, 0x1679, 0x167c, 0x167f, 0x1682, 0x1685, + 0x1688, 0x168b, 0x168e, 0x1691, 0x1694, 0x1697, 0x169a, 0x169d, + 0x16a0, 0x16a3, 0x16a6, 0x16a9, 0x16ac, 0x16af, 0x16b2, 0x16b5, + 0x16b8, 0x16bb, 0x16be, 0x16c1, 0x16c4, 0x16c7, 0x16ca, 0x16cd, + 0x16d0, 0x16d3, 0x16d6, 0x16d9, 0x16dc, 0x16df, 0x16e2, 0x16e5, + 0x16e8, 0x16eb, 0x16ee, 0x16f1, 0x16f4, 0x16f7, 0x16fa, 0x16fd, + 0x1700, 0x1703, 0x1706, 0x1709, 0x170c, 0x170f, 0x1712, 0x1715, + 0x1718, 0x171b, 0x171e, 0x1721, 0x1724, 0x1727, 0x172a, 0x172d, + // Entry 5C0 - 5FF + 0x1730, 0x1733, 0x1736, 0x1739, 0x173c, 0x173f, 0x1742, 0x1745, + 0x1748, 0x174b, 0x174e, 0x1751, 0x1754, 0x1757, 0x175a, 0x175d, + 0x1760, 0x1763, 0x1766, 0x1769, 0x176c, 0x176f, 0x1772, 0x1775, + 0x1778, 0x177b, 0x177e, 0x1781, 0x1784, 0x1787, 0x178a, 0x178d, + 0x1790, 0x1793, 0x1796, 0x1799, 0x179c, 0x179f, 0x17a2, 0x17a5, + 0x17a8, 0x17ab, 0x17ae, 0x17b1, 0x17b4, 0x17b7, 0x17ba, 0x17bd, + 0x17c0, 0x17c3, 0x17c6, 0x17c9, 0x17cc, 0x17cf, 0x17d2, 0x17d5, + 0x17d8, 0x17db, 0x17de, 0x17e1, 0x17e4, 0x17e7, 0x17ea, 0x17ed, + // Entry 600 - 63F + 0x17f0, 0x17f3, 0x17f6, 0x17f9, 0x17fc, 0x17ff, 0x1802, 0x1805, + 0x1808, 0x180b, 0x180e, 0x1811, 0x1814, 0x1817, 0x181a, 0x181d, + 0x1820, 0x1823, 0x1826, 0x1829, 0x182c, 0x182f, 0x1832, 0x1835, + 0x1838, 0x183b, 0x183e, 0x1841, 0x1844, 0x1847, 0x184a, 0x184d, + 0x1850, 0x1853, 0x1856, 0x1859, 0x185c, 0x185f, 0x1862, 0x1865, + 0x1868, 0x186b, 0x186e, 0x1871, 0x1874, 0x1877, 0x187a, 0x187d, + 0x1880, 0x1883, 0x1886, 0x1889, 0x188c, 0x188f, 0x1892, 0x1895, + 0x1898, 0x189b, 0x189e, 0x18a1, 0x18a4, 0x18a7, 0x18aa, 0x18ad, + // Entry 640 - 67F + 0x18b0, 0x18b3, 0x18b6, 0x18b9, 0x18bc, 0x18bf, 0x18c2, 0x18c5, + 0x18c8, 0x18cb, 0x18ce, 0x18d1, 0x18d4, 0x18d7, 0x18da, 0x18dd, + 0x18e0, 0x18e3, 0x18e6, 0x18e9, 0x18ec, 0x18ef, 0x18f2, 0x18f5, + 0x18f8, 0x18fb, 0x18fe, 0x1901, 0x1904, 0x1907, 0x190a, 0x190d, + 0x1910, 0x1913, 0x1916, 0x1919, 0x191c, 0x191f, 0x1922, 0x1925, + 0x1928, 0x192b, 0x192e, 0x1931, 0x1934, 0x1937, 0x193a, 0x193d, + 0x1940, 0x1943, 0x1946, 0x1949, 0x194c, 0x194f, 0x1952, 0x1955, + 0x1958, 0x195b, 0x195e, 0x1961, 0x1964, 0x1967, 0x196a, 0x196d, + // Entry 680 - 6BF + 0x1970, 0x1973, 0x1976, 0x1979, 0x197c, 0x197f, 0x1982, 0x1985, + 0x1988, 0x198b, 0x198e, 0x1991, 0x1994, 0x1997, 0x199a, 0x199d, + 0x19a0, 0x19a3, 0x19a6, 0x19a9, 0x19ac, 0x19af, 0x19b2, 0x19b5, + 0x19b8, 0x19bb, 0x19be, 0x19c1, 0x19c4, 0x19c7, 0x19ca, 0x19cd, + 0x19d0, 0x19d3, 0x19d6, 0x19d9, 0x19dc, 0x19df, 0x19e2, 0x19e5, + 0x19e8, 0x19eb, 0x19ee, 0x19f1, 0x19f4, 0x19f7, 0x19fa, 0x19fd, + 0x1a00, 0x1a03, 0x1a06, 0x1a09, 0x1a0c, 0x1a0f, 0x1a12, 0x1a15, + 0x1a18, 0x1a1b, 0x1a1e, 0x1a21, 0x1a24, 0x1a27, 0x1a2a, 0x1a2d, + // Entry 6C0 - 6FF + 0x1a30, +} // Size: 3482 bytes + +var xorData string = "" + // Size: 4907 bytes + "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + + "\x02\x0f\x1f\x02\x0f\x1d\x02\x01\x13\x02\x0f\x16\x02\x0f\x0b\x02\x0f3" + + "\x02\x0f7\x02\x0f?\x02\x0f/\x02\x0f*\x02\x0c&\x02\x0c*\x02\x0c;\x02\x0c9" + + "\x02\x0c%\x02\xab\xed\x02\xab\xe2\x02\xab\xe3\x02\xa9\xe0\x02\xa9\xe1" + + "\x02\xa9\xe6\x02\xa3\xcb\x02\xa3\xc8\x02\xa3\xc9\x02\x01#\x02\x01\x08" + + "\x02\x0e>\x02\x0e'\x02\x0f\x03\x02\x03\x0d\x02\x03\x09\x02\x03\x17\x02" + + "\x03\x0e\x02\x02\x03\x02\x011\x02\x01\x00\x02\x01\x10\x02\x03<\x02\x07" + + "\x0d\x02\x02\x0c\x02\x0c0\x02\x01\x03\x02\x01\x01\x02\x01 \x02\x01\x22" + + "\x02\x01)\x02\x01\x0a\x02\x01\x0c\x02\x02\x06\x02\x02\x02\x02\x03\x10" + + "\x03\x037 \x03\x0b+\x03\x021\x00\x02\x01\x04\x02\x01\x02\x02\x019\x02" + + "\x03\x1c\x02\x02$\x03\x80p$\x02\x03:\x02\x03\x0a\x03\xc1r.\x03\xc1r,\x03" + + "\xc1r\x02\x02\x02:\x02\x02>\x02\x02,\x02\x02\x10\x02\x02\x00\x03\xc1s<" + + "\x03\xc1s*\x03\xc2L$\x03\xc2L;\x02\x09)\x02\x0a\x19\x03\x83\xab\xe3\x03" + + "\x83\xab\xf2\x03 4\xe0\x03\x81\xab\xea\x03\x81\xab\xf3\x03 4\xef\x03\x96" + + "\xe1\xcd\x03\x84\xe5\xc3\x02\x0d\x11\x03\x8b\xec\xcb\x03\x94\xec\xcf\x03" + + "\x9a\xec\xc2\x03\x8b\xec\xdb\x03\x94\xec\xdf\x03\x9a\xec\xd2\x03\x01\x0c" + + "!\x03\x01\x0c#\x03ʠ\x9d\x03ʣ\x9c\x03ʢ\x9f\x03ʥ\x9e\x03ʤ\x91\x03ʧ\x90\x03" + + "ʦ\x93\x03ʩ\x92\x03ʨ\x95\x03\xca\xf3\xb5\x03\xca\xf0\xb4\x03\xca\xf1\xb7" + + "\x03\xca\xf6\xb6\x03\xca\xf7\x89\x03\xca\xf4\x88\x03\xca\xf5\x8b\x03\xca" + + "\xfa\x8a\x03\xca\xfb\x8d\x03\xca\xf8\x8c\x03\xca\xf9\x8f\x03\xca\xfe\x8e" + + "\x03\xca\xff\x81\x03\xca\xfc\x80\x03\xca\xfd\x83\x03\xca\xe2\x82\x03\xca" + + "\xe3\x85\x03\xca\xe0\x84\x03\xca\xe1\x87\x03\xca\xe6\x86\x03\xca\xe7\x99" + + "\x03\xca\xe4\x98\x03\xca\xe5\x9b\x03\xca\xea\x9a\x03\xca\xeb\x9d\x03\xca" + + "\xe8\x9c\x03ؓ\x89\x03ߔ\x8b\x02\x010\x03\x03\x04\x1e\x03\x04\x15\x12\x03" + + "\x0b\x05,\x03\x06\x04\x00\x03\x06\x04)\x03\x06\x044\x03\x06\x04<\x03\x06" + + "\x05\x1d\x03\x06\x06\x00\x03\x06\x06\x0a\x03\x06\x06'\x03\x06\x062\x03" + + "\x0786\x03\x079/\x03\x079 \x03\x07:\x0e\x03\x07:\x1b\x03\x07:%\x03\x07;/" + + "\x03\x07;%\x03\x074\x11\x03\x076\x09\x03\x077*\x03\x070\x01\x03\x070\x0f" + + "\x03\x070.\x03\x071\x16\x03\x071\x04\x03\x0710\x03\x072\x18\x03\x072-" + + "\x03\x073\x14\x03\x073>\x03\x07'\x09\x03\x07 \x00\x03\x07\x1f\x0b\x03" + + "\x07\x18#\x03\x07\x18(\x03\x07\x186\x03\x07\x18\x03\x03\x07\x19\x16\x03" + + "\x07\x116\x03\x07\x12'\x03\x07\x13\x10\x03\x07\x0c&\x03\x07\x0c\x08\x03" + + "\x07\x0c\x13\x03\x07\x0d\x02\x03\x07\x0d\x1c\x03\x07\x0b5\x03\x07\x0b" + + "\x0a\x03\x07\x0b\x01\x03\x07\x0b\x0f\x03\x07\x05\x00\x03\x07\x05\x09\x03" + + "\x07\x05\x0b\x03\x07\x07\x01\x03\x07\x07\x08\x03\x07\x00<\x03\x07\x00+" + + "\x03\x07\x01)\x03\x07\x01\x1b\x03\x07\x01\x08\x03\x07\x03?\x03\x0445\x03" + + "\x044\x08\x03\x0454\x03\x04)/\x03\x04)5\x03\x04+\x05\x03\x04+\x14\x03" + + "\x04+ \x03\x04+<\x03\x04*&\x03\x04*\x22\x03\x04&8\x03\x04!\x01\x03\x04!" + + "\x22\x03\x04\x11+\x03\x04\x10.\x03\x04\x104\x03\x04\x13=\x03\x04\x12\x04" + + "\x03\x04\x12\x0a\x03\x04\x0d\x1d\x03\x04\x0d\x07\x03\x04\x0d \x03\x05<>" + + "\x03\x055<\x03\x055!\x03\x055#\x03\x055&\x03\x054\x1d\x03\x054\x02\x03" + + "\x054\x07\x03\x0571\x03\x053\x1a\x03\x053\x16\x03\x05.<\x03\x05.\x07\x03" + + "\x05):\x03\x05)<\x03\x05)\x0c\x03\x05)\x15\x03\x05+-\x03\x05+5\x03\x05$" + + "\x1e\x03\x05$\x14\x03\x05'\x04\x03\x05'\x14\x03\x05&\x02\x03\x05\x226" + + "\x03\x05\x22\x0c\x03\x05\x22\x1c\x03\x05\x19\x0a\x03\x05\x1b\x09\x03\x05" + + "\x1b\x0c\x03\x05\x14\x07\x03\x05\x16?\x03\x05\x16\x0c\x03\x05\x0c\x05" + + "\x03\x05\x0e\x0f\x03\x05\x01\x0e\x03\x05\x00(\x03\x05\x030\x03\x05\x03" + + "\x06\x03\x0a==\x03\x0a=1\x03\x0a=,\x03\x0a=\x0c\x03\x0a??\x03\x0a<\x08" + + "\x03\x0a9!\x03\x0a9)\x03\x0a97\x03\x0a99\x03\x0a6\x0a\x03\x0a6\x1c\x03" + + "\x0a6\x17\x03\x0a7'\x03\x0a78\x03\x0a73\x03\x0a'\x01\x03\x0a'&\x03\x0a" + + "\x1f\x0e\x03\x0a\x1f\x03\x03\x0a\x1f3\x03\x0a\x1b/\x03\x0a\x18\x19\x03" + + "\x0a\x19\x01\x03\x0a\x16\x14\x03\x0a\x0e\x22\x03\x0a\x0f\x10\x03\x0a\x0f" + + "\x02\x03\x0a\x0f \x03\x0a\x0c\x04\x03\x0a\x0b>\x03\x0a\x0b+\x03\x0a\x08/" + + "\x03\x0a\x046\x03\x0a\x05\x14\x03\x0a\x00\x04\x03\x0a\x00\x10\x03\x0a" + + "\x00\x14\x03\x0b<3\x03\x0b;*\x03\x0b9\x22\x03\x0b9)\x03\x0b97\x03\x0b+" + + "\x10\x03\x0b((\x03\x0b&5\x03\x0b$\x1c\x03\x0b$\x12\x03\x0b%\x04\x03\x0b#" + + "<\x03\x0b#0\x03\x0b#\x0d\x03\x0b#\x19\x03\x0b!:\x03\x0b!\x1f\x03\x0b!" + + "\x00\x03\x0b\x1e5\x03\x0b\x1c\x1d\x03\x0b\x1d-\x03\x0b\x1d(\x03\x0b\x18." + + "\x03\x0b\x18 \x03\x0b\x18\x16\x03\x0b\x14\x13\x03\x0b\x15$\x03\x0b\x15" + + "\x22\x03\x0b\x12\x1b\x03\x0b\x12\x10\x03\x0b\x132\x03\x0b\x13=\x03\x0b" + + "\x12\x18\x03\x0b\x0c&\x03\x0b\x061\x03\x0b\x06:\x03\x0b\x05#\x03\x0b\x05" + + "<\x03\x0b\x04\x0b\x03\x0b\x04\x04\x03\x0b\x04\x1b\x03\x0b\x042\x03\x0b" + + "\x041\x03\x0b\x03\x03\x03\x0b\x03\x1d\x03\x0b\x03/\x03\x0b\x03+\x03\x0b" + + "\x02\x1b\x03\x0b\x02\x00\x03\x0b\x01\x1e\x03\x0b\x01\x08\x03\x0b\x015" + + "\x03\x06\x0d9\x03\x06\x0d=\x03\x06\x0d?\x03\x02\x001\x03\x02\x003\x03" + + "\x02\x02\x19\x03\x02\x006\x03\x02\x02\x1b\x03\x02\x004\x03\x02\x00<\x03" + + "\x02\x02\x0a\x03\x02\x02\x0e\x03\x02\x01\x1a\x03\x02\x01\x07\x03\x02\x01" + + "\x05\x03\x02\x01\x0b\x03\x02\x01%\x03\x02\x01\x0c\x03\x02\x01\x04\x03" + + "\x02\x01\x1c\x03\x02\x00.\x03\x02\x002\x03\x02\x00>\x03\x02\x00\x12\x03" + + "\x02\x00\x16\x03\x02\x011\x03\x02\x013\x03\x02\x02 \x03\x02\x02%\x03\x02" + + "\x02$\x03\x02\x028\x03\x02\x02;\x03\x02\x024\x03\x02\x012\x03\x02\x022" + + "\x03\x02\x02/\x03\x02\x01,\x03\x02\x01\x13\x03\x02\x01\x16\x03\x02\x01" + + "\x11\x03\x02\x01\x1e\x03\x02\x01\x15\x03\x02\x01\x17\x03\x02\x01\x0f\x03" + + "\x02\x01\x08\x03\x02\x00?\x03\x02\x03\x07\x03\x02\x03\x0d\x03\x02\x03" + + "\x13\x03\x02\x03\x1d\x03\x02\x03\x1f\x03\x02\x00\x03\x03\x02\x00\x0d\x03" + + "\x02\x00\x01\x03\x02\x00\x1b\x03\x02\x00\x19\x03\x02\x00\x18\x03\x02\x00" + + "\x13\x03\x02\x00/\x03\x07>\x12\x03\x07<\x1f\x03\x07>\x1d\x03\x06\x1d\x0e" + + "\x03\x07>\x1c\x03\x07>:\x03\x07>\x13\x03\x04\x12+\x03\x07?\x03\x03\x07>" + + "\x02\x03\x06\x224\x03\x06\x1a.\x03\x07<%\x03\x06\x1c\x0b\x03\x0609\x03" + + "\x05\x1f\x01\x03\x04'\x08\x03\x93\xfd\xf5\x03\x02\x0d \x03\x02\x0d#\x03" + + "\x02\x0d!\x03\x02\x0d&\x03\x02\x0d\x22\x03\x02\x0d/\x03\x02\x0d,\x03\x02" + + "\x0d$\x03\x02\x0d'\x03\x02\x0d%\x03\x02\x0d;\x03\x02\x0d=\x03\x02\x0d?" + + "\x03\x099.\x03\x08\x0b7\x03\x08\x02\x14\x03\x08\x14\x0d\x03\x08.:\x03" + + "\x089'\x03\x0f\x0b\x18\x03\x0f\x1c1\x03\x0f\x17&\x03\x0f9\x1f\x03\x0f0" + + "\x0c\x03\x0e\x0a9\x03\x0e\x056\x03\x0e\x1c#\x03\x0f\x13\x0e\x03\x072\x00" + + "\x03\x070\x0d\x03\x072\x0b\x03\x06\x11\x18\x03\x070\x10\x03\x06\x0f(\x03" + + "\x072\x05\x03\x06\x0f,\x03\x073\x15\x03\x06\x07\x08\x03\x05\x16\x02\x03" + + "\x04\x0b \x03\x05:8\x03\x05\x16%\x03\x0a\x0d\x1f\x03\x06\x16\x10\x03\x05" + + "\x1d5\x03\x05*;\x03\x05\x16\x1b\x03\x04.-\x03\x06\x1a\x19\x03\x04\x03," + + "\x03\x0b87\x03\x04/\x0a\x03\x06\x00,\x03\x04-\x01\x03\x04\x1e-\x03\x06/(" + + "\x03\x0a\x0b5\x03\x06\x0e7\x03\x06\x07.\x03\x0597\x03\x0a*%\x03\x0760" + + "\x03\x06\x0c;\x03\x05'\x00\x03\x072.\x03\x072\x08\x03\x06=\x01\x03\x06" + + "\x05\x1b\x03\x06\x06\x12\x03\x06$=\x03\x06'\x0d\x03\x04\x11\x0f\x03\x076" + + ",\x03\x06\x07;\x03\x06.,\x03\x86\xf9\xea\x03\x8f\xff\xeb\x02\x092\x02" + + "\x095\x02\x094\x02\x09;\x02\x09>\x02\x098\x02\x09*\x02\x09/\x02\x09,\x02" + + "\x09%\x02\x09&\x02\x09#\x02\x09 \x02\x08!\x02\x08%\x02\x08$\x02\x08+\x02" + + "\x08.\x02\x08*\x02\x08&\x02\x088\x02\x08>\x02\x084\x02\x086\x02\x080\x02" + + "\x08\x10\x02\x08\x17\x02\x08\x12\x02\x08\x1d\x02\x08\x1f\x02\x08\x13\x02" + + "\x08\x15\x02\x08\x14\x02\x08\x0c\x03\x8b\xfd\xd0\x03\x81\xec\xc6\x03\x87" + + "\xe0\x8a\x03-2\xe3\x03\x80\xef\xe4\x03-2\xea\x03\x88\xe6\xeb\x03\x8e\xe6" + + "\xe8\x03\x84\xe6\xe9\x03\x97\xe6\xee\x03-2\xf9\x03-2\xf6\x03\x8e\xe3\xad" + + "\x03\x80\xe3\x92\x03\x88\xe3\x90\x03\x8e\xe3\x90\x03\x80\xe3\x97\x03\x88" + + "\xe3\x95\x03\x88\xfe\xcb\x03\x8e\xfe\xca\x03\x84\xfe\xcd\x03\x91\xef\xc9" + + "\x03-2\xc1\x03-2\xc0\x03-2\xcb\x03\x88@\x09\x03\x8e@\x08\x03\x8f\xe0\xf5" + + "\x03\x8e\xe6\xf9\x03\x8e\xe0\xfa\x03\x93\xff\xf4\x03\x84\xee\xd3\x03\x0b" + + "(\x04\x023 \x03\x0b)\x08\x021;\x02\x01*\x03\x0b#\x10\x03\x0b 0\x03\x0b!" + + "\x10\x03\x0b!0\x03\x07\x15\x08\x03\x09?5\x03\x07\x1f\x08\x03\x07\x17\x0b" + + "\x03\x09\x1f\x15\x03\x0b\x1c7\x03\x0a+#\x03\x06\x1a\x1b\x03\x06\x1a\x14" + + "\x03\x0a\x01\x18\x03\x06#\x1b\x03\x0a2\x0c\x03\x0a\x01\x04\x03\x09#;\x03" + + "\x08='\x03\x08\x1a\x0a\x03\x07\x03\x0a\x111\x03\x09\x1b\x09\x03\x073.\x03\x07" + + "\x01\x00\x03\x09/,\x03\x07#>\x03\x07\x048\x03\x0a\x1f\x22\x03\x098>\x03" + + "\x09\x11\x00\x03\x08/\x17\x03\x06'\x22\x03\x0b\x1a+\x03\x0a\x22\x19\x03" + + "\x0a/1\x03\x0974\x03\x09\x0f\x22\x03\x08,\x22\x03\x08?\x14\x03\x07$5\x03" + + "\x07<3\x03\x07=*\x03\x07\x13\x18\x03\x068\x0a\x03\x06\x09\x16\x03\x06" + + "\x13\x00\x03\x08\x067\x03\x08\x01\x03\x03\x08\x12\x1d\x03\x07+7\x03\x06(" + + ";\x03\x06\x1c?\x03\x07\x0e\x17\x03\x0a\x06\x1d\x03\x0a\x19\x07\x03\x08" + + "\x14$\x03\x07$;\x03\x08,$\x03\x08\x06\x0d\x03\x07\x16\x0a\x03\x06>>\x03" + + "\x0a\x06\x12\x03\x0a\x14)\x03\x09\x0d\x1f\x03\x09\x12\x17\x03\x09\x19" + + "\x01\x03\x08\x11 \x03\x08\x1d'\x03\x06<\x1a\x03\x0a.\x00\x03\x07'\x18" + + "\x03\x0a\x22\x08\x03\x08\x0d\x0a\x03\x08\x13)\x03\x07*)\x03\x06<,\x03" + + "\x07\x0b\x1a\x03\x09.\x14\x03\x09\x0d\x1e\x03\x07\x0e#\x03\x0b\x1d'\x03" + + "\x0a\x0a8\x03\x09%2\x03\x08+&\x03\x080\x12\x03\x0a)4\x03\x08\x06\x1f\x03" + + "\x0b\x1b\x1a\x03\x0a\x1b\x0f\x03\x0b\x1d*\x03\x09\x16$\x03\x090\x11\x03" + + "\x08\x11\x08\x03\x0a*(\x03\x0a\x042\x03\x089,\x03\x074'\x03\x07\x0f\x05" + + "\x03\x09\x0b\x0a\x03\x07\x1b\x01\x03\x09\x17:\x03\x09.\x0d\x03\x07.\x11" + + "\x03\x09+\x15\x03\x080\x13\x03\x0b\x1f\x19\x03\x0a \x11\x03\x0a\x220\x03" + + "\x09\x07;\x03\x08\x16\x1c\x03\x07,\x13\x03\x07\x0e/\x03\x06\x221\x03\x0a" + + ".\x0a\x03\x0a7\x02\x03\x0a\x032\x03\x0a\x1d.\x03\x091\x06\x03\x09\x19:" + + "\x03\x08\x02/\x03\x060+\x03\x06\x0f-\x03\x06\x1c\x1f\x03\x06\x1d\x07\x03" + + "\x0a,\x11\x03\x09=\x0d\x03\x09\x0b;\x03\x07\x1b/\x03\x0a\x1f:\x03\x09 " + + "\x1f\x03\x09.\x10\x03\x094\x0b\x03\x09\x1a1\x03\x08#\x1a\x03\x084\x1d" + + "\x03\x08\x01\x1f\x03\x08\x11\x22\x03\x07'8\x03\x07\x1a>\x03\x0757\x03" + + "\x06&9\x03\x06+\x11\x03\x0a.\x0b\x03\x0a,>\x03\x0a4#\x03\x08%\x17\x03" + + "\x07\x05\x22\x03\x07\x0c\x0b\x03\x0a\x1d+\x03\x0a\x19\x16\x03\x09+\x1f" + + "\x03\x09\x08\x0b\x03\x08\x16\x18\x03\x08+\x12\x03\x0b\x1d\x0c\x03\x0a=" + + "\x10\x03\x0a\x09\x0d\x03\x0a\x10\x11\x03\x09&0\x03\x08(\x1f\x03\x087\x07" + + "\x03\x08\x185\x03\x07'6\x03\x06.\x05\x03\x06=\x04\x03\x06;;\x03\x06\x06," + + "\x03\x0b\x18>\x03\x08\x00\x18\x03\x06 \x03\x03\x06<\x00\x03\x09%\x18\x03" + + "\x0b\x1c<\x03\x0a%!\x03\x0a\x09\x12\x03\x0a\x16\x02\x03\x090'\x03\x09" + + "\x0e=\x03\x08 \x0e\x03\x08>\x03\x03\x074>\x03\x06&?\x03\x06\x19\x09\x03" + + "\x06?(\x03\x0a-\x0e\x03\x09:3\x03\x098:\x03\x09\x12\x0b\x03\x09\x1d\x17" + + "\x03\x087\x05\x03\x082\x14\x03\x08\x06%\x03\x08\x13\x1f\x03\x06\x06\x0e" + + "\x03\x0a\x22<\x03\x09/<\x03\x06>+\x03\x0a'?\x03\x0a\x13\x0c\x03\x09\x10<" + + "\x03\x07\x1b=\x03\x0a\x19\x13\x03\x09\x22\x1d\x03\x09\x07\x0d\x03\x08)" + + "\x1c\x03\x06=\x1a\x03\x0a/4\x03\x0a7\x11\x03\x0a\x16:\x03\x09?3\x03\x09:" + + "/\x03\x09\x05\x0a\x03\x09\x14\x06\x03\x087\x22\x03\x080\x07\x03\x08\x1a" + + "\x1f\x03\x07\x04(\x03\x07\x04\x09\x03\x06 %\x03\x06<\x08\x03\x0a+\x14" + + "\x03\x09\x1d\x16\x03\x0a70\x03\x08 >\x03\x0857\x03\x070\x0a\x03\x06=\x12" + + "\x03\x06\x16%\x03\x06\x1d,\x03\x099#\x03\x09\x10>\x03\x07 \x1e\x03\x08" + + "\x0c<\x03\x08\x0b\x18\x03\x08\x15+\x03\x08,:\x03\x08%\x22\x03\x07\x0a$" + + "\x03\x0b\x1c=\x03\x07+\x08\x03\x0a/\x05\x03\x0a \x07\x03\x0a\x12'\x03" + + "\x09#\x11\x03\x08\x1b\x15\x03\x0a\x06\x01\x03\x09\x1c\x1b\x03\x0922\x03" + + "\x07\x14<\x03\x07\x09\x04\x03\x061\x04\x03\x07\x0e\x01\x03\x0a\x13\x18" + + "\x03\x0a-\x0c\x03\x0a?\x0d\x03\x0a\x09\x0a\x03\x091&\x03\x0a/\x0b\x03" + + "\x08$<\x03\x083\x1d\x03\x08\x0c$\x03\x08\x0d\x07\x03\x08\x0d?\x03\x08" + + "\x0e\x14\x03\x065\x0a\x03\x08\x1a#\x03\x08\x16#\x03\x0702\x03\x07\x03" + + "\x1a\x03\x06(\x1d\x03\x06+\x1b\x03\x06\x0b\x05\x03\x06\x0b\x17\x03\x06" + + "\x0c\x04\x03\x06\x1e\x19\x03\x06+0\x03\x062\x18\x03\x0b\x16\x1e\x03\x0a+" + + "\x16\x03\x0a-?\x03\x0a#:\x03\x0a#\x10\x03\x0a%$\x03\x0a>+\x03\x0a01\x03" + + "\x0a1\x10\x03\x0a\x099\x03\x0a\x0a\x12\x03\x0a\x19\x1f\x03\x0a\x19\x12" + + "\x03\x09*)\x03\x09-\x16\x03\x09.1\x03\x09.2\x03\x09<\x0e\x03\x09> \x03" + + "\x093\x12\x03\x09\x0b\x01\x03\x09\x1c2\x03\x09\x11\x1c\x03\x09\x15%\x03" + + "\x08,&\x03\x08!\x22\x03\x089(\x03\x08\x0b\x1a\x03\x08\x0d2\x03\x08\x0c" + + "\x04\x03\x08\x0c\x06\x03\x08\x0c\x1f\x03\x08\x0c\x0c\x03\x08\x0f\x1f\x03" + + "\x08\x0f\x1d\x03\x08\x00\x14\x03\x08\x03\x14\x03\x08\x06\x16\x03\x08\x1e" + + "#\x03\x08\x11\x11\x03\x08\x10\x18\x03\x08\x14(\x03\x07)\x1e\x03\x07.1" + + "\x03\x07 $\x03\x07 '\x03\x078\x08\x03\x07\x0d0\x03\x07\x0f7\x03\x07\x05#" + + "\x03\x07\x05\x1a\x03\x07\x1a7\x03\x07\x1d-\x03\x07\x17\x10\x03\x06)\x1f" + + "\x03\x062\x0b\x03\x066\x16\x03\x06\x09\x11\x03\x09(\x1e\x03\x07!5\x03" + + "\x0b\x11\x16\x03\x0a/\x04\x03\x0a,\x1a\x03\x0b\x173\x03\x0a,1\x03\x0a/5" + + "\x03\x0a\x221\x03\x0a\x22\x0d\x03\x0a?%\x03\x0a<,\x03\x0a?#\x03\x0a>\x19" + + "\x03\x0a\x08&\x03\x0a\x0b\x0e\x03\x0a\x0c:\x03\x0a\x0c+\x03\x0a\x03\x22" + + "\x03\x0a\x06)\x03\x0a\x11\x10\x03\x0a\x11\x1a\x03\x0a\x17-\x03\x0a\x14(" + + "\x03\x09)\x1e\x03\x09/\x09\x03\x09.\x00\x03\x09,\x07\x03\x09/*\x03\x09-9" + + "\x03\x09\x228\x03\x09%\x09\x03\x09:\x12\x03\x09;\x1d\x03\x09?\x06\x03" + + "\x093%\x03\x096\x05\x03\x096\x08\x03\x097\x02\x03\x09\x07,\x03\x09\x04," + + "\x03\x09\x1f\x16\x03\x09\x11\x03\x03\x09\x11\x12\x03\x09\x168\x03\x08*" + + "\x05\x03\x08/2\x03\x084:\x03\x08\x22+\x03\x08 0\x03\x08&\x0a\x03\x08;" + + "\x10\x03\x08>$\x03\x08>\x18\x03\x0829\x03\x082:\x03\x081,\x03\x081<\x03" + + "\x081\x1c\x03\x087#\x03\x087*\x03\x08\x09'\x03\x08\x00\x1d\x03\x08\x05-" + + "\x03\x08\x1f4\x03\x08\x1d\x04\x03\x08\x16\x0f\x03\x07*7\x03\x07'!\x03" + + "\x07%\x1b\x03\x077\x0c\x03\x07\x0c1\x03\x07\x0c.\x03\x07\x00\x06\x03\x07" + + "\x01\x02\x03\x07\x010\x03\x07\x06=\x03\x07\x01\x03\x03\x07\x01\x13\x03" + + "\x07\x06\x06\x03\x07\x05\x0a\x03\x07\x1f\x09\x03\x07\x17:\x03\x06*1\x03" + + "\x06-\x1d\x03\x06\x223\x03\x062:\x03\x060$\x03\x066\x1e\x03\x064\x12\x03" + + "\x0645\x03\x06\x0b\x00\x03\x06\x0b7\x03\x06\x07\x1f\x03\x06\x15\x12\x03" + + "\x0c\x05\x0f\x03\x0b+\x0b\x03\x0b+-\x03\x06\x16\x1b\x03\x06\x15\x17\x03" + + "\x89\xca\xea\x03\x89\xca\xe8\x03\x0c8\x10\x03\x0c8\x01\x03\x0c8\x0f\x03" + + "\x0d8%\x03\x0d8!\x03\x0c8-\x03\x0c8/\x03\x0c8+\x03\x0c87\x03\x0c85\x03" + + "\x0c9\x09\x03\x0c9\x0d\x03\x0c9\x0f\x03\x0c9\x0b\x03\xcfu\x0c\x03\xcfu" + + "\x0f\x03\xcfu\x0e\x03\xcfu\x09\x03\x0c9\x10\x03\x0d9\x0c\x03\xcf`;\x03" + + "\xcf`>\x03\xcf`9\x03\xcf`8\x03\xcf`7\x03\xcf`*\x03\xcf`-\x03\xcf`,\x03" + + "\x0d\x1b\x1a\x03\x0d\x1b&\x03\x0c=.\x03\x0c=%\x03\x0c>\x1e\x03\x0c>\x14" + + "\x03\x0c?\x06\x03\x0c?\x0b\x03\x0c?\x0c\x03\x0c?\x0d\x03\x0c?\x02\x03" + + "\x0c>\x0f\x03\x0c>\x08\x03\x0c>\x09\x03\x0c>,\x03\x0c>\x0c\x03\x0c?\x13" + + "\x03\x0c?\x16\x03\x0c?\x15\x03\x0c?\x1c\x03\x0c?\x1f\x03\x0c?\x1d\x03" + + "\x0c?\x1a\x03\x0c?\x17\x03\x0c?\x08\x03\x0c?\x09\x03\x0c?\x0e\x03\x0c?" + + "\x04\x03\x0c?\x05\x03\x0c" + + "\x03\x0c=2\x03\x0c=6\x03\x0c<\x07\x03\x0c<\x05\x03\x0e:!\x03\x0e:#\x03" + + "\x0e8\x09\x03\x0e:&\x03\x0e8\x0b\x03\x0e:$\x03\x0e:,\x03\x0e8\x1a\x03" + + "\x0e8\x1e\x03\x0e:*\x03\x0e:7\x03\x0e:5\x03\x0e:;\x03\x0e:\x15\x03\x0e:<" + + "\x03\x0e:4\x03\x0e:'\x03\x0e:-\x03\x0e:%\x03\x0e:?\x03\x0e:=\x03\x0e:)" + + "\x03\x0e:/\x03\xcfs'\x03\x0d=\x0f\x03\x0d+*\x03\x0d99\x03\x0d9;\x03\x0d9" + + "?\x03\x0d)\x0d\x03\x0d(%\x02\x01\x18\x02\x01(\x02\x03'\x02\x03)\x02\x03+" + + "\x02\x03/\x02\x03\x19\x02\x03\x1b\x02\x03\x1f\x03\x0d\x22\x18\x03\x0d" + + "\x22\x1a\x03\x0d\x22'\x03\x0d\x22/\x03\x0d\x223\x03\x0d\x22$\x02\x01\x1e" + + "\x03\x0f$!\x03\x0f87\x03\x0f4\x0e\x03\x0f5\x1d\x03\x06'\x03\x03\x0f\x08" + + "\x18\x03\x0f\x0d\x1b\x03\x0e2=\x03\x0e;\x08\x03\x0e:\x0b\x03\x0e\x06$" + + "\x03\x0e\x0d)\x03\x0e\x16\x1f\x03\x0e\x16\x1b\x03\x0d$\x0a\x03\x05,\x1d" + + "\x03\x0d. \x03\x0d.#\x03\x0c(/\x03\x09%\x02\x03\x0d90\x03\x0d\x0e4\x03" + + "\x0d\x0d\x0f\x03\x0c#\x00\x03\x0c,\x1e\x03\x0c2\x0e\x03\x0c\x01\x17\x03" + + "\x0c\x09:\x03\x0e\x173\x03\x0c\x08\x03\x03\x0c\x11\x07\x03\x0c\x10\x18" + + "\x03\x0c\x1f\x1c\x03\x0c\x19\x0e\x03\x0c\x1a\x1f\x03\x0f0>\x03\x0b->\x03" + + "\x0b<+\x03\x0b8\x13\x03\x0b\x043\x03\x0b\x14\x03\x03\x0b\x16%\x03\x0d" + + "\x22&\x03\x0b\x1a\x1a\x03\x0b\x1a\x04\x03\x0a%9\x03\x0a&2\x03\x0a&0\x03" + + "\x0a!\x1a\x03\x0a!7\x03\x0a5\x10\x03\x0a=4\x03\x0a?\x0e\x03\x0a>\x10\x03" + + "\x0a\x00 \x03\x0a\x0f:\x03\x0a\x0f9\x03\x0a\x0b\x0a\x03\x0a\x17%\x03\x0a" + + "\x1b-\x03\x09-\x1a\x03\x09,4\x03\x09.,\x03\x09)\x09\x03\x096!\x03\x091" + + "\x1f\x03\x093\x16\x03\x0c+\x1f\x03\x098 \x03\x098=\x03\x0c(\x1a\x03\x0c(" + + "\x16\x03\x09\x0a+\x03\x09\x16\x12\x03\x09\x13\x0e\x03\x09\x153\x03\x08)!" + + "\x03\x09\x1a\x01\x03\x09\x18\x01\x03\x08%#\x03\x08>\x22\x03\x08\x05%\x03" + + "\x08\x02*\x03\x08\x15;\x03\x08\x1b7\x03\x0f\x07\x1d\x03\x0f\x04\x03\x03" + + "\x070\x0c\x03\x07;\x0b\x03\x07\x08\x17\x03\x07\x12\x06\x03\x06/-\x03\x06" + + "71\x03\x065+\x03\x06>7\x03\x06\x049\x03\x05+\x1e\x03\x05,\x17\x03\x05 " + + "\x1d\x03\x05\x22\x05\x03\x050\x1d" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// idnaTrie. Total size: 31598 bytes (30.86 KiB). Checksum: d3118eda0d6b5360. +type idnaTrie struct{} + +func newIdnaTrie(i int) *idnaTrie { + return &idnaTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *idnaTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 133: + return uint16(idnaValues[n<<6+uint32(b)]) + default: + n -= 133 + return uint16(idnaSparse.lookup(n, b)) + } +} + +// idnaValues: 135 blocks, 8640 entries, 17280 bytes +// The third block is the zero block. +var idnaValues = [8640]uint16{ + // Block 0x0, offset 0x0 + 0x00: 0x0080, 0x01: 0x0080, 0x02: 0x0080, 0x03: 0x0080, 0x04: 0x0080, 0x05: 0x0080, + 0x06: 0x0080, 0x07: 0x0080, 0x08: 0x0080, 0x09: 0x0080, 0x0a: 0x0080, 0x0b: 0x0080, + 0x0c: 0x0080, 0x0d: 0x0080, 0x0e: 0x0080, 0x0f: 0x0080, 0x10: 0x0080, 0x11: 0x0080, + 0x12: 0x0080, 0x13: 0x0080, 0x14: 0x0080, 0x15: 0x0080, 0x16: 0x0080, 0x17: 0x0080, + 0x18: 0x0080, 0x19: 0x0080, 0x1a: 0x0080, 0x1b: 0x0080, 0x1c: 0x0080, 0x1d: 0x0080, + 0x1e: 0x0080, 0x1f: 0x0080, 0x20: 0x0080, 0x21: 0x0080, 0x22: 0x0080, 0x23: 0x0080, + 0x24: 0x0080, 0x25: 0x0080, 0x26: 0x0080, 0x27: 0x0080, 0x28: 0x0080, 0x29: 0x0080, + 0x2a: 0x0080, 0x2b: 0x0080, 0x2c: 0x0080, 0x2d: 0x0008, 0x2e: 0x0008, 0x2f: 0x0080, + 0x30: 0x0008, 0x31: 0x0008, 0x32: 0x0008, 0x33: 0x0008, 0x34: 0x0008, 0x35: 0x0008, + 0x36: 0x0008, 0x37: 0x0008, 0x38: 0x0008, 0x39: 0x0008, 0x3a: 0x0080, 0x3b: 0x0080, + 0x3c: 0x0080, 0x3d: 0x0080, 0x3e: 0x0080, 0x3f: 0x0080, + // Block 0x1, offset 0x40 + 0x40: 0x0080, 0x41: 0xe105, 0x42: 0xe105, 0x43: 0xe105, 0x44: 0xe105, 0x45: 0xe105, + 0x46: 0xe105, 0x47: 0xe105, 0x48: 0xe105, 0x49: 0xe105, 0x4a: 0xe105, 0x4b: 0xe105, + 0x4c: 0xe105, 0x4d: 0xe105, 0x4e: 0xe105, 0x4f: 0xe105, 0x50: 0xe105, 0x51: 0xe105, + 0x52: 0xe105, 0x53: 0xe105, 0x54: 0xe105, 0x55: 0xe105, 0x56: 0xe105, 0x57: 0xe105, + 0x58: 0xe105, 0x59: 0xe105, 0x5a: 0xe105, 0x5b: 0x0080, 0x5c: 0x0080, 0x5d: 0x0080, + 0x5e: 0x0080, 0x5f: 0x0080, 0x60: 0x0080, 0x61: 0x0008, 0x62: 0x0008, 0x63: 0x0008, + 0x64: 0x0008, 0x65: 0x0008, 0x66: 0x0008, 0x67: 0x0008, 0x68: 0x0008, 0x69: 0x0008, + 0x6a: 0x0008, 0x6b: 0x0008, 0x6c: 0x0008, 0x6d: 0x0008, 0x6e: 0x0008, 0x6f: 0x0008, + 0x70: 0x0008, 0x71: 0x0008, 0x72: 0x0008, 0x73: 0x0008, 0x74: 0x0008, 0x75: 0x0008, + 0x76: 0x0008, 0x77: 0x0008, 0x78: 0x0008, 0x79: 0x0008, 0x7a: 0x0008, 0x7b: 0x0080, + 0x7c: 0x0080, 0x7d: 0x0080, 0x7e: 0x0080, 0x7f: 0x0080, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x0012, 0xe9: 0x0018, + 0xea: 0x0019, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x0022, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0029, 0xf3: 0x0031, 0xf4: 0x003a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x0042, 0xf9: 0x0049, 0xfa: 0x0051, 0xfb: 0x0018, + 0xfc: 0x0059, 0xfd: 0x0061, 0xfe: 0x0069, 0xff: 0x0018, + // Block 0x4, offset 0x100 + 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, + 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, + 0x10c: 0xe00d, 0x10d: 0x0008, 0x10e: 0xe00d, 0x10f: 0x0008, 0x110: 0xe00d, 0x111: 0x0008, + 0x112: 0xe00d, 0x113: 0x0008, 0x114: 0xe00d, 0x115: 0x0008, 0x116: 0xe00d, 0x117: 0x0008, + 0x118: 0xe00d, 0x119: 0x0008, 0x11a: 0xe00d, 0x11b: 0x0008, 0x11c: 0xe00d, 0x11d: 0x0008, + 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, + 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, + 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, + 0x130: 0x0071, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0079, + // Block 0x5, offset 0x140 + 0x140: 0x0079, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x0081, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, + 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, + 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, + 0x15e: 0xe00d, 0x15f: 0x0008, 0x160: 0xe00d, 0x161: 0x0008, 0x162: 0xe00d, 0x163: 0x0008, + 0x164: 0xe00d, 0x165: 0x0008, 0x166: 0xe00d, 0x167: 0x0008, 0x168: 0xe00d, 0x169: 0x0008, + 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, + 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, + 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x0089, + // Block 0x6, offset 0x180 + 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, + 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, + 0x18c: 0x0008, 0x18d: 0x0008, 0x18e: 0x00c5, 0x18f: 0x00dd, 0x190: 0x00f5, 0x191: 0xe01d, + 0x192: 0x0008, 0x193: 0x010d, 0x194: 0x0125, 0x195: 0x0008, 0x196: 0x013d, 0x197: 0x013d, + 0x198: 0xe00d, 0x199: 0x0008, 0x19a: 0x0008, 0x19b: 0x0008, 0x19c: 0x010d, 0x19d: 0x0155, + 0x19e: 0x0008, 0x19f: 0x016d, 0x1a0: 0xe00d, 0x1a1: 0x0008, 0x1a2: 0xe00d, 0x1a3: 0x0008, + 0x1a4: 0xe00d, 0x1a5: 0x0008, 0x1a6: 0x0185, 0x1a7: 0xe07d, 0x1a8: 0x0008, 0x1a9: 0x019d, + 0x1aa: 0x0008, 0x1ab: 0x0008, 0x1ac: 0xe00d, 0x1ad: 0x0008, 0x1ae: 0x0185, 0x1af: 0xe0fd, + 0x1b0: 0x0008, 0x1b1: 0x01b5, 0x1b2: 0x01cd, 0x1b3: 0xe03d, 0x1b4: 0x0008, 0x1b5: 0xe01d, + 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, + 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x0091, 0x1c5: 0x0091, + 0x1c6: 0x0091, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, + 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, + 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, + 0x1de: 0xe00d, 0x1df: 0x0008, 0x1e0: 0xe00d, 0x1e1: 0x0008, 0x1e2: 0xe00d, 0x1e3: 0x0008, + 0x1e4: 0xe00d, 0x1e5: 0x0008, 0x1e6: 0xe00d, 0x1e7: 0x0008, 0x1e8: 0xe00d, 0x1e9: 0x0008, + 0x1ea: 0xe00d, 0x1eb: 0x0008, 0x1ec: 0xe00d, 0x1ed: 0x0008, 0x1ee: 0xe00d, 0x1ef: 0x0008, + 0x1f0: 0x0008, 0x1f1: 0x028d, 0x1f2: 0x02a5, 0x1f3: 0x02bd, 0x1f4: 0xe00d, 0x1f5: 0x0008, + 0x1f6: 0x02d5, 0x1f7: 0x02ed, 0x1f8: 0xe00d, 0x1f9: 0x0008, 0x1fa: 0xe00d, 0x1fb: 0x0008, + 0x1fc: 0xe00d, 0x1fd: 0x0008, 0x1fe: 0xe00d, 0x1ff: 0x0008, + // Block 0x8, offset 0x200 + 0x200: 0xe00d, 0x201: 0x0008, 0x202: 0xe00d, 0x203: 0x0008, 0x204: 0xe00d, 0x205: 0x0008, + 0x206: 0xe00d, 0x207: 0x0008, 0x208: 0xe00d, 0x209: 0x0008, 0x20a: 0xe00d, 0x20b: 0x0008, + 0x20c: 0xe00d, 0x20d: 0x0008, 0x20e: 0xe00d, 0x20f: 0x0008, 0x210: 0xe00d, 0x211: 0x0008, + 0x212: 0xe00d, 0x213: 0x0008, 0x214: 0xe00d, 0x215: 0x0008, 0x216: 0xe00d, 0x217: 0x0008, + 0x218: 0xe00d, 0x219: 0x0008, 0x21a: 0xe00d, 0x21b: 0x0008, 0x21c: 0xe00d, 0x21d: 0x0008, + 0x21e: 0xe00d, 0x21f: 0x0008, 0x220: 0x0305, 0x221: 0x0008, 0x222: 0xe00d, 0x223: 0x0008, + 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, + 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, + 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0099, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x00a1, 0x23f: 0x0008, + // Block 0x9, offset 0x240 + 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, + 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, + 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, + 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, + 0x258: 0x00d2, 0x259: 0x00da, 0x25a: 0x00e2, 0x25b: 0x00ea, 0x25c: 0x00f2, 0x25d: 0x00fa, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0101, 0x262: 0x0089, 0x263: 0x0109, + 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, + 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, + 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, + 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, + 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, + // Block 0xa, offset 0x280 + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0111, 0x285: 0x040d, + 0x286: 0x3308, 0x287: 0x3308, 0x288: 0x3308, 0x289: 0x3308, 0x28a: 0x3308, 0x28b: 0x3308, + 0x28c: 0x3308, 0x28d: 0x3308, 0x28e: 0x3308, 0x28f: 0x33c0, 0x290: 0x3308, 0x291: 0x3308, + 0x292: 0x3308, 0x293: 0x3308, 0x294: 0x3308, 0x295: 0x3308, 0x296: 0x3308, 0x297: 0x3308, + 0x298: 0x3308, 0x299: 0x3308, 0x29a: 0x3308, 0x29b: 0x3308, 0x29c: 0x3308, 0x29d: 0x3308, + 0x29e: 0x3308, 0x29f: 0x3308, 0x2a0: 0x3308, 0x2a1: 0x3308, 0x2a2: 0x3308, 0x2a3: 0x3308, + 0x2a4: 0x3308, 0x2a5: 0x3308, 0x2a6: 0x3308, 0x2a7: 0x3308, 0x2a8: 0x3308, 0x2a9: 0x3308, + 0x2aa: 0x3308, 0x2ab: 0x3308, 0x2ac: 0x3308, 0x2ad: 0x3308, 0x2ae: 0x3308, 0x2af: 0x3308, + 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x011a, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x0122, 0x2bf: 0x043d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x003a, 0x2c5: 0x012a, + 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, + 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, + 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, + 0x2d8: 0xe105, 0x2d9: 0xe105, 0x2da: 0xe105, 0x2db: 0xe105, 0x2dc: 0xe105, 0x2dd: 0xe105, + 0x2de: 0xe105, 0x2df: 0xe105, 0x2e0: 0x049d, 0x2e1: 0x049d, 0x2e2: 0x0040, 0x2e3: 0x049d, + 0x2e4: 0x049d, 0x2e5: 0x049d, 0x2e6: 0x049d, 0x2e7: 0x049d, 0x2e8: 0x049d, 0x2e9: 0x049d, + 0x2ea: 0x049d, 0x2eb: 0x049d, 0x2ec: 0x0008, 0x2ed: 0x0008, 0x2ee: 0x0008, 0x2ef: 0x0008, + 0x2f0: 0x0008, 0x2f1: 0x0008, 0x2f2: 0x0008, 0x2f3: 0x0008, 0x2f4: 0x0008, 0x2f5: 0x0008, + 0x2f6: 0x0008, 0x2f7: 0x0008, 0x2f8: 0x0008, 0x2f9: 0x0008, 0x2fa: 0x0008, 0x2fb: 0x0008, + 0x2fc: 0x0008, 0x2fd: 0x0008, 0x2fe: 0x0008, 0x2ff: 0x0008, + // Block 0xc, offset 0x300 + 0x300: 0x0008, 0x301: 0x0008, 0x302: 0xe00f, 0x303: 0x0008, 0x304: 0x0008, 0x305: 0x0008, + 0x306: 0x0008, 0x307: 0x0008, 0x308: 0x0008, 0x309: 0x0008, 0x30a: 0x0008, 0x30b: 0x0008, + 0x30c: 0x0008, 0x30d: 0x0008, 0x30e: 0x0008, 0x30f: 0xe0c5, 0x310: 0x04b5, 0x311: 0x04cd, + 0x312: 0xe0bd, 0x313: 0xe0f5, 0x314: 0xe0fd, 0x315: 0xe09d, 0x316: 0xe0b5, 0x317: 0x0008, + 0x318: 0xe00d, 0x319: 0x0008, 0x31a: 0xe00d, 0x31b: 0x0008, 0x31c: 0xe00d, 0x31d: 0x0008, + 0x31e: 0xe00d, 0x31f: 0x0008, 0x320: 0xe00d, 0x321: 0x0008, 0x322: 0xe00d, 0x323: 0x0008, + 0x324: 0xe00d, 0x325: 0x0008, 0x326: 0xe00d, 0x327: 0x0008, 0x328: 0xe00d, 0x329: 0x0008, + 0x32a: 0xe00d, 0x32b: 0x0008, 0x32c: 0xe00d, 0x32d: 0x0008, 0x32e: 0xe00d, 0x32f: 0x0008, + 0x330: 0x04e5, 0x331: 0xe185, 0x332: 0xe18d, 0x333: 0x0008, 0x334: 0x04fd, 0x335: 0x03dd, + 0x336: 0x0018, 0x337: 0xe07d, 0x338: 0x0008, 0x339: 0xe1d5, 0x33a: 0xe00d, 0x33b: 0x0008, + 0x33c: 0x0008, 0x33d: 0x0515, 0x33e: 0x052d, 0x33f: 0x052d, + // Block 0xd, offset 0x340 + 0x340: 0x0008, 0x341: 0x0008, 0x342: 0x0008, 0x343: 0x0008, 0x344: 0x0008, 0x345: 0x0008, + 0x346: 0x0008, 0x347: 0x0008, 0x348: 0x0008, 0x349: 0x0008, 0x34a: 0x0008, 0x34b: 0x0008, + 0x34c: 0x0008, 0x34d: 0x0008, 0x34e: 0x0008, 0x34f: 0x0008, 0x350: 0x0008, 0x351: 0x0008, + 0x352: 0x0008, 0x353: 0x0008, 0x354: 0x0008, 0x355: 0x0008, 0x356: 0x0008, 0x357: 0x0008, + 0x358: 0x0008, 0x359: 0x0008, 0x35a: 0x0008, 0x35b: 0x0008, 0x35c: 0x0008, 0x35d: 0x0008, + 0x35e: 0x0008, 0x35f: 0x0008, 0x360: 0xe00d, 0x361: 0x0008, 0x362: 0xe00d, 0x363: 0x0008, + 0x364: 0xe00d, 0x365: 0x0008, 0x366: 0xe00d, 0x367: 0x0008, 0x368: 0xe00d, 0x369: 0x0008, + 0x36a: 0xe00d, 0x36b: 0x0008, 0x36c: 0xe00d, 0x36d: 0x0008, 0x36e: 0xe00d, 0x36f: 0x0008, + 0x370: 0xe00d, 0x371: 0x0008, 0x372: 0xe00d, 0x373: 0x0008, 0x374: 0xe00d, 0x375: 0x0008, + 0x376: 0xe00d, 0x377: 0x0008, 0x378: 0xe00d, 0x379: 0x0008, 0x37a: 0xe00d, 0x37b: 0x0008, + 0x37c: 0xe00d, 0x37d: 0x0008, 0x37e: 0xe00d, 0x37f: 0x0008, + // Block 0xe, offset 0x380 + 0x380: 0xe00d, 0x381: 0x0008, 0x382: 0x0018, 0x383: 0x3308, 0x384: 0x3308, 0x385: 0x3308, + 0x386: 0x3308, 0x387: 0x3308, 0x388: 0x3318, 0x389: 0x3318, 0x38a: 0xe00d, 0x38b: 0x0008, + 0x38c: 0xe00d, 0x38d: 0x0008, 0x38e: 0xe00d, 0x38f: 0x0008, 0x390: 0xe00d, 0x391: 0x0008, + 0x392: 0xe00d, 0x393: 0x0008, 0x394: 0xe00d, 0x395: 0x0008, 0x396: 0xe00d, 0x397: 0x0008, + 0x398: 0xe00d, 0x399: 0x0008, 0x39a: 0xe00d, 0x39b: 0x0008, 0x39c: 0xe00d, 0x39d: 0x0008, + 0x39e: 0xe00d, 0x39f: 0x0008, 0x3a0: 0xe00d, 0x3a1: 0x0008, 0x3a2: 0xe00d, 0x3a3: 0x0008, + 0x3a4: 0xe00d, 0x3a5: 0x0008, 0x3a6: 0xe00d, 0x3a7: 0x0008, 0x3a8: 0xe00d, 0x3a9: 0x0008, + 0x3aa: 0xe00d, 0x3ab: 0x0008, 0x3ac: 0xe00d, 0x3ad: 0x0008, 0x3ae: 0xe00d, 0x3af: 0x0008, + 0x3b0: 0xe00d, 0x3b1: 0x0008, 0x3b2: 0xe00d, 0x3b3: 0x0008, 0x3b4: 0xe00d, 0x3b5: 0x0008, + 0x3b6: 0xe00d, 0x3b7: 0x0008, 0x3b8: 0xe00d, 0x3b9: 0x0008, 0x3ba: 0xe00d, 0x3bb: 0x0008, + 0x3bc: 0xe00d, 0x3bd: 0x0008, 0x3be: 0xe00d, 0x3bf: 0x0008, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0040, 0x3c1: 0xe01d, 0x3c2: 0x0008, 0x3c3: 0xe03d, 0x3c4: 0x0008, 0x3c5: 0xe01d, + 0x3c6: 0x0008, 0x3c7: 0xe07d, 0x3c8: 0x0008, 0x3c9: 0xe01d, 0x3ca: 0x0008, 0x3cb: 0xe03d, + 0x3cc: 0x0008, 0x3cd: 0xe01d, 0x3ce: 0x0008, 0x3cf: 0x0008, 0x3d0: 0xe00d, 0x3d1: 0x0008, + 0x3d2: 0xe00d, 0x3d3: 0x0008, 0x3d4: 0xe00d, 0x3d5: 0x0008, 0x3d6: 0xe00d, 0x3d7: 0x0008, + 0x3d8: 0xe00d, 0x3d9: 0x0008, 0x3da: 0xe00d, 0x3db: 0x0008, 0x3dc: 0xe00d, 0x3dd: 0x0008, + 0x3de: 0xe00d, 0x3df: 0x0008, 0x3e0: 0xe00d, 0x3e1: 0x0008, 0x3e2: 0xe00d, 0x3e3: 0x0008, + 0x3e4: 0xe00d, 0x3e5: 0x0008, 0x3e6: 0xe00d, 0x3e7: 0x0008, 0x3e8: 0xe00d, 0x3e9: 0x0008, + 0x3ea: 0xe00d, 0x3eb: 0x0008, 0x3ec: 0xe00d, 0x3ed: 0x0008, 0x3ee: 0xe00d, 0x3ef: 0x0008, + 0x3f0: 0xe00d, 0x3f1: 0x0008, 0x3f2: 0xe00d, 0x3f3: 0x0008, 0x3f4: 0xe00d, 0x3f5: 0x0008, + 0x3f6: 0xe00d, 0x3f7: 0x0008, 0x3f8: 0xe00d, 0x3f9: 0x0008, 0x3fa: 0xe00d, 0x3fb: 0x0008, + 0x3fc: 0xe00d, 0x3fd: 0x0008, 0x3fe: 0xe00d, 0x3ff: 0x0008, + // Block 0x10, offset 0x400 + 0x400: 0xe00d, 0x401: 0x0008, 0x402: 0xe00d, 0x403: 0x0008, 0x404: 0xe00d, 0x405: 0x0008, + 0x406: 0xe00d, 0x407: 0x0008, 0x408: 0xe00d, 0x409: 0x0008, 0x40a: 0xe00d, 0x40b: 0x0008, + 0x40c: 0xe00d, 0x40d: 0x0008, 0x40e: 0xe00d, 0x40f: 0x0008, 0x410: 0xe00d, 0x411: 0x0008, + 0x412: 0xe00d, 0x413: 0x0008, 0x414: 0xe00d, 0x415: 0x0008, 0x416: 0xe00d, 0x417: 0x0008, + 0x418: 0xe00d, 0x419: 0x0008, 0x41a: 0xe00d, 0x41b: 0x0008, 0x41c: 0xe00d, 0x41d: 0x0008, + 0x41e: 0xe00d, 0x41f: 0x0008, 0x420: 0xe00d, 0x421: 0x0008, 0x422: 0xe00d, 0x423: 0x0008, + 0x424: 0xe00d, 0x425: 0x0008, 0x426: 0xe00d, 0x427: 0x0008, 0x428: 0xe00d, 0x429: 0x0008, + 0x42a: 0xe00d, 0x42b: 0x0008, 0x42c: 0xe00d, 0x42d: 0x0008, 0x42e: 0xe00d, 0x42f: 0x0008, + 0x430: 0x0040, 0x431: 0x03f5, 0x432: 0x03f5, 0x433: 0x03f5, 0x434: 0x03f5, 0x435: 0x03f5, + 0x436: 0x03f5, 0x437: 0x03f5, 0x438: 0x03f5, 0x439: 0x03f5, 0x43a: 0x03f5, 0x43b: 0x03f5, + 0x43c: 0x03f5, 0x43d: 0x03f5, 0x43e: 0x03f5, 0x43f: 0x03f5, + // Block 0x11, offset 0x440 + 0x440: 0x0840, 0x441: 0x0840, 0x442: 0x0840, 0x443: 0x0840, 0x444: 0x0840, 0x445: 0x0840, + 0x446: 0x0018, 0x447: 0x0018, 0x448: 0x0818, 0x449: 0x0018, 0x44a: 0x0018, 0x44b: 0x0818, + 0x44c: 0x0018, 0x44d: 0x0818, 0x44e: 0x0018, 0x44f: 0x0018, 0x450: 0x3308, 0x451: 0x3308, + 0x452: 0x3308, 0x453: 0x3308, 0x454: 0x3308, 0x455: 0x3308, 0x456: 0x3308, 0x457: 0x3308, + 0x458: 0x3308, 0x459: 0x3308, 0x45a: 0x3308, 0x45b: 0x0818, 0x45c: 0x0b40, 0x45d: 0x0818, + 0x45e: 0x0818, 0x45f: 0x0818, 0x460: 0x0a08, 0x461: 0x0808, 0x462: 0x0c08, 0x463: 0x0c08, + 0x464: 0x0c08, 0x465: 0x0c08, 0x466: 0x0a08, 0x467: 0x0c08, 0x468: 0x0a08, 0x469: 0x0c08, + 0x46a: 0x0a08, 0x46b: 0x0a08, 0x46c: 0x0a08, 0x46d: 0x0a08, 0x46e: 0x0a08, 0x46f: 0x0c08, + 0x470: 0x0c08, 0x471: 0x0c08, 0x472: 0x0c08, 0x473: 0x0a08, 0x474: 0x0a08, 0x475: 0x0a08, + 0x476: 0x0a08, 0x477: 0x0a08, 0x478: 0x0a08, 0x479: 0x0a08, 0x47a: 0x0a08, 0x47b: 0x0a08, + 0x47c: 0x0a08, 0x47d: 0x0a08, 0x47e: 0x0a08, 0x47f: 0x0a08, + // Block 0x12, offset 0x480 + 0x480: 0x0818, 0x481: 0x0a08, 0x482: 0x0a08, 0x483: 0x0a08, 0x484: 0x0a08, 0x485: 0x0a08, + 0x486: 0x0a08, 0x487: 0x0a08, 0x488: 0x0c08, 0x489: 0x0a08, 0x48a: 0x0a08, 0x48b: 0x3308, + 0x48c: 0x3308, 0x48d: 0x3308, 0x48e: 0x3308, 0x48f: 0x3308, 0x490: 0x3308, 0x491: 0x3308, + 0x492: 0x3308, 0x493: 0x3308, 0x494: 0x3308, 0x495: 0x3308, 0x496: 0x3308, 0x497: 0x3308, + 0x498: 0x3308, 0x499: 0x3308, 0x49a: 0x3308, 0x49b: 0x3308, 0x49c: 0x3308, 0x49d: 0x3308, + 0x49e: 0x3308, 0x49f: 0x3308, 0x4a0: 0x0808, 0x4a1: 0x0808, 0x4a2: 0x0808, 0x4a3: 0x0808, + 0x4a4: 0x0808, 0x4a5: 0x0808, 0x4a6: 0x0808, 0x4a7: 0x0808, 0x4a8: 0x0808, 0x4a9: 0x0808, + 0x4aa: 0x0018, 0x4ab: 0x0818, 0x4ac: 0x0818, 0x4ad: 0x0818, 0x4ae: 0x0a08, 0x4af: 0x0a08, + 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0139, + 0x4b6: 0x0141, 0x4b7: 0x0149, 0x4b8: 0x0151, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, + 0x4bc: 0x0a08, 0x4bd: 0x0a08, 0x4be: 0x0a08, 0x4bf: 0x0a08, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0c08, 0x4c1: 0x0a08, 0x4c2: 0x0a08, 0x4c3: 0x0c08, 0x4c4: 0x0c08, 0x4c5: 0x0c08, + 0x4c6: 0x0c08, 0x4c7: 0x0c08, 0x4c8: 0x0c08, 0x4c9: 0x0c08, 0x4ca: 0x0c08, 0x4cb: 0x0c08, + 0x4cc: 0x0a08, 0x4cd: 0x0c08, 0x4ce: 0x0a08, 0x4cf: 0x0c08, 0x4d0: 0x0a08, 0x4d1: 0x0a08, + 0x4d2: 0x0c08, 0x4d3: 0x0c08, 0x4d4: 0x0818, 0x4d5: 0x0c08, 0x4d6: 0x3308, 0x4d7: 0x3308, + 0x4d8: 0x3308, 0x4d9: 0x3308, 0x4da: 0x3308, 0x4db: 0x3308, 0x4dc: 0x3308, 0x4dd: 0x0840, + 0x4de: 0x0018, 0x4df: 0x3308, 0x4e0: 0x3308, 0x4e1: 0x3308, 0x4e2: 0x3308, 0x4e3: 0x3308, + 0x4e4: 0x3308, 0x4e5: 0x0808, 0x4e6: 0x0808, 0x4e7: 0x3308, 0x4e8: 0x3308, 0x4e9: 0x0018, + 0x4ea: 0x3308, 0x4eb: 0x3308, 0x4ec: 0x3308, 0x4ed: 0x3308, 0x4ee: 0x0c08, 0x4ef: 0x0c08, + 0x4f0: 0x0008, 0x4f1: 0x0008, 0x4f2: 0x0008, 0x4f3: 0x0008, 0x4f4: 0x0008, 0x4f5: 0x0008, + 0x4f6: 0x0008, 0x4f7: 0x0008, 0x4f8: 0x0008, 0x4f9: 0x0008, 0x4fa: 0x0a08, 0x4fb: 0x0a08, + 0x4fc: 0x0a08, 0x4fd: 0x0808, 0x4fe: 0x0808, 0x4ff: 0x0a08, + // Block 0x14, offset 0x500 + 0x500: 0x0818, 0x501: 0x0818, 0x502: 0x0818, 0x503: 0x0818, 0x504: 0x0818, 0x505: 0x0818, + 0x506: 0x0818, 0x507: 0x0818, 0x508: 0x0818, 0x509: 0x0818, 0x50a: 0x0818, 0x50b: 0x0818, + 0x50c: 0x0818, 0x50d: 0x0818, 0x50e: 0x0040, 0x50f: 0x0b40, 0x510: 0x0c08, 0x511: 0x3308, + 0x512: 0x0a08, 0x513: 0x0a08, 0x514: 0x0a08, 0x515: 0x0c08, 0x516: 0x0c08, 0x517: 0x0c08, + 0x518: 0x0c08, 0x519: 0x0c08, 0x51a: 0x0a08, 0x51b: 0x0a08, 0x51c: 0x0a08, 0x51d: 0x0a08, + 0x51e: 0x0c08, 0x51f: 0x0a08, 0x520: 0x0a08, 0x521: 0x0a08, 0x522: 0x0a08, 0x523: 0x0a08, + 0x524: 0x0a08, 0x525: 0x0a08, 0x526: 0x0a08, 0x527: 0x0a08, 0x528: 0x0c08, 0x529: 0x0a08, + 0x52a: 0x0c08, 0x52b: 0x0a08, 0x52c: 0x0c08, 0x52d: 0x0a08, 0x52e: 0x0a08, 0x52f: 0x0c08, + 0x530: 0x3308, 0x531: 0x3308, 0x532: 0x3308, 0x533: 0x3308, 0x534: 0x3308, 0x535: 0x3308, + 0x536: 0x3308, 0x537: 0x3308, 0x538: 0x3308, 0x539: 0x3308, 0x53a: 0x3308, 0x53b: 0x3308, + 0x53c: 0x3308, 0x53d: 0x3308, 0x53e: 0x3308, 0x53f: 0x3308, + // Block 0x15, offset 0x540 + 0x540: 0x0c08, 0x541: 0x0a08, 0x542: 0x0a08, 0x543: 0x0a08, 0x544: 0x0a08, 0x545: 0x0a08, + 0x546: 0x0c08, 0x547: 0x0c08, 0x548: 0x0a08, 0x549: 0x0c08, 0x54a: 0x0a08, 0x54b: 0x0a08, + 0x54c: 0x0a08, 0x54d: 0x0a08, 0x54e: 0x0a08, 0x54f: 0x0a08, 0x550: 0x0a08, 0x551: 0x0a08, + 0x552: 0x0a08, 0x553: 0x0a08, 0x554: 0x0c08, 0x555: 0x0a08, 0x556: 0x0c08, 0x557: 0x0c08, + 0x558: 0x0c08, 0x559: 0x3308, 0x55a: 0x3308, 0x55b: 0x3308, 0x55c: 0x0040, 0x55d: 0x0040, + 0x55e: 0x0818, 0x55f: 0x0040, 0x560: 0x0a08, 0x561: 0x0808, 0x562: 0x0a08, 0x563: 0x0a08, + 0x564: 0x0a08, 0x565: 0x0a08, 0x566: 0x0808, 0x567: 0x0c08, 0x568: 0x0a08, 0x569: 0x0c08, + 0x56a: 0x0c08, 0x56b: 0x0040, 0x56c: 0x0040, 0x56d: 0x0040, 0x56e: 0x0040, 0x56f: 0x0040, + 0x570: 0x0c08, 0x571: 0x0c08, 0x572: 0x0c08, 0x573: 0x0c08, 0x574: 0x0c08, 0x575: 0x0c08, + 0x576: 0x0c08, 0x577: 0x0c08, 0x578: 0x0c08, 0x579: 0x0c08, 0x57a: 0x0c08, 0x57b: 0x0c08, + 0x57c: 0x0c08, 0x57d: 0x0c08, 0x57e: 0x0c08, 0x57f: 0x0c08, + // Block 0x16, offset 0x580 + 0x580: 0x0c08, 0x581: 0x0c08, 0x582: 0x0c08, 0x583: 0x0808, 0x584: 0x0808, 0x585: 0x0808, + 0x586: 0x0a08, 0x587: 0x0808, 0x588: 0x0818, 0x589: 0x0a08, 0x58a: 0x0a08, 0x58b: 0x0a08, + 0x58c: 0x0a08, 0x58d: 0x0a08, 0x58e: 0x0c08, 0x58f: 0x0040, 0x590: 0x0840, 0x591: 0x0840, + 0x592: 0x0040, 0x593: 0x0040, 0x594: 0x0040, 0x595: 0x0040, 0x596: 0x0040, 0x597: 0x0040, + 0x598: 0x3308, 0x599: 0x3308, 0x59a: 0x3308, 0x59b: 0x3308, 0x59c: 0x3308, 0x59d: 0x3308, + 0x59e: 0x3308, 0x59f: 0x3308, 0x5a0: 0x0a08, 0x5a1: 0x0a08, 0x5a2: 0x0a08, 0x5a3: 0x0a08, + 0x5a4: 0x0a08, 0x5a5: 0x0a08, 0x5a6: 0x0a08, 0x5a7: 0x0a08, 0x5a8: 0x0a08, 0x5a9: 0x0a08, + 0x5aa: 0x0c08, 0x5ab: 0x0c08, 0x5ac: 0x0c08, 0x5ad: 0x0808, 0x5ae: 0x0c08, 0x5af: 0x0a08, + 0x5b0: 0x0a08, 0x5b1: 0x0c08, 0x5b2: 0x0c08, 0x5b3: 0x0a08, 0x5b4: 0x0a08, 0x5b5: 0x0a08, + 0x5b6: 0x0a08, 0x5b7: 0x0a08, 0x5b8: 0x0a08, 0x5b9: 0x0c08, 0x5ba: 0x0a08, 0x5bb: 0x0a08, + 0x5bc: 0x0a08, 0x5bd: 0x0a08, 0x5be: 0x0a08, 0x5bf: 0x0a08, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3008, 0x5c1: 0x3308, 0x5c2: 0x3308, 0x5c3: 0x3308, 0x5c4: 0x3308, 0x5c5: 0x3308, + 0x5c6: 0x3308, 0x5c7: 0x3308, 0x5c8: 0x3308, 0x5c9: 0x3008, 0x5ca: 0x3008, 0x5cb: 0x3008, + 0x5cc: 0x3008, 0x5cd: 0x3b08, 0x5ce: 0x3008, 0x5cf: 0x3008, 0x5d0: 0x0008, 0x5d1: 0x3308, + 0x5d2: 0x3308, 0x5d3: 0x3308, 0x5d4: 0x3308, 0x5d5: 0x3308, 0x5d6: 0x3308, 0x5d7: 0x3308, + 0x5d8: 0x0159, 0x5d9: 0x0161, 0x5da: 0x0169, 0x5db: 0x0171, 0x5dc: 0x0179, 0x5dd: 0x0181, + 0x5de: 0x0189, 0x5df: 0x0191, 0x5e0: 0x0008, 0x5e1: 0x0008, 0x5e2: 0x3308, 0x5e3: 0x3308, + 0x5e4: 0x0018, 0x5e5: 0x0018, 0x5e6: 0x0008, 0x5e7: 0x0008, 0x5e8: 0x0008, 0x5e9: 0x0008, + 0x5ea: 0x0008, 0x5eb: 0x0008, 0x5ec: 0x0008, 0x5ed: 0x0008, 0x5ee: 0x0008, 0x5ef: 0x0008, + 0x5f0: 0x0018, 0x5f1: 0x0008, 0x5f2: 0x0008, 0x5f3: 0x0008, 0x5f4: 0x0008, 0x5f5: 0x0008, + 0x5f6: 0x0008, 0x5f7: 0x0008, 0x5f8: 0x0008, 0x5f9: 0x0008, 0x5fa: 0x0008, 0x5fb: 0x0008, + 0x5fc: 0x0008, 0x5fd: 0x0008, 0x5fe: 0x0008, 0x5ff: 0x0008, + // Block 0x18, offset 0x600 + 0x600: 0x0008, 0x601: 0x3308, 0x602: 0x3008, 0x603: 0x3008, 0x604: 0x0040, 0x605: 0x0008, + 0x606: 0x0008, 0x607: 0x0008, 0x608: 0x0008, 0x609: 0x0008, 0x60a: 0x0008, 0x60b: 0x0008, + 0x60c: 0x0008, 0x60d: 0x0040, 0x60e: 0x0040, 0x60f: 0x0008, 0x610: 0x0008, 0x611: 0x0040, + 0x612: 0x0040, 0x613: 0x0008, 0x614: 0x0008, 0x615: 0x0008, 0x616: 0x0008, 0x617: 0x0008, + 0x618: 0x0008, 0x619: 0x0008, 0x61a: 0x0008, 0x61b: 0x0008, 0x61c: 0x0008, 0x61d: 0x0008, + 0x61e: 0x0008, 0x61f: 0x0008, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x0008, 0x623: 0x0008, + 0x624: 0x0008, 0x625: 0x0008, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0040, + 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, + 0x630: 0x0008, 0x631: 0x0040, 0x632: 0x0008, 0x633: 0x0040, 0x634: 0x0040, 0x635: 0x0040, + 0x636: 0x0008, 0x637: 0x0008, 0x638: 0x0008, 0x639: 0x0008, 0x63a: 0x0040, 0x63b: 0x0040, + 0x63c: 0x3308, 0x63d: 0x0008, 0x63e: 0x3008, 0x63f: 0x3008, + // Block 0x19, offset 0x640 + 0x640: 0x3008, 0x641: 0x3308, 0x642: 0x3308, 0x643: 0x3308, 0x644: 0x3308, 0x645: 0x0040, + 0x646: 0x0040, 0x647: 0x3008, 0x648: 0x3008, 0x649: 0x0040, 0x64a: 0x0040, 0x64b: 0x3008, + 0x64c: 0x3008, 0x64d: 0x3b08, 0x64e: 0x0008, 0x64f: 0x0040, 0x650: 0x0040, 0x651: 0x0040, + 0x652: 0x0040, 0x653: 0x0040, 0x654: 0x0040, 0x655: 0x0040, 0x656: 0x0040, 0x657: 0x3008, + 0x658: 0x0040, 0x659: 0x0040, 0x65a: 0x0040, 0x65b: 0x0040, 0x65c: 0x0199, 0x65d: 0x01a1, + 0x65e: 0x0040, 0x65f: 0x01a9, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x3308, 0x663: 0x3308, + 0x664: 0x0040, 0x665: 0x0040, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0008, + 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, + 0x670: 0x0008, 0x671: 0x0008, 0x672: 0x0018, 0x673: 0x0018, 0x674: 0x0018, 0x675: 0x0018, + 0x676: 0x0018, 0x677: 0x0018, 0x678: 0x0018, 0x679: 0x0018, 0x67a: 0x0018, 0x67b: 0x0018, + 0x67c: 0x0008, 0x67d: 0x0018, 0x67e: 0x3308, 0x67f: 0x0040, + // Block 0x1a, offset 0x680 + 0x680: 0x0040, 0x681: 0x3308, 0x682: 0x3308, 0x683: 0x3008, 0x684: 0x0040, 0x685: 0x0008, + 0x686: 0x0008, 0x687: 0x0008, 0x688: 0x0008, 0x689: 0x0008, 0x68a: 0x0008, 0x68b: 0x0040, + 0x68c: 0x0040, 0x68d: 0x0040, 0x68e: 0x0040, 0x68f: 0x0008, 0x690: 0x0008, 0x691: 0x0040, + 0x692: 0x0040, 0x693: 0x0008, 0x694: 0x0008, 0x695: 0x0008, 0x696: 0x0008, 0x697: 0x0008, + 0x698: 0x0008, 0x699: 0x0008, 0x69a: 0x0008, 0x69b: 0x0008, 0x69c: 0x0008, 0x69d: 0x0008, + 0x69e: 0x0008, 0x69f: 0x0008, 0x6a0: 0x0008, 0x6a1: 0x0008, 0x6a2: 0x0008, 0x6a3: 0x0008, + 0x6a4: 0x0008, 0x6a5: 0x0008, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0040, + 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, + 0x6b0: 0x0008, 0x6b1: 0x0040, 0x6b2: 0x0008, 0x6b3: 0x01b1, 0x6b4: 0x0040, 0x6b5: 0x0008, + 0x6b6: 0x01b9, 0x6b7: 0x0040, 0x6b8: 0x0008, 0x6b9: 0x0008, 0x6ba: 0x0040, 0x6bb: 0x0040, + 0x6bc: 0x3308, 0x6bd: 0x0040, 0x6be: 0x3008, 0x6bf: 0x3008, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3008, 0x6c1: 0x3308, 0x6c2: 0x3308, 0x6c3: 0x0040, 0x6c4: 0x0040, 0x6c5: 0x0040, + 0x6c6: 0x0040, 0x6c7: 0x3308, 0x6c8: 0x3308, 0x6c9: 0x0040, 0x6ca: 0x0040, 0x6cb: 0x3308, + 0x6cc: 0x3308, 0x6cd: 0x3b08, 0x6ce: 0x0040, 0x6cf: 0x0040, 0x6d0: 0x0040, 0x6d1: 0x3308, + 0x6d2: 0x0040, 0x6d3: 0x0040, 0x6d4: 0x0040, 0x6d5: 0x0040, 0x6d6: 0x0040, 0x6d7: 0x0040, + 0x6d8: 0x0040, 0x6d9: 0x01c1, 0x6da: 0x01c9, 0x6db: 0x01d1, 0x6dc: 0x0008, 0x6dd: 0x0040, + 0x6de: 0x01d9, 0x6df: 0x0040, 0x6e0: 0x0040, 0x6e1: 0x0040, 0x6e2: 0x0040, 0x6e3: 0x0040, + 0x6e4: 0x0040, 0x6e5: 0x0040, 0x6e6: 0x0008, 0x6e7: 0x0008, 0x6e8: 0x0008, 0x6e9: 0x0008, + 0x6ea: 0x0008, 0x6eb: 0x0008, 0x6ec: 0x0008, 0x6ed: 0x0008, 0x6ee: 0x0008, 0x6ef: 0x0008, + 0x6f0: 0x3308, 0x6f1: 0x3308, 0x6f2: 0x0008, 0x6f3: 0x0008, 0x6f4: 0x0008, 0x6f5: 0x3308, + 0x6f6: 0x0018, 0x6f7: 0x0040, 0x6f8: 0x0040, 0x6f9: 0x0040, 0x6fa: 0x0040, 0x6fb: 0x0040, + 0x6fc: 0x0040, 0x6fd: 0x0040, 0x6fe: 0x0040, 0x6ff: 0x0040, + // Block 0x1c, offset 0x700 + 0x700: 0x0040, 0x701: 0x3308, 0x702: 0x3308, 0x703: 0x3008, 0x704: 0x0040, 0x705: 0x0008, + 0x706: 0x0008, 0x707: 0x0008, 0x708: 0x0008, 0x709: 0x0008, 0x70a: 0x0008, 0x70b: 0x0008, + 0x70c: 0x0008, 0x70d: 0x0008, 0x70e: 0x0040, 0x70f: 0x0008, 0x710: 0x0008, 0x711: 0x0008, + 0x712: 0x0040, 0x713: 0x0008, 0x714: 0x0008, 0x715: 0x0008, 0x716: 0x0008, 0x717: 0x0008, + 0x718: 0x0008, 0x719: 0x0008, 0x71a: 0x0008, 0x71b: 0x0008, 0x71c: 0x0008, 0x71d: 0x0008, + 0x71e: 0x0008, 0x71f: 0x0008, 0x720: 0x0008, 0x721: 0x0008, 0x722: 0x0008, 0x723: 0x0008, + 0x724: 0x0008, 0x725: 0x0008, 0x726: 0x0008, 0x727: 0x0008, 0x728: 0x0008, 0x729: 0x0040, + 0x72a: 0x0008, 0x72b: 0x0008, 0x72c: 0x0008, 0x72d: 0x0008, 0x72e: 0x0008, 0x72f: 0x0008, + 0x730: 0x0008, 0x731: 0x0040, 0x732: 0x0008, 0x733: 0x0008, 0x734: 0x0040, 0x735: 0x0008, + 0x736: 0x0008, 0x737: 0x0008, 0x738: 0x0008, 0x739: 0x0008, 0x73a: 0x0040, 0x73b: 0x0040, + 0x73c: 0x3308, 0x73d: 0x0008, 0x73e: 0x3008, 0x73f: 0x3008, + // Block 0x1d, offset 0x740 + 0x740: 0x3008, 0x741: 0x3308, 0x742: 0x3308, 0x743: 0x3308, 0x744: 0x3308, 0x745: 0x3308, + 0x746: 0x0040, 0x747: 0x3308, 0x748: 0x3308, 0x749: 0x3008, 0x74a: 0x0040, 0x74b: 0x3008, + 0x74c: 0x3008, 0x74d: 0x3b08, 0x74e: 0x0040, 0x74f: 0x0040, 0x750: 0x0008, 0x751: 0x0040, + 0x752: 0x0040, 0x753: 0x0040, 0x754: 0x0040, 0x755: 0x0040, 0x756: 0x0040, 0x757: 0x0040, + 0x758: 0x0040, 0x759: 0x0040, 0x75a: 0x0040, 0x75b: 0x0040, 0x75c: 0x0040, 0x75d: 0x0040, + 0x75e: 0x0040, 0x75f: 0x0040, 0x760: 0x0008, 0x761: 0x0008, 0x762: 0x3308, 0x763: 0x3308, + 0x764: 0x0040, 0x765: 0x0040, 0x766: 0x0008, 0x767: 0x0008, 0x768: 0x0008, 0x769: 0x0008, + 0x76a: 0x0008, 0x76b: 0x0008, 0x76c: 0x0008, 0x76d: 0x0008, 0x76e: 0x0008, 0x76f: 0x0008, + 0x770: 0x0018, 0x771: 0x0018, 0x772: 0x0040, 0x773: 0x0040, 0x774: 0x0040, 0x775: 0x0040, + 0x776: 0x0040, 0x777: 0x0040, 0x778: 0x0040, 0x779: 0x0008, 0x77a: 0x3308, 0x77b: 0x3308, + 0x77c: 0x3308, 0x77d: 0x3308, 0x77e: 0x3308, 0x77f: 0x3308, + // Block 0x1e, offset 0x780 + 0x780: 0x0040, 0x781: 0x3308, 0x782: 0x3008, 0x783: 0x3008, 0x784: 0x0040, 0x785: 0x0008, + 0x786: 0x0008, 0x787: 0x0008, 0x788: 0x0008, 0x789: 0x0008, 0x78a: 0x0008, 0x78b: 0x0008, + 0x78c: 0x0008, 0x78d: 0x0040, 0x78e: 0x0040, 0x78f: 0x0008, 0x790: 0x0008, 0x791: 0x0040, + 0x792: 0x0040, 0x793: 0x0008, 0x794: 0x0008, 0x795: 0x0008, 0x796: 0x0008, 0x797: 0x0008, + 0x798: 0x0008, 0x799: 0x0008, 0x79a: 0x0008, 0x79b: 0x0008, 0x79c: 0x0008, 0x79d: 0x0008, + 0x79e: 0x0008, 0x79f: 0x0008, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x0008, 0x7a3: 0x0008, + 0x7a4: 0x0008, 0x7a5: 0x0008, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0040, + 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, + 0x7b0: 0x0008, 0x7b1: 0x0040, 0x7b2: 0x0008, 0x7b3: 0x0008, 0x7b4: 0x0040, 0x7b5: 0x0008, + 0x7b6: 0x0008, 0x7b7: 0x0008, 0x7b8: 0x0008, 0x7b9: 0x0008, 0x7ba: 0x0040, 0x7bb: 0x0040, + 0x7bc: 0x3308, 0x7bd: 0x0008, 0x7be: 0x3008, 0x7bf: 0x3308, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x3008, 0x7c1: 0x3308, 0x7c2: 0x3308, 0x7c3: 0x3308, 0x7c4: 0x3308, 0x7c5: 0x0040, + 0x7c6: 0x0040, 0x7c7: 0x3008, 0x7c8: 0x3008, 0x7c9: 0x0040, 0x7ca: 0x0040, 0x7cb: 0x3008, + 0x7cc: 0x3008, 0x7cd: 0x3b08, 0x7ce: 0x0040, 0x7cf: 0x0040, 0x7d0: 0x0040, 0x7d1: 0x0040, + 0x7d2: 0x0040, 0x7d3: 0x0040, 0x7d4: 0x0040, 0x7d5: 0x3308, 0x7d6: 0x3308, 0x7d7: 0x3008, + 0x7d8: 0x0040, 0x7d9: 0x0040, 0x7da: 0x0040, 0x7db: 0x0040, 0x7dc: 0x01e1, 0x7dd: 0x01e9, + 0x7de: 0x0040, 0x7df: 0x0008, 0x7e0: 0x0008, 0x7e1: 0x0008, 0x7e2: 0x3308, 0x7e3: 0x3308, + 0x7e4: 0x0040, 0x7e5: 0x0040, 0x7e6: 0x0008, 0x7e7: 0x0008, 0x7e8: 0x0008, 0x7e9: 0x0008, + 0x7ea: 0x0008, 0x7eb: 0x0008, 0x7ec: 0x0008, 0x7ed: 0x0008, 0x7ee: 0x0008, 0x7ef: 0x0008, + 0x7f0: 0x0018, 0x7f1: 0x0008, 0x7f2: 0x0018, 0x7f3: 0x0018, 0x7f4: 0x0018, 0x7f5: 0x0018, + 0x7f6: 0x0018, 0x7f7: 0x0018, 0x7f8: 0x0040, 0x7f9: 0x0040, 0x7fa: 0x0040, 0x7fb: 0x0040, + 0x7fc: 0x0040, 0x7fd: 0x0040, 0x7fe: 0x0040, 0x7ff: 0x0040, + // Block 0x20, offset 0x800 + 0x800: 0x0040, 0x801: 0x0040, 0x802: 0x3308, 0x803: 0x0008, 0x804: 0x0040, 0x805: 0x0008, + 0x806: 0x0008, 0x807: 0x0008, 0x808: 0x0008, 0x809: 0x0008, 0x80a: 0x0008, 0x80b: 0x0040, + 0x80c: 0x0040, 0x80d: 0x0040, 0x80e: 0x0008, 0x80f: 0x0008, 0x810: 0x0008, 0x811: 0x0040, + 0x812: 0x0008, 0x813: 0x0008, 0x814: 0x0008, 0x815: 0x0008, 0x816: 0x0040, 0x817: 0x0040, + 0x818: 0x0040, 0x819: 0x0008, 0x81a: 0x0008, 0x81b: 0x0040, 0x81c: 0x0008, 0x81d: 0x0040, + 0x81e: 0x0008, 0x81f: 0x0008, 0x820: 0x0040, 0x821: 0x0040, 0x822: 0x0040, 0x823: 0x0008, + 0x824: 0x0008, 0x825: 0x0040, 0x826: 0x0040, 0x827: 0x0040, 0x828: 0x0008, 0x829: 0x0008, + 0x82a: 0x0008, 0x82b: 0x0040, 0x82c: 0x0040, 0x82d: 0x0040, 0x82e: 0x0008, 0x82f: 0x0008, + 0x830: 0x0008, 0x831: 0x0008, 0x832: 0x0008, 0x833: 0x0008, 0x834: 0x0008, 0x835: 0x0008, + 0x836: 0x0008, 0x837: 0x0008, 0x838: 0x0008, 0x839: 0x0008, 0x83a: 0x0040, 0x83b: 0x0040, + 0x83c: 0x0040, 0x83d: 0x0040, 0x83e: 0x3008, 0x83f: 0x3008, + // Block 0x21, offset 0x840 + 0x840: 0x3308, 0x841: 0x3008, 0x842: 0x3008, 0x843: 0x3008, 0x844: 0x3008, 0x845: 0x0040, + 0x846: 0x3308, 0x847: 0x3308, 0x848: 0x3308, 0x849: 0x0040, 0x84a: 0x3308, 0x84b: 0x3308, + 0x84c: 0x3308, 0x84d: 0x3b08, 0x84e: 0x0040, 0x84f: 0x0040, 0x850: 0x0040, 0x851: 0x0040, + 0x852: 0x0040, 0x853: 0x0040, 0x854: 0x0040, 0x855: 0x3308, 0x856: 0x3308, 0x857: 0x0040, + 0x858: 0x0008, 0x859: 0x0008, 0x85a: 0x0008, 0x85b: 0x0040, 0x85c: 0x0040, 0x85d: 0x0008, + 0x85e: 0x0040, 0x85f: 0x0040, 0x860: 0x0008, 0x861: 0x0008, 0x862: 0x3308, 0x863: 0x3308, + 0x864: 0x0040, 0x865: 0x0040, 0x866: 0x0008, 0x867: 0x0008, 0x868: 0x0008, 0x869: 0x0008, + 0x86a: 0x0008, 0x86b: 0x0008, 0x86c: 0x0008, 0x86d: 0x0008, 0x86e: 0x0008, 0x86f: 0x0008, + 0x870: 0x0040, 0x871: 0x0040, 0x872: 0x0040, 0x873: 0x0040, 0x874: 0x0040, 0x875: 0x0040, + 0x876: 0x0040, 0x877: 0x0018, 0x878: 0x0018, 0x879: 0x0018, 0x87a: 0x0018, 0x87b: 0x0018, + 0x87c: 0x0018, 0x87d: 0x0018, 0x87e: 0x0018, 0x87f: 0x0018, + // Block 0x22, offset 0x880 + 0x880: 0x0008, 0x881: 0x3308, 0x882: 0x3008, 0x883: 0x3008, 0x884: 0x0018, 0x885: 0x0008, + 0x886: 0x0008, 0x887: 0x0008, 0x888: 0x0008, 0x889: 0x0008, 0x88a: 0x0008, 0x88b: 0x0008, + 0x88c: 0x0008, 0x88d: 0x0040, 0x88e: 0x0008, 0x88f: 0x0008, 0x890: 0x0008, 0x891: 0x0040, + 0x892: 0x0008, 0x893: 0x0008, 0x894: 0x0008, 0x895: 0x0008, 0x896: 0x0008, 0x897: 0x0008, + 0x898: 0x0008, 0x899: 0x0008, 0x89a: 0x0008, 0x89b: 0x0008, 0x89c: 0x0008, 0x89d: 0x0008, + 0x89e: 0x0008, 0x89f: 0x0008, 0x8a0: 0x0008, 0x8a1: 0x0008, 0x8a2: 0x0008, 0x8a3: 0x0008, + 0x8a4: 0x0008, 0x8a5: 0x0008, 0x8a6: 0x0008, 0x8a7: 0x0008, 0x8a8: 0x0008, 0x8a9: 0x0040, + 0x8aa: 0x0008, 0x8ab: 0x0008, 0x8ac: 0x0008, 0x8ad: 0x0008, 0x8ae: 0x0008, 0x8af: 0x0008, + 0x8b0: 0x0008, 0x8b1: 0x0008, 0x8b2: 0x0008, 0x8b3: 0x0008, 0x8b4: 0x0040, 0x8b5: 0x0008, + 0x8b6: 0x0008, 0x8b7: 0x0008, 0x8b8: 0x0008, 0x8b9: 0x0008, 0x8ba: 0x0040, 0x8bb: 0x0040, + 0x8bc: 0x3308, 0x8bd: 0x0008, 0x8be: 0x3008, 0x8bf: 0x3308, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x3008, 0x8c1: 0x3008, 0x8c2: 0x3008, 0x8c3: 0x3008, 0x8c4: 0x3008, 0x8c5: 0x0040, + 0x8c6: 0x3308, 0x8c7: 0x3008, 0x8c8: 0x3008, 0x8c9: 0x0040, 0x8ca: 0x3008, 0x8cb: 0x3008, + 0x8cc: 0x3308, 0x8cd: 0x3b08, 0x8ce: 0x0040, 0x8cf: 0x0040, 0x8d0: 0x0040, 0x8d1: 0x0040, + 0x8d2: 0x0040, 0x8d3: 0x0040, 0x8d4: 0x0040, 0x8d5: 0x3008, 0x8d6: 0x3008, 0x8d7: 0x0040, + 0x8d8: 0x0040, 0x8d9: 0x0040, 0x8da: 0x0040, 0x8db: 0x0040, 0x8dc: 0x0040, 0x8dd: 0x0008, + 0x8de: 0x0008, 0x8df: 0x0040, 0x8e0: 0x0008, 0x8e1: 0x0008, 0x8e2: 0x3308, 0x8e3: 0x3308, + 0x8e4: 0x0040, 0x8e5: 0x0040, 0x8e6: 0x0008, 0x8e7: 0x0008, 0x8e8: 0x0008, 0x8e9: 0x0008, + 0x8ea: 0x0008, 0x8eb: 0x0008, 0x8ec: 0x0008, 0x8ed: 0x0008, 0x8ee: 0x0008, 0x8ef: 0x0008, + 0x8f0: 0x0040, 0x8f1: 0x0008, 0x8f2: 0x0008, 0x8f3: 0x3008, 0x8f4: 0x0040, 0x8f5: 0x0040, + 0x8f6: 0x0040, 0x8f7: 0x0040, 0x8f8: 0x0040, 0x8f9: 0x0040, 0x8fa: 0x0040, 0x8fb: 0x0040, + 0x8fc: 0x0040, 0x8fd: 0x0040, 0x8fe: 0x0040, 0x8ff: 0x0040, + // Block 0x24, offset 0x900 + 0x900: 0x3008, 0x901: 0x3308, 0x902: 0x3308, 0x903: 0x3308, 0x904: 0x3308, 0x905: 0x0040, + 0x906: 0x3008, 0x907: 0x3008, 0x908: 0x3008, 0x909: 0x0040, 0x90a: 0x3008, 0x90b: 0x3008, + 0x90c: 0x3008, 0x90d: 0x3b08, 0x90e: 0x0008, 0x90f: 0x0018, 0x910: 0x0040, 0x911: 0x0040, + 0x912: 0x0040, 0x913: 0x0040, 0x914: 0x0008, 0x915: 0x0008, 0x916: 0x0008, 0x917: 0x3008, + 0x918: 0x0018, 0x919: 0x0018, 0x91a: 0x0018, 0x91b: 0x0018, 0x91c: 0x0018, 0x91d: 0x0018, + 0x91e: 0x0018, 0x91f: 0x0008, 0x920: 0x0008, 0x921: 0x0008, 0x922: 0x3308, 0x923: 0x3308, + 0x924: 0x0040, 0x925: 0x0040, 0x926: 0x0008, 0x927: 0x0008, 0x928: 0x0008, 0x929: 0x0008, + 0x92a: 0x0008, 0x92b: 0x0008, 0x92c: 0x0008, 0x92d: 0x0008, 0x92e: 0x0008, 0x92f: 0x0008, + 0x930: 0x0018, 0x931: 0x0018, 0x932: 0x0018, 0x933: 0x0018, 0x934: 0x0018, 0x935: 0x0018, + 0x936: 0x0018, 0x937: 0x0018, 0x938: 0x0018, 0x939: 0x0018, 0x93a: 0x0008, 0x93b: 0x0008, + 0x93c: 0x0008, 0x93d: 0x0008, 0x93e: 0x0008, 0x93f: 0x0008, + // Block 0x25, offset 0x940 + 0x940: 0x0040, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0040, 0x944: 0x0008, 0x945: 0x0040, + 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0008, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0040, + 0x94c: 0x0008, 0x94d: 0x0008, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0008, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0008, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0008, 0x95d: 0x0008, + 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, + 0x964: 0x0040, 0x965: 0x0008, 0x966: 0x0040, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0008, + 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0008, 0x96d: 0x0008, 0x96e: 0x0008, 0x96f: 0x0008, + 0x970: 0x0008, 0x971: 0x3308, 0x972: 0x0008, 0x973: 0x01f9, 0x974: 0x3308, 0x975: 0x3308, + 0x976: 0x3308, 0x977: 0x3308, 0x978: 0x3308, 0x979: 0x3308, 0x97a: 0x3b08, 0x97b: 0x3308, + 0x97c: 0x3308, 0x97d: 0x0008, 0x97e: 0x0040, 0x97f: 0x0040, + // Block 0x26, offset 0x980 + 0x980: 0x0008, 0x981: 0x0008, 0x982: 0x0008, 0x983: 0x0211, 0x984: 0x0008, 0x985: 0x0008, + 0x986: 0x0008, 0x987: 0x0008, 0x988: 0x0040, 0x989: 0x0008, 0x98a: 0x0008, 0x98b: 0x0008, + 0x98c: 0x0008, 0x98d: 0x0219, 0x98e: 0x0008, 0x98f: 0x0008, 0x990: 0x0008, 0x991: 0x0008, + 0x992: 0x0221, 0x993: 0x0008, 0x994: 0x0008, 0x995: 0x0008, 0x996: 0x0008, 0x997: 0x0229, + 0x998: 0x0008, 0x999: 0x0008, 0x99a: 0x0008, 0x99b: 0x0008, 0x99c: 0x0231, 0x99d: 0x0008, + 0x99e: 0x0008, 0x99f: 0x0008, 0x9a0: 0x0008, 0x9a1: 0x0008, 0x9a2: 0x0008, 0x9a3: 0x0008, + 0x9a4: 0x0008, 0x9a5: 0x0008, 0x9a6: 0x0008, 0x9a7: 0x0008, 0x9a8: 0x0008, 0x9a9: 0x0239, + 0x9aa: 0x0008, 0x9ab: 0x0008, 0x9ac: 0x0008, 0x9ad: 0x0040, 0x9ae: 0x0040, 0x9af: 0x0040, + 0x9b0: 0x0040, 0x9b1: 0x3308, 0x9b2: 0x3308, 0x9b3: 0x0241, 0x9b4: 0x3308, 0x9b5: 0x0249, + 0x9b6: 0x0251, 0x9b7: 0x0259, 0x9b8: 0x0261, 0x9b9: 0x0269, 0x9ba: 0x3308, 0x9bb: 0x3308, + 0x9bc: 0x3308, 0x9bd: 0x3308, 0x9be: 0x3308, 0x9bf: 0x3008, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x3308, 0x9c1: 0x0271, 0x9c2: 0x3308, 0x9c3: 0x3308, 0x9c4: 0x3b08, 0x9c5: 0x0018, + 0x9c6: 0x3308, 0x9c7: 0x3308, 0x9c8: 0x0008, 0x9c9: 0x0008, 0x9ca: 0x0008, 0x9cb: 0x0008, + 0x9cc: 0x0008, 0x9cd: 0x3308, 0x9ce: 0x3308, 0x9cf: 0x3308, 0x9d0: 0x3308, 0x9d1: 0x3308, + 0x9d2: 0x3308, 0x9d3: 0x0279, 0x9d4: 0x3308, 0x9d5: 0x3308, 0x9d6: 0x3308, 0x9d7: 0x3308, + 0x9d8: 0x0040, 0x9d9: 0x3308, 0x9da: 0x3308, 0x9db: 0x3308, 0x9dc: 0x3308, 0x9dd: 0x0281, + 0x9de: 0x3308, 0x9df: 0x3308, 0x9e0: 0x3308, 0x9e1: 0x3308, 0x9e2: 0x0289, 0x9e3: 0x3308, + 0x9e4: 0x3308, 0x9e5: 0x3308, 0x9e6: 0x3308, 0x9e7: 0x0291, 0x9e8: 0x3308, 0x9e9: 0x3308, + 0x9ea: 0x3308, 0x9eb: 0x3308, 0x9ec: 0x0299, 0x9ed: 0x3308, 0x9ee: 0x3308, 0x9ef: 0x3308, + 0x9f0: 0x3308, 0x9f1: 0x3308, 0x9f2: 0x3308, 0x9f3: 0x3308, 0x9f4: 0x3308, 0x9f5: 0x3308, + 0x9f6: 0x3308, 0x9f7: 0x3308, 0x9f8: 0x3308, 0x9f9: 0x02a1, 0x9fa: 0x3308, 0x9fb: 0x3308, + 0x9fc: 0x3308, 0x9fd: 0x0040, 0x9fe: 0x0018, 0x9ff: 0x0018, + // Block 0x28, offset 0xa00 + 0xa00: 0x0008, 0xa01: 0x0008, 0xa02: 0x0008, 0xa03: 0x0008, 0xa04: 0x0008, 0xa05: 0x0008, + 0xa06: 0x0008, 0xa07: 0x0008, 0xa08: 0x0008, 0xa09: 0x0008, 0xa0a: 0x0008, 0xa0b: 0x0008, + 0xa0c: 0x0008, 0xa0d: 0x0008, 0xa0e: 0x0008, 0xa0f: 0x0008, 0xa10: 0x0008, 0xa11: 0x0008, + 0xa12: 0x0008, 0xa13: 0x0008, 0xa14: 0x0008, 0xa15: 0x0008, 0xa16: 0x0008, 0xa17: 0x0008, + 0xa18: 0x0008, 0xa19: 0x0008, 0xa1a: 0x0008, 0xa1b: 0x0008, 0xa1c: 0x0008, 0xa1d: 0x0008, + 0xa1e: 0x0008, 0xa1f: 0x0008, 0xa20: 0x0008, 0xa21: 0x0008, 0xa22: 0x0008, 0xa23: 0x0008, + 0xa24: 0x0008, 0xa25: 0x0008, 0xa26: 0x0008, 0xa27: 0x0008, 0xa28: 0x0008, 0xa29: 0x0008, + 0xa2a: 0x0008, 0xa2b: 0x0008, 0xa2c: 0x0019, 0xa2d: 0x02e1, 0xa2e: 0x02e9, 0xa2f: 0x0008, + 0xa30: 0x02f1, 0xa31: 0x02f9, 0xa32: 0x0301, 0xa33: 0x0309, 0xa34: 0x00a9, 0xa35: 0x0311, + 0xa36: 0x00b1, 0xa37: 0x0319, 0xa38: 0x0101, 0xa39: 0x0321, 0xa3a: 0x0329, 0xa3b: 0x0008, + 0xa3c: 0x0051, 0xa3d: 0x0331, 0xa3e: 0x0339, 0xa3f: 0x00b9, + // Block 0x29, offset 0xa40 + 0xa40: 0x0341, 0xa41: 0x0349, 0xa42: 0x00c1, 0xa43: 0x0019, 0xa44: 0x0351, 0xa45: 0x0359, + 0xa46: 0x05b5, 0xa47: 0x02e9, 0xa48: 0x02f1, 0xa49: 0x02f9, 0xa4a: 0x0361, 0xa4b: 0x0369, + 0xa4c: 0x0371, 0xa4d: 0x0309, 0xa4e: 0x0008, 0xa4f: 0x0319, 0xa50: 0x0321, 0xa51: 0x0379, + 0xa52: 0x0051, 0xa53: 0x0381, 0xa54: 0x05cd, 0xa55: 0x05cd, 0xa56: 0x0339, 0xa57: 0x0341, + 0xa58: 0x0349, 0xa59: 0x05b5, 0xa5a: 0x0389, 0xa5b: 0x0391, 0xa5c: 0x05e5, 0xa5d: 0x0399, + 0xa5e: 0x03a1, 0xa5f: 0x03a9, 0xa60: 0x03b1, 0xa61: 0x03b9, 0xa62: 0x0311, 0xa63: 0x00b9, + 0xa64: 0x0349, 0xa65: 0x0391, 0xa66: 0x0399, 0xa67: 0x03a1, 0xa68: 0x03c1, 0xa69: 0x03b1, + 0xa6a: 0x03b9, 0xa6b: 0x0008, 0xa6c: 0x0008, 0xa6d: 0x0008, 0xa6e: 0x0008, 0xa6f: 0x0008, + 0xa70: 0x0008, 0xa71: 0x0008, 0xa72: 0x0008, 0xa73: 0x0008, 0xa74: 0x0008, 0xa75: 0x0008, + 0xa76: 0x0008, 0xa77: 0x0008, 0xa78: 0x03c9, 0xa79: 0x0008, 0xa7a: 0x0008, 0xa7b: 0x0008, + 0xa7c: 0x0008, 0xa7d: 0x0008, 0xa7e: 0x0008, 0xa7f: 0x0008, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0008, 0xa81: 0x0008, 0xa82: 0x0008, 0xa83: 0x0008, 0xa84: 0x0008, 0xa85: 0x0008, + 0xa86: 0x0008, 0xa87: 0x0008, 0xa88: 0x0008, 0xa89: 0x0008, 0xa8a: 0x0008, 0xa8b: 0x0008, + 0xa8c: 0x0008, 0xa8d: 0x0008, 0xa8e: 0x0008, 0xa8f: 0x0008, 0xa90: 0x0008, 0xa91: 0x0008, + 0xa92: 0x0008, 0xa93: 0x0008, 0xa94: 0x0008, 0xa95: 0x0008, 0xa96: 0x0008, 0xa97: 0x0008, + 0xa98: 0x0008, 0xa99: 0x0008, 0xa9a: 0x0008, 0xa9b: 0x03d1, 0xa9c: 0x03d9, 0xa9d: 0x03e1, + 0xa9e: 0x03e9, 0xa9f: 0x0371, 0xaa0: 0x03f1, 0xaa1: 0x03f9, 0xaa2: 0x0401, 0xaa3: 0x0409, + 0xaa4: 0x0411, 0xaa5: 0x0419, 0xaa6: 0x0421, 0xaa7: 0x05fd, 0xaa8: 0x0429, 0xaa9: 0x0431, + 0xaaa: 0xe17d, 0xaab: 0x0439, 0xaac: 0x0441, 0xaad: 0x0449, 0xaae: 0x0451, 0xaaf: 0x0459, + 0xab0: 0x0461, 0xab1: 0x0469, 0xab2: 0x0471, 0xab3: 0x0479, 0xab4: 0x0481, 0xab5: 0x0489, + 0xab6: 0x0491, 0xab7: 0x0499, 0xab8: 0x0615, 0xab9: 0x04a1, 0xaba: 0x04a9, 0xabb: 0x04b1, + 0xabc: 0x04b9, 0xabd: 0x04c1, 0xabe: 0x04c9, 0xabf: 0x04d1, + // Block 0x2b, offset 0xac0 + 0xac0: 0xe00d, 0xac1: 0x0008, 0xac2: 0xe00d, 0xac3: 0x0008, 0xac4: 0xe00d, 0xac5: 0x0008, + 0xac6: 0xe00d, 0xac7: 0x0008, 0xac8: 0xe00d, 0xac9: 0x0008, 0xaca: 0xe00d, 0xacb: 0x0008, + 0xacc: 0xe00d, 0xacd: 0x0008, 0xace: 0xe00d, 0xacf: 0x0008, 0xad0: 0xe00d, 0xad1: 0x0008, + 0xad2: 0xe00d, 0xad3: 0x0008, 0xad4: 0xe00d, 0xad5: 0x0008, 0xad6: 0xe00d, 0xad7: 0x0008, + 0xad8: 0xe00d, 0xad9: 0x0008, 0xada: 0xe00d, 0xadb: 0x0008, 0xadc: 0xe00d, 0xadd: 0x0008, + 0xade: 0xe00d, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, + 0xae4: 0xe00d, 0xae5: 0x0008, 0xae6: 0xe00d, 0xae7: 0x0008, 0xae8: 0xe00d, 0xae9: 0x0008, + 0xaea: 0xe00d, 0xaeb: 0x0008, 0xaec: 0xe00d, 0xaed: 0x0008, 0xaee: 0xe00d, 0xaef: 0x0008, + 0xaf0: 0xe00d, 0xaf1: 0x0008, 0xaf2: 0xe00d, 0xaf3: 0x0008, 0xaf4: 0xe00d, 0xaf5: 0x0008, + 0xaf6: 0xe00d, 0xaf7: 0x0008, 0xaf8: 0xe00d, 0xaf9: 0x0008, 0xafa: 0xe00d, 0xafb: 0x0008, + 0xafc: 0xe00d, 0xafd: 0x0008, 0xafe: 0xe00d, 0xaff: 0x0008, + // Block 0x2c, offset 0xb00 + 0xb00: 0xe00d, 0xb01: 0x0008, 0xb02: 0xe00d, 0xb03: 0x0008, 0xb04: 0xe00d, 0xb05: 0x0008, + 0xb06: 0xe00d, 0xb07: 0x0008, 0xb08: 0xe00d, 0xb09: 0x0008, 0xb0a: 0xe00d, 0xb0b: 0x0008, + 0xb0c: 0xe00d, 0xb0d: 0x0008, 0xb0e: 0xe00d, 0xb0f: 0x0008, 0xb10: 0xe00d, 0xb11: 0x0008, + 0xb12: 0xe00d, 0xb13: 0x0008, 0xb14: 0xe00d, 0xb15: 0x0008, 0xb16: 0x0008, 0xb17: 0x0008, + 0xb18: 0x0008, 0xb19: 0x0008, 0xb1a: 0x062d, 0xb1b: 0x064d, 0xb1c: 0x0008, 0xb1d: 0x0008, + 0xb1e: 0x04d9, 0xb1f: 0x0008, 0xb20: 0xe00d, 0xb21: 0x0008, 0xb22: 0xe00d, 0xb23: 0x0008, + 0xb24: 0xe00d, 0xb25: 0x0008, 0xb26: 0xe00d, 0xb27: 0x0008, 0xb28: 0xe00d, 0xb29: 0x0008, + 0xb2a: 0xe00d, 0xb2b: 0x0008, 0xb2c: 0xe00d, 0xb2d: 0x0008, 0xb2e: 0xe00d, 0xb2f: 0x0008, + 0xb30: 0xe00d, 0xb31: 0x0008, 0xb32: 0xe00d, 0xb33: 0x0008, 0xb34: 0xe00d, 0xb35: 0x0008, + 0xb36: 0xe00d, 0xb37: 0x0008, 0xb38: 0xe00d, 0xb39: 0x0008, 0xb3a: 0xe00d, 0xb3b: 0x0008, + 0xb3c: 0xe00d, 0xb3d: 0x0008, 0xb3e: 0xe00d, 0xb3f: 0x0008, + // Block 0x2d, offset 0xb40 + 0xb40: 0x0008, 0xb41: 0x0008, 0xb42: 0x0008, 0xb43: 0x0008, 0xb44: 0x0008, 0xb45: 0x0008, + 0xb46: 0x0040, 0xb47: 0x0040, 0xb48: 0xe045, 0xb49: 0xe045, 0xb4a: 0xe045, 0xb4b: 0xe045, + 0xb4c: 0xe045, 0xb4d: 0xe045, 0xb4e: 0x0040, 0xb4f: 0x0040, 0xb50: 0x0008, 0xb51: 0x0008, + 0xb52: 0x0008, 0xb53: 0x0008, 0xb54: 0x0008, 0xb55: 0x0008, 0xb56: 0x0008, 0xb57: 0x0008, + 0xb58: 0x0040, 0xb59: 0xe045, 0xb5a: 0x0040, 0xb5b: 0xe045, 0xb5c: 0x0040, 0xb5d: 0xe045, + 0xb5e: 0x0040, 0xb5f: 0xe045, 0xb60: 0x0008, 0xb61: 0x0008, 0xb62: 0x0008, 0xb63: 0x0008, + 0xb64: 0x0008, 0xb65: 0x0008, 0xb66: 0x0008, 0xb67: 0x0008, 0xb68: 0xe045, 0xb69: 0xe045, + 0xb6a: 0xe045, 0xb6b: 0xe045, 0xb6c: 0xe045, 0xb6d: 0xe045, 0xb6e: 0xe045, 0xb6f: 0xe045, + 0xb70: 0x0008, 0xb71: 0x04e1, 0xb72: 0x0008, 0xb73: 0x04e9, 0xb74: 0x0008, 0xb75: 0x04f1, + 0xb76: 0x0008, 0xb77: 0x04f9, 0xb78: 0x0008, 0xb79: 0x0501, 0xb7a: 0x0008, 0xb7b: 0x0509, + 0xb7c: 0x0008, 0xb7d: 0x0511, 0xb7e: 0x0040, 0xb7f: 0x0040, + // Block 0x2e, offset 0xb80 + 0xb80: 0x0519, 0xb81: 0x0521, 0xb82: 0x0529, 0xb83: 0x0531, 0xb84: 0x0539, 0xb85: 0x0541, + 0xb86: 0x0549, 0xb87: 0x0551, 0xb88: 0x0519, 0xb89: 0x0521, 0xb8a: 0x0529, 0xb8b: 0x0531, + 0xb8c: 0x0539, 0xb8d: 0x0541, 0xb8e: 0x0549, 0xb8f: 0x0551, 0xb90: 0x0559, 0xb91: 0x0561, + 0xb92: 0x0569, 0xb93: 0x0571, 0xb94: 0x0579, 0xb95: 0x0581, 0xb96: 0x0589, 0xb97: 0x0591, + 0xb98: 0x0559, 0xb99: 0x0561, 0xb9a: 0x0569, 0xb9b: 0x0571, 0xb9c: 0x0579, 0xb9d: 0x0581, + 0xb9e: 0x0589, 0xb9f: 0x0591, 0xba0: 0x0599, 0xba1: 0x05a1, 0xba2: 0x05a9, 0xba3: 0x05b1, + 0xba4: 0x05b9, 0xba5: 0x05c1, 0xba6: 0x05c9, 0xba7: 0x05d1, 0xba8: 0x0599, 0xba9: 0x05a1, + 0xbaa: 0x05a9, 0xbab: 0x05b1, 0xbac: 0x05b9, 0xbad: 0x05c1, 0xbae: 0x05c9, 0xbaf: 0x05d1, + 0xbb0: 0x0008, 0xbb1: 0x0008, 0xbb2: 0x05d9, 0xbb3: 0x05e1, 0xbb4: 0x05e9, 0xbb5: 0x0040, + 0xbb6: 0x0008, 0xbb7: 0x05f1, 0xbb8: 0xe045, 0xbb9: 0xe045, 0xbba: 0x0665, 0xbbb: 0x04e1, + 0xbbc: 0x05e1, 0xbbd: 0x067e, 0xbbe: 0x05f9, 0xbbf: 0x069e, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x06be, 0xbc1: 0x0602, 0xbc2: 0x0609, 0xbc3: 0x0611, 0xbc4: 0x0619, 0xbc5: 0x0040, + 0xbc6: 0x0008, 0xbc7: 0x0621, 0xbc8: 0x06dd, 0xbc9: 0x04e9, 0xbca: 0x06f5, 0xbcb: 0x04f1, + 0xbcc: 0x0611, 0xbcd: 0x062a, 0xbce: 0x0632, 0xbcf: 0x063a, 0xbd0: 0x0008, 0xbd1: 0x0008, + 0xbd2: 0x0008, 0xbd3: 0x0641, 0xbd4: 0x0040, 0xbd5: 0x0040, 0xbd6: 0x0008, 0xbd7: 0x0008, + 0xbd8: 0xe045, 0xbd9: 0xe045, 0xbda: 0x070d, 0xbdb: 0x04f9, 0xbdc: 0x0040, 0xbdd: 0x064a, + 0xbde: 0x0652, 0xbdf: 0x065a, 0xbe0: 0x0008, 0xbe1: 0x0008, 0xbe2: 0x0008, 0xbe3: 0x0661, + 0xbe4: 0x0008, 0xbe5: 0x0008, 0xbe6: 0x0008, 0xbe7: 0x0008, 0xbe8: 0xe045, 0xbe9: 0xe045, + 0xbea: 0x0725, 0xbeb: 0x0509, 0xbec: 0xe04d, 0xbed: 0x066a, 0xbee: 0x012a, 0xbef: 0x0672, + 0xbf0: 0x0040, 0xbf1: 0x0040, 0xbf2: 0x0679, 0xbf3: 0x0681, 0xbf4: 0x0689, 0xbf5: 0x0040, + 0xbf6: 0x0008, 0xbf7: 0x0691, 0xbf8: 0x073d, 0xbf9: 0x0501, 0xbfa: 0x0515, 0xbfb: 0x0511, + 0xbfc: 0x0681, 0xbfd: 0x0756, 0xbfe: 0x0776, 0xbff: 0x0040, + // Block 0x30, offset 0xc00 + 0xc00: 0x000a, 0xc01: 0x000a, 0xc02: 0x000a, 0xc03: 0x000a, 0xc04: 0x000a, 0xc05: 0x000a, + 0xc06: 0x000a, 0xc07: 0x000a, 0xc08: 0x000a, 0xc09: 0x000a, 0xc0a: 0x000a, 0xc0b: 0x03c0, + 0xc0c: 0x0003, 0xc0d: 0x0003, 0xc0e: 0x0340, 0xc0f: 0x0b40, 0xc10: 0x0018, 0xc11: 0xe00d, + 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x0796, + 0xc18: 0x0018, 0xc19: 0x0018, 0xc1a: 0x0018, 0xc1b: 0x0018, 0xc1c: 0x0018, 0xc1d: 0x0018, + 0xc1e: 0x0018, 0xc1f: 0x0018, 0xc20: 0x0018, 0xc21: 0x0018, 0xc22: 0x0018, 0xc23: 0x0018, + 0xc24: 0x0040, 0xc25: 0x0040, 0xc26: 0x0040, 0xc27: 0x0018, 0xc28: 0x0040, 0xc29: 0x0040, + 0xc2a: 0x0340, 0xc2b: 0x0340, 0xc2c: 0x0340, 0xc2d: 0x0340, 0xc2e: 0x0340, 0xc2f: 0x000a, + 0xc30: 0x0018, 0xc31: 0x0018, 0xc32: 0x0018, 0xc33: 0x0699, 0xc34: 0x06a1, 0xc35: 0x0018, + 0xc36: 0x06a9, 0xc37: 0x06b1, 0xc38: 0x0018, 0xc39: 0x0018, 0xc3a: 0x0018, 0xc3b: 0x0018, + 0xc3c: 0x06ba, 0xc3d: 0x0018, 0xc3e: 0x07b6, 0xc3f: 0x0018, + // Block 0x31, offset 0xc40 + 0xc40: 0x0018, 0xc41: 0x0018, 0xc42: 0x0018, 0xc43: 0x0018, 0xc44: 0x0018, 0xc45: 0x0018, + 0xc46: 0x0018, 0xc47: 0x06c2, 0xc48: 0x06ca, 0xc49: 0x06d2, 0xc4a: 0x0018, 0xc4b: 0x0018, + 0xc4c: 0x0018, 0xc4d: 0x0018, 0xc4e: 0x0018, 0xc4f: 0x0018, 0xc50: 0x0018, 0xc51: 0x0018, + 0xc52: 0x0018, 0xc53: 0x0018, 0xc54: 0x0018, 0xc55: 0x0018, 0xc56: 0x0018, 0xc57: 0x06d9, + 0xc58: 0x0018, 0xc59: 0x0018, 0xc5a: 0x0018, 0xc5b: 0x0018, 0xc5c: 0x0018, 0xc5d: 0x0018, + 0xc5e: 0x0018, 0xc5f: 0x000a, 0xc60: 0x03c0, 0xc61: 0x0340, 0xc62: 0x0340, 0xc63: 0x0340, + 0xc64: 0x03c0, 0xc65: 0x0040, 0xc66: 0x0040, 0xc67: 0x0040, 0xc68: 0x0040, 0xc69: 0x0040, + 0xc6a: 0x0340, 0xc6b: 0x0340, 0xc6c: 0x0340, 0xc6d: 0x0340, 0xc6e: 0x0340, 0xc6f: 0x0340, + 0xc70: 0x06e1, 0xc71: 0x0311, 0xc72: 0x0040, 0xc73: 0x0040, 0xc74: 0x06e9, 0xc75: 0x06f1, + 0xc76: 0x06f9, 0xc77: 0x0701, 0xc78: 0x0709, 0xc79: 0x0711, 0xc7a: 0x071a, 0xc7b: 0x07d5, + 0xc7c: 0x0722, 0xc7d: 0x072a, 0xc7e: 0x0732, 0xc7f: 0x0329, + // Block 0x32, offset 0xc80 + 0xc80: 0x06e1, 0xc81: 0x0049, 0xc82: 0x0029, 0xc83: 0x0031, 0xc84: 0x06e9, 0xc85: 0x06f1, + 0xc86: 0x06f9, 0xc87: 0x0701, 0xc88: 0x0709, 0xc89: 0x0711, 0xc8a: 0x071a, 0xc8b: 0x07ed, + 0xc8c: 0x0722, 0xc8d: 0x072a, 0xc8e: 0x0732, 0xc8f: 0x0040, 0xc90: 0x0019, 0xc91: 0x02f9, + 0xc92: 0x0051, 0xc93: 0x0109, 0xc94: 0x0361, 0xc95: 0x00a9, 0xc96: 0x0319, 0xc97: 0x0101, + 0xc98: 0x0321, 0xc99: 0x0329, 0xc9a: 0x0339, 0xc9b: 0x0089, 0xc9c: 0x0341, 0xc9d: 0x0040, + 0xc9e: 0x0040, 0xc9f: 0x0040, 0xca0: 0x0018, 0xca1: 0x0018, 0xca2: 0x0018, 0xca3: 0x0018, + 0xca4: 0x0018, 0xca5: 0x0018, 0xca6: 0x0018, 0xca7: 0x0018, 0xca8: 0x0739, 0xca9: 0x0018, + 0xcaa: 0x0018, 0xcab: 0x0018, 0xcac: 0x0018, 0xcad: 0x0018, 0xcae: 0x0018, 0xcaf: 0x0018, + 0xcb0: 0x0018, 0xcb1: 0x0018, 0xcb2: 0x0018, 0xcb3: 0x0018, 0xcb4: 0x0018, 0xcb5: 0x0018, + 0xcb6: 0x0018, 0xcb7: 0x0018, 0xcb8: 0x0018, 0xcb9: 0x0018, 0xcba: 0x0018, 0xcbb: 0x0018, + 0xcbc: 0x0018, 0xcbd: 0x0018, 0xcbe: 0x0018, 0xcbf: 0x0018, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x0806, 0xcc1: 0x0826, 0xcc2: 0x03d9, 0xcc3: 0x0845, 0xcc4: 0x0018, 0xcc5: 0x0866, + 0xcc6: 0x0886, 0xcc7: 0x0369, 0xcc8: 0x0018, 0xcc9: 0x08a5, 0xcca: 0x0309, 0xccb: 0x00a9, + 0xccc: 0x00a9, 0xccd: 0x00a9, 0xcce: 0x00a9, 0xccf: 0x0741, 0xcd0: 0x0311, 0xcd1: 0x0311, + 0xcd2: 0x0101, 0xcd3: 0x0101, 0xcd4: 0x0018, 0xcd5: 0x0329, 0xcd6: 0x0749, 0xcd7: 0x0018, + 0xcd8: 0x0018, 0xcd9: 0x0339, 0xcda: 0x0751, 0xcdb: 0x00b9, 0xcdc: 0x00b9, 0xcdd: 0x00b9, + 0xcde: 0x0018, 0xcdf: 0x0018, 0xce0: 0x0759, 0xce1: 0x08c5, 0xce2: 0x0761, 0xce3: 0x0018, + 0xce4: 0x04b1, 0xce5: 0x0018, 0xce6: 0x0769, 0xce7: 0x0018, 0xce8: 0x04b1, 0xce9: 0x0018, + 0xcea: 0x0319, 0xceb: 0x0771, 0xcec: 0x02e9, 0xced: 0x03d9, 0xcee: 0x0018, 0xcef: 0x02f9, + 0xcf0: 0x02f9, 0xcf1: 0x03f1, 0xcf2: 0x0040, 0xcf3: 0x0321, 0xcf4: 0x0051, 0xcf5: 0x0779, + 0xcf6: 0x0781, 0xcf7: 0x0789, 0xcf8: 0x0791, 0xcf9: 0x0311, 0xcfa: 0x0018, 0xcfb: 0x08e5, + 0xcfc: 0x0799, 0xcfd: 0x03a1, 0xcfe: 0x03a1, 0xcff: 0x0799, + // Block 0x34, offset 0xd00 + 0xd00: 0x0905, 0xd01: 0x0018, 0xd02: 0x0018, 0xd03: 0x0018, 0xd04: 0x0018, 0xd05: 0x02f1, + 0xd06: 0x02f1, 0xd07: 0x02f9, 0xd08: 0x0311, 0xd09: 0x00b1, 0xd0a: 0x0018, 0xd0b: 0x0018, + 0xd0c: 0x0018, 0xd0d: 0x0018, 0xd0e: 0x0008, 0xd0f: 0x0018, 0xd10: 0x07a1, 0xd11: 0x07a9, + 0xd12: 0x07b1, 0xd13: 0x07b9, 0xd14: 0x07c1, 0xd15: 0x07c9, 0xd16: 0x07d1, 0xd17: 0x07d9, + 0xd18: 0x07e1, 0xd19: 0x07e9, 0xd1a: 0x07f1, 0xd1b: 0x07f9, 0xd1c: 0x0801, 0xd1d: 0x0809, + 0xd1e: 0x0811, 0xd1f: 0x0819, 0xd20: 0x0311, 0xd21: 0x0821, 0xd22: 0x091d, 0xd23: 0x0829, + 0xd24: 0x0391, 0xd25: 0x0831, 0xd26: 0x093d, 0xd27: 0x0839, 0xd28: 0x0841, 0xd29: 0x0109, + 0xd2a: 0x0849, 0xd2b: 0x095d, 0xd2c: 0x0101, 0xd2d: 0x03d9, 0xd2e: 0x02f1, 0xd2f: 0x0321, + 0xd30: 0x0311, 0xd31: 0x0821, 0xd32: 0x097d, 0xd33: 0x0829, 0xd34: 0x0391, 0xd35: 0x0831, + 0xd36: 0x099d, 0xd37: 0x0839, 0xd38: 0x0841, 0xd39: 0x0109, 0xd3a: 0x0849, 0xd3b: 0x09bd, + 0xd3c: 0x0101, 0xd3d: 0x03d9, 0xd3e: 0x02f1, 0xd3f: 0x0321, + // Block 0x35, offset 0xd40 + 0xd40: 0x0018, 0xd41: 0x0018, 0xd42: 0x0018, 0xd43: 0x0018, 0xd44: 0x0018, 0xd45: 0x0018, + 0xd46: 0x0018, 0xd47: 0x0018, 0xd48: 0x0018, 0xd49: 0x0018, 0xd4a: 0x0018, 0xd4b: 0x0040, + 0xd4c: 0x0040, 0xd4d: 0x0040, 0xd4e: 0x0040, 0xd4f: 0x0040, 0xd50: 0x0040, 0xd51: 0x0040, + 0xd52: 0x0040, 0xd53: 0x0040, 0xd54: 0x0040, 0xd55: 0x0040, 0xd56: 0x0040, 0xd57: 0x0040, + 0xd58: 0x0040, 0xd59: 0x0040, 0xd5a: 0x0040, 0xd5b: 0x0040, 0xd5c: 0x0040, 0xd5d: 0x0040, + 0xd5e: 0x0040, 0xd5f: 0x0040, 0xd60: 0x0049, 0xd61: 0x0029, 0xd62: 0x0031, 0xd63: 0x06e9, + 0xd64: 0x06f1, 0xd65: 0x06f9, 0xd66: 0x0701, 0xd67: 0x0709, 0xd68: 0x0711, 0xd69: 0x0879, + 0xd6a: 0x0881, 0xd6b: 0x0889, 0xd6c: 0x0891, 0xd6d: 0x0899, 0xd6e: 0x08a1, 0xd6f: 0x08a9, + 0xd70: 0x08b1, 0xd71: 0x08b9, 0xd72: 0x08c1, 0xd73: 0x08c9, 0xd74: 0x0a1e, 0xd75: 0x0a3e, + 0xd76: 0x0a5e, 0xd77: 0x0a7e, 0xd78: 0x0a9e, 0xd79: 0x0abe, 0xd7a: 0x0ade, 0xd7b: 0x0afe, + 0xd7c: 0x0b1e, 0xd7d: 0x08d2, 0xd7e: 0x08da, 0xd7f: 0x08e2, + // Block 0x36, offset 0xd80 + 0xd80: 0x08ea, 0xd81: 0x08f2, 0xd82: 0x08fa, 0xd83: 0x0902, 0xd84: 0x090a, 0xd85: 0x0912, + 0xd86: 0x091a, 0xd87: 0x0922, 0xd88: 0x0040, 0xd89: 0x0040, 0xd8a: 0x0040, 0xd8b: 0x0040, + 0xd8c: 0x0040, 0xd8d: 0x0040, 0xd8e: 0x0040, 0xd8f: 0x0040, 0xd90: 0x0040, 0xd91: 0x0040, + 0xd92: 0x0040, 0xd93: 0x0040, 0xd94: 0x0040, 0xd95: 0x0040, 0xd96: 0x0040, 0xd97: 0x0040, + 0xd98: 0x0040, 0xd99: 0x0040, 0xd9a: 0x0040, 0xd9b: 0x0040, 0xd9c: 0x0b3e, 0xd9d: 0x0b5e, + 0xd9e: 0x0b7e, 0xd9f: 0x0b9e, 0xda0: 0x0bbe, 0xda1: 0x0bde, 0xda2: 0x0bfe, 0xda3: 0x0c1e, + 0xda4: 0x0c3e, 0xda5: 0x0c5e, 0xda6: 0x0c7e, 0xda7: 0x0c9e, 0xda8: 0x0cbe, 0xda9: 0x0cde, + 0xdaa: 0x0cfe, 0xdab: 0x0d1e, 0xdac: 0x0d3e, 0xdad: 0x0d5e, 0xdae: 0x0d7e, 0xdaf: 0x0d9e, + 0xdb0: 0x0dbe, 0xdb1: 0x0dde, 0xdb2: 0x0dfe, 0xdb3: 0x0e1e, 0xdb4: 0x0e3e, 0xdb5: 0x0e5e, + 0xdb6: 0x0019, 0xdb7: 0x02e9, 0xdb8: 0x03d9, 0xdb9: 0x02f1, 0xdba: 0x02f9, 0xdbb: 0x03f1, + 0xdbc: 0x0309, 0xdbd: 0x00a9, 0xdbe: 0x0311, 0xdbf: 0x00b1, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0319, 0xdc1: 0x0101, 0xdc2: 0x0321, 0xdc3: 0x0329, 0xdc4: 0x0051, 0xdc5: 0x0339, + 0xdc6: 0x0751, 0xdc7: 0x00b9, 0xdc8: 0x0089, 0xdc9: 0x0341, 0xdca: 0x0349, 0xdcb: 0x0391, + 0xdcc: 0x00c1, 0xdcd: 0x0109, 0xdce: 0x00c9, 0xdcf: 0x04b1, 0xdd0: 0x0019, 0xdd1: 0x02e9, + 0xdd2: 0x03d9, 0xdd3: 0x02f1, 0xdd4: 0x02f9, 0xdd5: 0x03f1, 0xdd6: 0x0309, 0xdd7: 0x00a9, + 0xdd8: 0x0311, 0xdd9: 0x00b1, 0xdda: 0x0319, 0xddb: 0x0101, 0xddc: 0x0321, 0xddd: 0x0329, + 0xdde: 0x0051, 0xddf: 0x0339, 0xde0: 0x0751, 0xde1: 0x00b9, 0xde2: 0x0089, 0xde3: 0x0341, + 0xde4: 0x0349, 0xde5: 0x0391, 0xde6: 0x00c1, 0xde7: 0x0109, 0xde8: 0x00c9, 0xde9: 0x04b1, + 0xdea: 0x06e1, 0xdeb: 0x0018, 0xdec: 0x0018, 0xded: 0x0018, 0xdee: 0x0018, 0xdef: 0x0018, + 0xdf0: 0x0018, 0xdf1: 0x0018, 0xdf2: 0x0018, 0xdf3: 0x0018, 0xdf4: 0x0018, 0xdf5: 0x0018, + 0xdf6: 0x0018, 0xdf7: 0x0018, 0xdf8: 0x0018, 0xdf9: 0x0018, 0xdfa: 0x0018, 0xdfb: 0x0018, + 0xdfc: 0x0018, 0xdfd: 0x0018, 0xdfe: 0x0018, 0xdff: 0x0018, + // Block 0x38, offset 0xe00 + 0xe00: 0x0008, 0xe01: 0x0008, 0xe02: 0x0008, 0xe03: 0x0008, 0xe04: 0x0008, 0xe05: 0x0008, + 0xe06: 0x0008, 0xe07: 0x0008, 0xe08: 0x0008, 0xe09: 0x0008, 0xe0a: 0x0008, 0xe0b: 0x0008, + 0xe0c: 0x0008, 0xe0d: 0x0008, 0xe0e: 0x0008, 0xe0f: 0x0008, 0xe10: 0x0008, 0xe11: 0x0008, + 0xe12: 0x0008, 0xe13: 0x0008, 0xe14: 0x0008, 0xe15: 0x0008, 0xe16: 0x0008, 0xe17: 0x0008, + 0xe18: 0x0008, 0xe19: 0x0008, 0xe1a: 0x0008, 0xe1b: 0x0008, 0xe1c: 0x0008, 0xe1d: 0x0008, + 0xe1e: 0x0008, 0xe1f: 0x0008, 0xe20: 0xe00d, 0xe21: 0x0008, 0xe22: 0x0941, 0xe23: 0x0ed5, + 0xe24: 0x0949, 0xe25: 0x0008, 0xe26: 0x0008, 0xe27: 0xe07d, 0xe28: 0x0008, 0xe29: 0xe01d, + 0xe2a: 0x0008, 0xe2b: 0xe03d, 0xe2c: 0x0008, 0xe2d: 0x0359, 0xe2e: 0x0441, 0xe2f: 0x0351, + 0xe30: 0x03d1, 0xe31: 0x0008, 0xe32: 0xe00d, 0xe33: 0x0008, 0xe34: 0x0008, 0xe35: 0xe01d, + 0xe36: 0x0008, 0xe37: 0x0008, 0xe38: 0x0008, 0xe39: 0x0008, 0xe3a: 0x0008, 0xe3b: 0x0008, + 0xe3c: 0x00b1, 0xe3d: 0x0391, 0xe3e: 0x0951, 0xe3f: 0x0959, + // Block 0x39, offset 0xe40 + 0xe40: 0xe00d, 0xe41: 0x0008, 0xe42: 0xe00d, 0xe43: 0x0008, 0xe44: 0xe00d, 0xe45: 0x0008, + 0xe46: 0xe00d, 0xe47: 0x0008, 0xe48: 0xe00d, 0xe49: 0x0008, 0xe4a: 0xe00d, 0xe4b: 0x0008, + 0xe4c: 0xe00d, 0xe4d: 0x0008, 0xe4e: 0xe00d, 0xe4f: 0x0008, 0xe50: 0xe00d, 0xe51: 0x0008, + 0xe52: 0xe00d, 0xe53: 0x0008, 0xe54: 0xe00d, 0xe55: 0x0008, 0xe56: 0xe00d, 0xe57: 0x0008, + 0xe58: 0xe00d, 0xe59: 0x0008, 0xe5a: 0xe00d, 0xe5b: 0x0008, 0xe5c: 0xe00d, 0xe5d: 0x0008, + 0xe5e: 0xe00d, 0xe5f: 0x0008, 0xe60: 0xe00d, 0xe61: 0x0008, 0xe62: 0xe00d, 0xe63: 0x0008, + 0xe64: 0x0008, 0xe65: 0x0018, 0xe66: 0x0018, 0xe67: 0x0018, 0xe68: 0x0018, 0xe69: 0x0018, + 0xe6a: 0x0018, 0xe6b: 0xe03d, 0xe6c: 0x0008, 0xe6d: 0xe01d, 0xe6e: 0x0008, 0xe6f: 0x3308, + 0xe70: 0x3308, 0xe71: 0x3308, 0xe72: 0xe00d, 0xe73: 0x0008, 0xe74: 0x0040, 0xe75: 0x0040, + 0xe76: 0x0040, 0xe77: 0x0040, 0xe78: 0x0040, 0xe79: 0x0018, 0xe7a: 0x0018, 0xe7b: 0x0018, + 0xe7c: 0x0018, 0xe7d: 0x0018, 0xe7e: 0x0018, 0xe7f: 0x0018, + // Block 0x3a, offset 0xe80 + 0xe80: 0x2715, 0xe81: 0x2735, 0xe82: 0x2755, 0xe83: 0x2775, 0xe84: 0x2795, 0xe85: 0x27b5, + 0xe86: 0x27d5, 0xe87: 0x27f5, 0xe88: 0x2815, 0xe89: 0x2835, 0xe8a: 0x2855, 0xe8b: 0x2875, + 0xe8c: 0x2895, 0xe8d: 0x28b5, 0xe8e: 0x28d5, 0xe8f: 0x28f5, 0xe90: 0x2915, 0xe91: 0x2935, + 0xe92: 0x2955, 0xe93: 0x2975, 0xe94: 0x2995, 0xe95: 0x29b5, 0xe96: 0x0040, 0xe97: 0x0040, + 0xe98: 0x0040, 0xe99: 0x0040, 0xe9a: 0x0040, 0xe9b: 0x0040, 0xe9c: 0x0040, 0xe9d: 0x0040, + 0xe9e: 0x0040, 0xe9f: 0x0040, 0xea0: 0x0040, 0xea1: 0x0040, 0xea2: 0x0040, 0xea3: 0x0040, + 0xea4: 0x0040, 0xea5: 0x0040, 0xea6: 0x0040, 0xea7: 0x0040, 0xea8: 0x0040, 0xea9: 0x0040, + 0xeaa: 0x0040, 0xeab: 0x0040, 0xeac: 0x0040, 0xead: 0x0040, 0xeae: 0x0040, 0xeaf: 0x0040, + 0xeb0: 0x0040, 0xeb1: 0x0040, 0xeb2: 0x0040, 0xeb3: 0x0040, 0xeb4: 0x0040, 0xeb5: 0x0040, + 0xeb6: 0x0040, 0xeb7: 0x0040, 0xeb8: 0x0040, 0xeb9: 0x0040, 0xeba: 0x0040, 0xebb: 0x0040, + 0xebc: 0x0040, 0xebd: 0x0040, 0xebe: 0x0040, 0xebf: 0x0040, + // Block 0x3b, offset 0xec0 + 0xec0: 0x000a, 0xec1: 0x0018, 0xec2: 0x0961, 0xec3: 0x0018, 0xec4: 0x0018, 0xec5: 0x0008, + 0xec6: 0x0008, 0xec7: 0x0008, 0xec8: 0x0018, 0xec9: 0x0018, 0xeca: 0x0018, 0xecb: 0x0018, + 0xecc: 0x0018, 0xecd: 0x0018, 0xece: 0x0018, 0xecf: 0x0018, 0xed0: 0x0018, 0xed1: 0x0018, + 0xed2: 0x0018, 0xed3: 0x0018, 0xed4: 0x0018, 0xed5: 0x0018, 0xed6: 0x0018, 0xed7: 0x0018, + 0xed8: 0x0018, 0xed9: 0x0018, 0xeda: 0x0018, 0xedb: 0x0018, 0xedc: 0x0018, 0xedd: 0x0018, + 0xede: 0x0018, 0xedf: 0x0018, 0xee0: 0x0018, 0xee1: 0x0018, 0xee2: 0x0018, 0xee3: 0x0018, + 0xee4: 0x0018, 0xee5: 0x0018, 0xee6: 0x0018, 0xee7: 0x0018, 0xee8: 0x0018, 0xee9: 0x0018, + 0xeea: 0x3308, 0xeeb: 0x3308, 0xeec: 0x3308, 0xeed: 0x3308, 0xeee: 0x3018, 0xeef: 0x3018, + 0xef0: 0x0018, 0xef1: 0x0018, 0xef2: 0x0018, 0xef3: 0x0018, 0xef4: 0x0018, 0xef5: 0x0018, + 0xef6: 0xe125, 0xef7: 0x0018, 0xef8: 0x29d5, 0xef9: 0x29f5, 0xefa: 0x2a15, 0xefb: 0x0018, + 0xefc: 0x0008, 0xefd: 0x0018, 0xefe: 0x0018, 0xeff: 0x0018, + // Block 0x3c, offset 0xf00 + 0xf00: 0x2b55, 0xf01: 0x2b75, 0xf02: 0x2b95, 0xf03: 0x2bb5, 0xf04: 0x2bd5, 0xf05: 0x2bf5, + 0xf06: 0x2bf5, 0xf07: 0x2bf5, 0xf08: 0x2c15, 0xf09: 0x2c15, 0xf0a: 0x2c15, 0xf0b: 0x2c15, + 0xf0c: 0x2c35, 0xf0d: 0x2c35, 0xf0e: 0x2c35, 0xf0f: 0x2c55, 0xf10: 0x2c75, 0xf11: 0x2c75, + 0xf12: 0x2a95, 0xf13: 0x2a95, 0xf14: 0x2c75, 0xf15: 0x2c75, 0xf16: 0x2c95, 0xf17: 0x2c95, + 0xf18: 0x2c75, 0xf19: 0x2c75, 0xf1a: 0x2a95, 0xf1b: 0x2a95, 0xf1c: 0x2c75, 0xf1d: 0x2c75, + 0xf1e: 0x2c55, 0xf1f: 0x2c55, 0xf20: 0x2cb5, 0xf21: 0x2cb5, 0xf22: 0x2cd5, 0xf23: 0x2cd5, + 0xf24: 0x0040, 0xf25: 0x2cf5, 0xf26: 0x2d15, 0xf27: 0x2d35, 0xf28: 0x2d35, 0xf29: 0x2d55, + 0xf2a: 0x2d75, 0xf2b: 0x2d95, 0xf2c: 0x2db5, 0xf2d: 0x2dd5, 0xf2e: 0x2df5, 0xf2f: 0x2e15, + 0xf30: 0x2e35, 0xf31: 0x2e55, 0xf32: 0x2e55, 0xf33: 0x2e75, 0xf34: 0x2e95, 0xf35: 0x2e95, + 0xf36: 0x2eb5, 0xf37: 0x2ed5, 0xf38: 0x2e75, 0xf39: 0x2ef5, 0xf3a: 0x2f15, 0xf3b: 0x2ef5, + 0xf3c: 0x2e75, 0xf3d: 0x2f35, 0xf3e: 0x2f55, 0xf3f: 0x2f75, + // Block 0x3d, offset 0xf40 + 0xf40: 0x2f95, 0xf41: 0x2fb5, 0xf42: 0x2d15, 0xf43: 0x2cf5, 0xf44: 0x2fd5, 0xf45: 0x2ff5, + 0xf46: 0x3015, 0xf47: 0x3035, 0xf48: 0x3055, 0xf49: 0x3075, 0xf4a: 0x3095, 0xf4b: 0x30b5, + 0xf4c: 0x30d5, 0xf4d: 0x30f5, 0xf4e: 0x3115, 0xf4f: 0x0040, 0xf50: 0x0018, 0xf51: 0x0018, + 0xf52: 0x3135, 0xf53: 0x3155, 0xf54: 0x3175, 0xf55: 0x3195, 0xf56: 0x31b5, 0xf57: 0x31d5, + 0xf58: 0x31f5, 0xf59: 0x3215, 0xf5a: 0x3235, 0xf5b: 0x3255, 0xf5c: 0x3175, 0xf5d: 0x3275, + 0xf5e: 0x3295, 0xf5f: 0x32b5, 0xf60: 0x0008, 0xf61: 0x0008, 0xf62: 0x0008, 0xf63: 0x0008, + 0xf64: 0x0008, 0xf65: 0x0008, 0xf66: 0x0008, 0xf67: 0x0008, 0xf68: 0x0008, 0xf69: 0x0008, + 0xf6a: 0x0008, 0xf6b: 0x0008, 0xf6c: 0x0008, 0xf6d: 0x0008, 0xf6e: 0x0008, 0xf6f: 0x0008, + 0xf70: 0x0008, 0xf71: 0x0008, 0xf72: 0x0008, 0xf73: 0x0008, 0xf74: 0x0008, 0xf75: 0x0008, + 0xf76: 0x0008, 0xf77: 0x0008, 0xf78: 0x0008, 0xf79: 0x0008, 0xf7a: 0x0008, 0xf7b: 0x0008, + 0xf7c: 0x0008, 0xf7d: 0x0008, 0xf7e: 0x0008, 0xf7f: 0x0008, + // Block 0x3e, offset 0xf80 + 0xf80: 0x0b82, 0xf81: 0x0b8a, 0xf82: 0x0b92, 0xf83: 0x0b9a, 0xf84: 0x32d5, 0xf85: 0x32f5, + 0xf86: 0x3315, 0xf87: 0x3335, 0xf88: 0x0018, 0xf89: 0x0018, 0xf8a: 0x0018, 0xf8b: 0x0018, + 0xf8c: 0x0018, 0xf8d: 0x0018, 0xf8e: 0x0018, 0xf8f: 0x0018, 0xf90: 0x3355, 0xf91: 0x0ba1, + 0xf92: 0x0ba9, 0xf93: 0x0bb1, 0xf94: 0x0bb9, 0xf95: 0x0bc1, 0xf96: 0x0bc9, 0xf97: 0x0bd1, + 0xf98: 0x0bd9, 0xf99: 0x0be1, 0xf9a: 0x0be9, 0xf9b: 0x0bf1, 0xf9c: 0x0bf9, 0xf9d: 0x0c01, + 0xf9e: 0x0c09, 0xf9f: 0x0c11, 0xfa0: 0x3375, 0xfa1: 0x3395, 0xfa2: 0x33b5, 0xfa3: 0x33d5, + 0xfa4: 0x33f5, 0xfa5: 0x33f5, 0xfa6: 0x3415, 0xfa7: 0x3435, 0xfa8: 0x3455, 0xfa9: 0x3475, + 0xfaa: 0x3495, 0xfab: 0x34b5, 0xfac: 0x34d5, 0xfad: 0x34f5, 0xfae: 0x3515, 0xfaf: 0x3535, + 0xfb0: 0x3555, 0xfb1: 0x3575, 0xfb2: 0x3595, 0xfb3: 0x35b5, 0xfb4: 0x35d5, 0xfb5: 0x35f5, + 0xfb6: 0x3615, 0xfb7: 0x3635, 0xfb8: 0x3655, 0xfb9: 0x3675, 0xfba: 0x3695, 0xfbb: 0x36b5, + 0xfbc: 0x0c19, 0xfbd: 0x0c21, 0xfbe: 0x36d5, 0xfbf: 0x0018, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x36f5, 0xfc1: 0x3715, 0xfc2: 0x3735, 0xfc3: 0x3755, 0xfc4: 0x3775, 0xfc5: 0x3795, + 0xfc6: 0x37b5, 0xfc7: 0x37d5, 0xfc8: 0x37f5, 0xfc9: 0x3815, 0xfca: 0x3835, 0xfcb: 0x3855, + 0xfcc: 0x3875, 0xfcd: 0x3895, 0xfce: 0x38b5, 0xfcf: 0x38d5, 0xfd0: 0x38f5, 0xfd1: 0x3915, + 0xfd2: 0x3935, 0xfd3: 0x3955, 0xfd4: 0x3975, 0xfd5: 0x3995, 0xfd6: 0x39b5, 0xfd7: 0x39d5, + 0xfd8: 0x39f5, 0xfd9: 0x3a15, 0xfda: 0x3a35, 0xfdb: 0x3a55, 0xfdc: 0x3a75, 0xfdd: 0x3a95, + 0xfde: 0x3ab5, 0xfdf: 0x3ad5, 0xfe0: 0x3af5, 0xfe1: 0x3b15, 0xfe2: 0x3b35, 0xfe3: 0x3b55, + 0xfe4: 0x3b75, 0xfe5: 0x3b95, 0xfe6: 0x1295, 0xfe7: 0x3bb5, 0xfe8: 0x3bd5, 0xfe9: 0x3bf5, + 0xfea: 0x3c15, 0xfeb: 0x3c35, 0xfec: 0x3c55, 0xfed: 0x3c75, 0xfee: 0x23b5, 0xfef: 0x3c95, + 0xff0: 0x3cb5, 0xff1: 0x0c29, 0xff2: 0x0c31, 0xff3: 0x0c39, 0xff4: 0x0c41, 0xff5: 0x0c49, + 0xff6: 0x0c51, 0xff7: 0x0c59, 0xff8: 0x0c61, 0xff9: 0x0c69, 0xffa: 0x0c71, 0xffb: 0x0c79, + 0xffc: 0x0c81, 0xffd: 0x0c89, 0xffe: 0x0c91, 0xfff: 0x0c99, + // Block 0x40, offset 0x1000 + 0x1000: 0x0ca1, 0x1001: 0x0ca9, 0x1002: 0x0cb1, 0x1003: 0x0cb9, 0x1004: 0x0cc1, 0x1005: 0x0cc9, + 0x1006: 0x0cd1, 0x1007: 0x0cd9, 0x1008: 0x0ce1, 0x1009: 0x0ce9, 0x100a: 0x0cf1, 0x100b: 0x0cf9, + 0x100c: 0x0d01, 0x100d: 0x3cd5, 0x100e: 0x0d09, 0x100f: 0x3cf5, 0x1010: 0x3d15, 0x1011: 0x3d2d, + 0x1012: 0x3d45, 0x1013: 0x3d5d, 0x1014: 0x3d75, 0x1015: 0x3d75, 0x1016: 0x3d5d, 0x1017: 0x3d8d, + 0x1018: 0x07d5, 0x1019: 0x3da5, 0x101a: 0x3dbd, 0x101b: 0x3dd5, 0x101c: 0x3ded, 0x101d: 0x3e05, + 0x101e: 0x3e1d, 0x101f: 0x3e35, 0x1020: 0x3e4d, 0x1021: 0x3e65, 0x1022: 0x3e7d, 0x1023: 0x3e95, + 0x1024: 0x3ead, 0x1025: 0x3ead, 0x1026: 0x3ec5, 0x1027: 0x3ec5, 0x1028: 0x3edd, 0x1029: 0x3edd, + 0x102a: 0x3ef5, 0x102b: 0x3f0d, 0x102c: 0x3f25, 0x102d: 0x3f3d, 0x102e: 0x3f55, 0x102f: 0x3f55, + 0x1030: 0x3f6d, 0x1031: 0x3f6d, 0x1032: 0x3f6d, 0x1033: 0x3f85, 0x1034: 0x3f9d, 0x1035: 0x3fb5, + 0x1036: 0x3fcd, 0x1037: 0x3fb5, 0x1038: 0x3fe5, 0x1039: 0x3ffd, 0x103a: 0x3f85, 0x103b: 0x4015, + 0x103c: 0x402d, 0x103d: 0x402d, 0x103e: 0x402d, 0x103f: 0x0d11, + // Block 0x41, offset 0x1040 + 0x1040: 0x10f9, 0x1041: 0x1101, 0x1042: 0x40a5, 0x1043: 0x1109, 0x1044: 0x1111, 0x1045: 0x1119, + 0x1046: 0x1121, 0x1047: 0x1129, 0x1048: 0x40c5, 0x1049: 0x1131, 0x104a: 0x1139, 0x104b: 0x1141, + 0x104c: 0x40e5, 0x104d: 0x40e5, 0x104e: 0x1149, 0x104f: 0x1151, 0x1050: 0x1159, 0x1051: 0x4105, + 0x1052: 0x4125, 0x1053: 0x4145, 0x1054: 0x4165, 0x1055: 0x4185, 0x1056: 0x1161, 0x1057: 0x1169, + 0x1058: 0x1171, 0x1059: 0x1179, 0x105a: 0x1181, 0x105b: 0x41a5, 0x105c: 0x1189, 0x105d: 0x1191, + 0x105e: 0x1199, 0x105f: 0x41c5, 0x1060: 0x41e5, 0x1061: 0x11a1, 0x1062: 0x4205, 0x1063: 0x4225, + 0x1064: 0x4245, 0x1065: 0x11a9, 0x1066: 0x4265, 0x1067: 0x11b1, 0x1068: 0x11b9, 0x1069: 0x10f9, + 0x106a: 0x4285, 0x106b: 0x42a5, 0x106c: 0x42c5, 0x106d: 0x42e5, 0x106e: 0x11c1, 0x106f: 0x11c9, + 0x1070: 0x11d1, 0x1071: 0x11d9, 0x1072: 0x4305, 0x1073: 0x11e1, 0x1074: 0x11e9, 0x1075: 0x11f1, + 0x1076: 0x4325, 0x1077: 0x11f9, 0x1078: 0x1201, 0x1079: 0x11f9, 0x107a: 0x1209, 0x107b: 0x1211, + 0x107c: 0x4345, 0x107d: 0x1219, 0x107e: 0x1221, 0x107f: 0x1219, + // Block 0x42, offset 0x1080 + 0x1080: 0x4365, 0x1081: 0x4385, 0x1082: 0x0040, 0x1083: 0x1229, 0x1084: 0x1231, 0x1085: 0x1239, + 0x1086: 0x1241, 0x1087: 0x0040, 0x1088: 0x1249, 0x1089: 0x1251, 0x108a: 0x1259, 0x108b: 0x1261, + 0x108c: 0x1269, 0x108d: 0x1271, 0x108e: 0x1199, 0x108f: 0x1279, 0x1090: 0x1281, 0x1091: 0x1289, + 0x1092: 0x43a5, 0x1093: 0x1291, 0x1094: 0x1121, 0x1095: 0x43c5, 0x1096: 0x43e5, 0x1097: 0x1299, + 0x1098: 0x0040, 0x1099: 0x4405, 0x109a: 0x12a1, 0x109b: 0x12a9, 0x109c: 0x12b1, 0x109d: 0x12b9, + 0x109e: 0x12c1, 0x109f: 0x12c9, 0x10a0: 0x12d1, 0x10a1: 0x12d9, 0x10a2: 0x12e1, 0x10a3: 0x12e9, + 0x10a4: 0x12f1, 0x10a5: 0x12f9, 0x10a6: 0x1301, 0x10a7: 0x1309, 0x10a8: 0x1311, 0x10a9: 0x1319, + 0x10aa: 0x1321, 0x10ab: 0x1329, 0x10ac: 0x1331, 0x10ad: 0x1339, 0x10ae: 0x1341, 0x10af: 0x1349, + 0x10b0: 0x1351, 0x10b1: 0x1359, 0x10b2: 0x1361, 0x10b3: 0x1369, 0x10b4: 0x1371, 0x10b5: 0x1379, + 0x10b6: 0x1381, 0x10b7: 0x1389, 0x10b8: 0x1391, 0x10b9: 0x1399, 0x10ba: 0x13a1, 0x10bb: 0x13a9, + 0x10bc: 0x13b1, 0x10bd: 0x13b9, 0x10be: 0x13c1, 0x10bf: 0x4425, + // Block 0x43, offset 0x10c0 + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0xe00d, 0x10dd: 0x0008, + 0x10de: 0xe00d, 0x10df: 0x0008, 0x10e0: 0xe00d, 0x10e1: 0x0008, 0x10e2: 0xe00d, 0x10e3: 0x0008, + 0x10e4: 0xe00d, 0x10e5: 0x0008, 0x10e6: 0xe00d, 0x10e7: 0x0008, 0x10e8: 0xe00d, 0x10e9: 0x0008, + 0x10ea: 0xe00d, 0x10eb: 0x0008, 0x10ec: 0xe00d, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x3308, + 0x10f0: 0x3318, 0x10f1: 0x3318, 0x10f2: 0x3318, 0x10f3: 0x0018, 0x10f4: 0x3308, 0x10f5: 0x3308, + 0x10f6: 0x3308, 0x10f7: 0x3308, 0x10f8: 0x3308, 0x10f9: 0x3308, 0x10fa: 0x3308, 0x10fb: 0x3308, + 0x10fc: 0x3308, 0x10fd: 0x3308, 0x10fe: 0x0018, 0x10ff: 0x0008, + // Block 0x44, offset 0x1100 + 0x1100: 0xe00d, 0x1101: 0x0008, 0x1102: 0xe00d, 0x1103: 0x0008, 0x1104: 0xe00d, 0x1105: 0x0008, + 0x1106: 0xe00d, 0x1107: 0x0008, 0x1108: 0xe00d, 0x1109: 0x0008, 0x110a: 0xe00d, 0x110b: 0x0008, + 0x110c: 0xe00d, 0x110d: 0x0008, 0x110e: 0xe00d, 0x110f: 0x0008, 0x1110: 0xe00d, 0x1111: 0x0008, + 0x1112: 0xe00d, 0x1113: 0x0008, 0x1114: 0xe00d, 0x1115: 0x0008, 0x1116: 0xe00d, 0x1117: 0x0008, + 0x1118: 0xe00d, 0x1119: 0x0008, 0x111a: 0xe00d, 0x111b: 0x0008, 0x111c: 0x02d1, 0x111d: 0x13c9, + 0x111e: 0x3308, 0x111f: 0x3308, 0x1120: 0x0008, 0x1121: 0x0008, 0x1122: 0x0008, 0x1123: 0x0008, + 0x1124: 0x0008, 0x1125: 0x0008, 0x1126: 0x0008, 0x1127: 0x0008, 0x1128: 0x0008, 0x1129: 0x0008, + 0x112a: 0x0008, 0x112b: 0x0008, 0x112c: 0x0008, 0x112d: 0x0008, 0x112e: 0x0008, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0x0008, 0x1133: 0x0008, 0x1134: 0x0008, 0x1135: 0x0008, + 0x1136: 0x0008, 0x1137: 0x0008, 0x1138: 0x0008, 0x1139: 0x0008, 0x113a: 0x0008, 0x113b: 0x0008, + 0x113c: 0x0008, 0x113d: 0x0008, 0x113e: 0x0008, 0x113f: 0x0008, + // Block 0x45, offset 0x1140 + 0x1140: 0x0018, 0x1141: 0x0018, 0x1142: 0x0018, 0x1143: 0x0018, 0x1144: 0x0018, 0x1145: 0x0018, + 0x1146: 0x0018, 0x1147: 0x0018, 0x1148: 0x0018, 0x1149: 0x0018, 0x114a: 0x0018, 0x114b: 0x0018, + 0x114c: 0x0018, 0x114d: 0x0018, 0x114e: 0x0018, 0x114f: 0x0018, 0x1150: 0x0018, 0x1151: 0x0018, + 0x1152: 0x0018, 0x1153: 0x0018, 0x1154: 0x0018, 0x1155: 0x0018, 0x1156: 0x0018, 0x1157: 0x0008, + 0x1158: 0x0008, 0x1159: 0x0008, 0x115a: 0x0008, 0x115b: 0x0008, 0x115c: 0x0008, 0x115d: 0x0008, + 0x115e: 0x0008, 0x115f: 0x0008, 0x1160: 0x0018, 0x1161: 0x0018, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0x0008, 0x1171: 0x0008, 0x1172: 0xe00d, 0x1173: 0x0008, 0x1174: 0xe00d, 0x1175: 0x0008, + 0x1176: 0xe00d, 0x1177: 0x0008, 0x1178: 0xe00d, 0x1179: 0x0008, 0x117a: 0xe00d, 0x117b: 0x0008, + 0x117c: 0xe00d, 0x117d: 0x0008, 0x117e: 0xe00d, 0x117f: 0x0008, + // Block 0x46, offset 0x1180 + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0xe00d, 0x1189: 0x0008, 0x118a: 0xe00d, 0x118b: 0x0008, + 0x118c: 0xe00d, 0x118d: 0x0008, 0x118e: 0xe00d, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0xe00d, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, + 0x11aa: 0xe00d, 0x11ab: 0x0008, 0x11ac: 0xe00d, 0x11ad: 0x0008, 0x11ae: 0xe00d, 0x11af: 0x0008, + 0x11b0: 0xe0fd, 0x11b1: 0x0008, 0x11b2: 0x0008, 0x11b3: 0x0008, 0x11b4: 0x0008, 0x11b5: 0x0008, + 0x11b6: 0x0008, 0x11b7: 0x0008, 0x11b8: 0x0008, 0x11b9: 0xe01d, 0x11ba: 0x0008, 0x11bb: 0xe03d, + 0x11bc: 0x0008, 0x11bd: 0x4445, 0x11be: 0xe00d, 0x11bf: 0x0008, + // Block 0x47, offset 0x11c0 + 0x11c0: 0xe00d, 0x11c1: 0x0008, 0x11c2: 0xe00d, 0x11c3: 0x0008, 0x11c4: 0xe00d, 0x11c5: 0x0008, + 0x11c6: 0xe00d, 0x11c7: 0x0008, 0x11c8: 0x0008, 0x11c9: 0x0018, 0x11ca: 0x0018, 0x11cb: 0xe03d, + 0x11cc: 0x0008, 0x11cd: 0x0409, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0xe00d, 0x11d1: 0x0008, + 0x11d2: 0xe00d, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x0008, 0x11d6: 0xe00d, 0x11d7: 0x0008, + 0x11d8: 0xe00d, 0x11d9: 0x0008, 0x11da: 0xe00d, 0x11db: 0x0008, 0x11dc: 0xe00d, 0x11dd: 0x0008, + 0x11de: 0xe00d, 0x11df: 0x0008, 0x11e0: 0xe00d, 0x11e1: 0x0008, 0x11e2: 0xe00d, 0x11e3: 0x0008, + 0x11e4: 0xe00d, 0x11e5: 0x0008, 0x11e6: 0xe00d, 0x11e7: 0x0008, 0x11e8: 0xe00d, 0x11e9: 0x0008, + 0x11ea: 0x13d1, 0x11eb: 0x0371, 0x11ec: 0x0401, 0x11ed: 0x13d9, 0x11ee: 0x0421, 0x11ef: 0x0008, + 0x11f0: 0x13e1, 0x11f1: 0x13e9, 0x11f2: 0x0429, 0x11f3: 0x4465, 0x11f4: 0xe00d, 0x11f5: 0x0008, + 0x11f6: 0xe00d, 0x11f7: 0x0008, 0x11f8: 0xe00d, 0x11f9: 0x0008, 0x11fa: 0xe00d, 0x11fb: 0x0008, + 0x11fc: 0xe00d, 0x11fd: 0x0008, 0x11fe: 0xe00d, 0x11ff: 0x0008, + // Block 0x48, offset 0x1200 + 0x1200: 0xe00d, 0x1201: 0x0008, 0x1202: 0xe00d, 0x1203: 0x0008, 0x1204: 0x03f5, 0x1205: 0x0479, + 0x1206: 0x447d, 0x1207: 0xe07d, 0x1208: 0x0008, 0x1209: 0xe01d, 0x120a: 0x0008, 0x120b: 0x0040, + 0x120c: 0x0040, 0x120d: 0x0040, 0x120e: 0x0040, 0x120f: 0x0040, 0x1210: 0xe00d, 0x1211: 0x0008, + 0x1212: 0x0040, 0x1213: 0x0008, 0x1214: 0x0040, 0x1215: 0x0008, 0x1216: 0xe00d, 0x1217: 0x0008, + 0x1218: 0xe00d, 0x1219: 0x0008, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x03d9, 0x1233: 0x03f1, 0x1234: 0x0751, 0x1235: 0xe01d, + 0x1236: 0x0008, 0x1237: 0x0008, 0x1238: 0x0741, 0x1239: 0x13f1, 0x123a: 0x0008, 0x123b: 0x0008, + 0x123c: 0x0008, 0x123d: 0x0008, 0x123e: 0x0008, 0x123f: 0x0008, + // Block 0x49, offset 0x1240 + 0x1240: 0x650d, 0x1241: 0x652d, 0x1242: 0x654d, 0x1243: 0x656d, 0x1244: 0x658d, 0x1245: 0x65ad, + 0x1246: 0x65cd, 0x1247: 0x65ed, 0x1248: 0x660d, 0x1249: 0x662d, 0x124a: 0x664d, 0x124b: 0x666d, + 0x124c: 0x668d, 0x124d: 0x66ad, 0x124e: 0x0008, 0x124f: 0x0008, 0x1250: 0x66cd, 0x1251: 0x0008, + 0x1252: 0x66ed, 0x1253: 0x0008, 0x1254: 0x0008, 0x1255: 0x670d, 0x1256: 0x672d, 0x1257: 0x674d, + 0x1258: 0x676d, 0x1259: 0x678d, 0x125a: 0x67ad, 0x125b: 0x67cd, 0x125c: 0x67ed, 0x125d: 0x680d, + 0x125e: 0x682d, 0x125f: 0x0008, 0x1260: 0x684d, 0x1261: 0x0008, 0x1262: 0x686d, 0x1263: 0x0008, + 0x1264: 0x0008, 0x1265: 0x688d, 0x1266: 0x68ad, 0x1267: 0x0008, 0x1268: 0x0008, 0x1269: 0x0008, + 0x126a: 0x68cd, 0x126b: 0x68ed, 0x126c: 0x690d, 0x126d: 0x692d, 0x126e: 0x694d, 0x126f: 0x696d, + 0x1270: 0x698d, 0x1271: 0x69ad, 0x1272: 0x69cd, 0x1273: 0x69ed, 0x1274: 0x6a0d, 0x1275: 0x6a2d, + 0x1276: 0x6a4d, 0x1277: 0x6a6d, 0x1278: 0x6a8d, 0x1279: 0x6aad, 0x127a: 0x6acd, 0x127b: 0x6aed, + 0x127c: 0x6b0d, 0x127d: 0x6b2d, 0x127e: 0x6b4d, 0x127f: 0x6b6d, + // Block 0x4a, offset 0x1280 + 0x1280: 0x7acd, 0x1281: 0x7aed, 0x1282: 0x7b0d, 0x1283: 0x7b2d, 0x1284: 0x7b4d, 0x1285: 0x7b6d, + 0x1286: 0x7b8d, 0x1287: 0x7bad, 0x1288: 0x7bcd, 0x1289: 0x7bed, 0x128a: 0x7c0d, 0x128b: 0x7c2d, + 0x128c: 0x7c4d, 0x128d: 0x7c6d, 0x128e: 0x7c8d, 0x128f: 0x1409, 0x1290: 0x1411, 0x1291: 0x1419, + 0x1292: 0x7cad, 0x1293: 0x7ccd, 0x1294: 0x7ced, 0x1295: 0x1421, 0x1296: 0x1429, 0x1297: 0x1431, + 0x1298: 0x7d0d, 0x1299: 0x7d2d, 0x129a: 0x0040, 0x129b: 0x0040, 0x129c: 0x0040, 0x129d: 0x0040, + 0x129e: 0x0040, 0x129f: 0x0040, 0x12a0: 0x0040, 0x12a1: 0x0040, 0x12a2: 0x0040, 0x12a3: 0x0040, + 0x12a4: 0x0040, 0x12a5: 0x0040, 0x12a6: 0x0040, 0x12a7: 0x0040, 0x12a8: 0x0040, 0x12a9: 0x0040, + 0x12aa: 0x0040, 0x12ab: 0x0040, 0x12ac: 0x0040, 0x12ad: 0x0040, 0x12ae: 0x0040, 0x12af: 0x0040, + 0x12b0: 0x0040, 0x12b1: 0x0040, 0x12b2: 0x0040, 0x12b3: 0x0040, 0x12b4: 0x0040, 0x12b5: 0x0040, + 0x12b6: 0x0040, 0x12b7: 0x0040, 0x12b8: 0x0040, 0x12b9: 0x0040, 0x12ba: 0x0040, 0x12bb: 0x0040, + 0x12bc: 0x0040, 0x12bd: 0x0040, 0x12be: 0x0040, 0x12bf: 0x0040, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x1439, 0x12c1: 0x1441, 0x12c2: 0x1449, 0x12c3: 0x7d4d, 0x12c4: 0x7d6d, 0x12c5: 0x1451, + 0x12c6: 0x1451, 0x12c7: 0x0040, 0x12c8: 0x0040, 0x12c9: 0x0040, 0x12ca: 0x0040, 0x12cb: 0x0040, + 0x12cc: 0x0040, 0x12cd: 0x0040, 0x12ce: 0x0040, 0x12cf: 0x0040, 0x12d0: 0x0040, 0x12d1: 0x0040, + 0x12d2: 0x0040, 0x12d3: 0x1459, 0x12d4: 0x1461, 0x12d5: 0x1469, 0x12d6: 0x1471, 0x12d7: 0x1479, + 0x12d8: 0x0040, 0x12d9: 0x0040, 0x12da: 0x0040, 0x12db: 0x0040, 0x12dc: 0x0040, 0x12dd: 0x1481, + 0x12de: 0x3308, 0x12df: 0x1489, 0x12e0: 0x1491, 0x12e1: 0x0779, 0x12e2: 0x0791, 0x12e3: 0x1499, + 0x12e4: 0x14a1, 0x12e5: 0x14a9, 0x12e6: 0x14b1, 0x12e7: 0x14b9, 0x12e8: 0x14c1, 0x12e9: 0x071a, + 0x12ea: 0x14c9, 0x12eb: 0x14d1, 0x12ec: 0x14d9, 0x12ed: 0x14e1, 0x12ee: 0x14e9, 0x12ef: 0x14f1, + 0x12f0: 0x14f9, 0x12f1: 0x1501, 0x12f2: 0x1509, 0x12f3: 0x1511, 0x12f4: 0x1519, 0x12f5: 0x1521, + 0x12f6: 0x1529, 0x12f7: 0x0040, 0x12f8: 0x1531, 0x12f9: 0x1539, 0x12fa: 0x1541, 0x12fb: 0x1549, + 0x12fc: 0x1551, 0x12fd: 0x0040, 0x12fe: 0x1559, 0x12ff: 0x0040, + // Block 0x4c, offset 0x1300 + 0x1300: 0x1561, 0x1301: 0x1569, 0x1302: 0x0040, 0x1303: 0x1571, 0x1304: 0x1579, 0x1305: 0x0040, + 0x1306: 0x1581, 0x1307: 0x1589, 0x1308: 0x1591, 0x1309: 0x1599, 0x130a: 0x15a1, 0x130b: 0x15a9, + 0x130c: 0x15b1, 0x130d: 0x15b9, 0x130e: 0x15c1, 0x130f: 0x15c9, 0x1310: 0x15d1, 0x1311: 0x15d1, + 0x1312: 0x15d9, 0x1313: 0x15d9, 0x1314: 0x15d9, 0x1315: 0x15d9, 0x1316: 0x15e1, 0x1317: 0x15e1, + 0x1318: 0x15e1, 0x1319: 0x15e1, 0x131a: 0x15e9, 0x131b: 0x15e9, 0x131c: 0x15e9, 0x131d: 0x15e9, + 0x131e: 0x15f1, 0x131f: 0x15f1, 0x1320: 0x15f1, 0x1321: 0x15f1, 0x1322: 0x15f9, 0x1323: 0x15f9, + 0x1324: 0x15f9, 0x1325: 0x15f9, 0x1326: 0x1601, 0x1327: 0x1601, 0x1328: 0x1601, 0x1329: 0x1601, + 0x132a: 0x1609, 0x132b: 0x1609, 0x132c: 0x1609, 0x132d: 0x1609, 0x132e: 0x1611, 0x132f: 0x1611, + 0x1330: 0x1611, 0x1331: 0x1611, 0x1332: 0x1619, 0x1333: 0x1619, 0x1334: 0x1619, 0x1335: 0x1619, + 0x1336: 0x1621, 0x1337: 0x1621, 0x1338: 0x1621, 0x1339: 0x1621, 0x133a: 0x1629, 0x133b: 0x1629, + 0x133c: 0x1629, 0x133d: 0x1629, 0x133e: 0x1631, 0x133f: 0x1631, + // Block 0x4d, offset 0x1340 + 0x1340: 0x1631, 0x1341: 0x1631, 0x1342: 0x1639, 0x1343: 0x1639, 0x1344: 0x1641, 0x1345: 0x1641, + 0x1346: 0x1649, 0x1347: 0x1649, 0x1348: 0x1651, 0x1349: 0x1651, 0x134a: 0x1659, 0x134b: 0x1659, + 0x134c: 0x1661, 0x134d: 0x1661, 0x134e: 0x1669, 0x134f: 0x1669, 0x1350: 0x1669, 0x1351: 0x1669, + 0x1352: 0x1671, 0x1353: 0x1671, 0x1354: 0x1671, 0x1355: 0x1671, 0x1356: 0x1679, 0x1357: 0x1679, + 0x1358: 0x1679, 0x1359: 0x1679, 0x135a: 0x1681, 0x135b: 0x1681, 0x135c: 0x1681, 0x135d: 0x1681, + 0x135e: 0x1689, 0x135f: 0x1689, 0x1360: 0x1691, 0x1361: 0x1691, 0x1362: 0x1691, 0x1363: 0x1691, + 0x1364: 0x1699, 0x1365: 0x1699, 0x1366: 0x16a1, 0x1367: 0x16a1, 0x1368: 0x16a1, 0x1369: 0x16a1, + 0x136a: 0x16a9, 0x136b: 0x16a9, 0x136c: 0x16a9, 0x136d: 0x16a9, 0x136e: 0x16b1, 0x136f: 0x16b1, + 0x1370: 0x16b9, 0x1371: 0x16b9, 0x1372: 0x0818, 0x1373: 0x0818, 0x1374: 0x0818, 0x1375: 0x0818, + 0x1376: 0x0818, 0x1377: 0x0818, 0x1378: 0x0818, 0x1379: 0x0818, 0x137a: 0x0818, 0x137b: 0x0818, + 0x137c: 0x0818, 0x137d: 0x0818, 0x137e: 0x0818, 0x137f: 0x0818, + // Block 0x4e, offset 0x1380 + 0x1380: 0x0818, 0x1381: 0x0818, 0x1382: 0x0818, 0x1383: 0x0040, 0x1384: 0x0040, 0x1385: 0x0040, + 0x1386: 0x0040, 0x1387: 0x0040, 0x1388: 0x0040, 0x1389: 0x0040, 0x138a: 0x0040, 0x138b: 0x0040, + 0x138c: 0x0040, 0x138d: 0x0040, 0x138e: 0x0040, 0x138f: 0x0040, 0x1390: 0x0040, 0x1391: 0x0040, + 0x1392: 0x0040, 0x1393: 0x16c1, 0x1394: 0x16c1, 0x1395: 0x16c1, 0x1396: 0x16c1, 0x1397: 0x16c9, + 0x1398: 0x16c9, 0x1399: 0x16d1, 0x139a: 0x16d1, 0x139b: 0x16d9, 0x139c: 0x16d9, 0x139d: 0x0149, + 0x139e: 0x16e1, 0x139f: 0x16e1, 0x13a0: 0x16e9, 0x13a1: 0x16e9, 0x13a2: 0x16f1, 0x13a3: 0x16f1, + 0x13a4: 0x16f9, 0x13a5: 0x16f9, 0x13a6: 0x16f9, 0x13a7: 0x16f9, 0x13a8: 0x1701, 0x13a9: 0x1701, + 0x13aa: 0x1709, 0x13ab: 0x1709, 0x13ac: 0x1711, 0x13ad: 0x1711, 0x13ae: 0x1719, 0x13af: 0x1719, + 0x13b0: 0x1721, 0x13b1: 0x1721, 0x13b2: 0x1729, 0x13b3: 0x1729, 0x13b4: 0x1731, 0x13b5: 0x1731, + 0x13b6: 0x1739, 0x13b7: 0x1739, 0x13b8: 0x1739, 0x13b9: 0x1741, 0x13ba: 0x1741, 0x13bb: 0x1741, + 0x13bc: 0x1749, 0x13bd: 0x1749, 0x13be: 0x1749, 0x13bf: 0x1749, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x1949, 0x13c1: 0x1951, 0x13c2: 0x1959, 0x13c3: 0x1961, 0x13c4: 0x1969, 0x13c5: 0x1971, + 0x13c6: 0x1979, 0x13c7: 0x1981, 0x13c8: 0x1989, 0x13c9: 0x1991, 0x13ca: 0x1999, 0x13cb: 0x19a1, + 0x13cc: 0x19a9, 0x13cd: 0x19b1, 0x13ce: 0x19b9, 0x13cf: 0x19c1, 0x13d0: 0x19c9, 0x13d1: 0x19d1, + 0x13d2: 0x19d9, 0x13d3: 0x19e1, 0x13d4: 0x19e9, 0x13d5: 0x19f1, 0x13d6: 0x19f9, 0x13d7: 0x1a01, + 0x13d8: 0x1a09, 0x13d9: 0x1a11, 0x13da: 0x1a19, 0x13db: 0x1a21, 0x13dc: 0x1a29, 0x13dd: 0x1a31, + 0x13de: 0x1a3a, 0x13df: 0x1a42, 0x13e0: 0x1a4a, 0x13e1: 0x1a52, 0x13e2: 0x1a5a, 0x13e3: 0x1a62, + 0x13e4: 0x1a69, 0x13e5: 0x1a71, 0x13e6: 0x1761, 0x13e7: 0x1a79, 0x13e8: 0x1741, 0x13e9: 0x1769, + 0x13ea: 0x1a81, 0x13eb: 0x1a89, 0x13ec: 0x1789, 0x13ed: 0x1a91, 0x13ee: 0x1791, 0x13ef: 0x1799, + 0x13f0: 0x1a99, 0x13f1: 0x1aa1, 0x13f2: 0x17b9, 0x13f3: 0x1aa9, 0x13f4: 0x17c1, 0x13f5: 0x17c9, + 0x13f6: 0x1ab1, 0x13f7: 0x1ab9, 0x13f8: 0x17d9, 0x13f9: 0x1ac1, 0x13fa: 0x17e1, 0x13fb: 0x17e9, + 0x13fc: 0x18d1, 0x13fd: 0x18d9, 0x13fe: 0x18f1, 0x13ff: 0x18f9, + // Block 0x50, offset 0x1400 + 0x1400: 0x1901, 0x1401: 0x1921, 0x1402: 0x1929, 0x1403: 0x1931, 0x1404: 0x1939, 0x1405: 0x1959, + 0x1406: 0x1961, 0x1407: 0x1969, 0x1408: 0x1ac9, 0x1409: 0x1989, 0x140a: 0x1ad1, 0x140b: 0x1ad9, + 0x140c: 0x19b9, 0x140d: 0x1ae1, 0x140e: 0x19c1, 0x140f: 0x19c9, 0x1410: 0x1a31, 0x1411: 0x1ae9, + 0x1412: 0x1af1, 0x1413: 0x1a09, 0x1414: 0x1af9, 0x1415: 0x1a11, 0x1416: 0x1a19, 0x1417: 0x1751, + 0x1418: 0x1759, 0x1419: 0x1b01, 0x141a: 0x1761, 0x141b: 0x1b09, 0x141c: 0x1771, 0x141d: 0x1779, + 0x141e: 0x1781, 0x141f: 0x1789, 0x1420: 0x1b11, 0x1421: 0x17a1, 0x1422: 0x17a9, 0x1423: 0x17b1, + 0x1424: 0x17b9, 0x1425: 0x1b19, 0x1426: 0x17d9, 0x1427: 0x17f1, 0x1428: 0x17f9, 0x1429: 0x1801, + 0x142a: 0x1809, 0x142b: 0x1811, 0x142c: 0x1821, 0x142d: 0x1829, 0x142e: 0x1831, 0x142f: 0x1839, + 0x1430: 0x1841, 0x1431: 0x1849, 0x1432: 0x1b21, 0x1433: 0x1851, 0x1434: 0x1859, 0x1435: 0x1861, + 0x1436: 0x1869, 0x1437: 0x1871, 0x1438: 0x1879, 0x1439: 0x1889, 0x143a: 0x1891, 0x143b: 0x1899, + 0x143c: 0x18a1, 0x143d: 0x18a9, 0x143e: 0x18b1, 0x143f: 0x18b9, + // Block 0x51, offset 0x1440 + 0x1440: 0x18c1, 0x1441: 0x18c9, 0x1442: 0x18e1, 0x1443: 0x18e9, 0x1444: 0x1909, 0x1445: 0x1911, + 0x1446: 0x1919, 0x1447: 0x1921, 0x1448: 0x1929, 0x1449: 0x1941, 0x144a: 0x1949, 0x144b: 0x1951, + 0x144c: 0x1959, 0x144d: 0x1b29, 0x144e: 0x1971, 0x144f: 0x1979, 0x1450: 0x1981, 0x1451: 0x1989, + 0x1452: 0x19a1, 0x1453: 0x19a9, 0x1454: 0x19b1, 0x1455: 0x19b9, 0x1456: 0x1b31, 0x1457: 0x19d1, + 0x1458: 0x19d9, 0x1459: 0x1b39, 0x145a: 0x19f1, 0x145b: 0x19f9, 0x145c: 0x1a01, 0x145d: 0x1a09, + 0x145e: 0x1b41, 0x145f: 0x1761, 0x1460: 0x1b09, 0x1461: 0x1789, 0x1462: 0x1b11, 0x1463: 0x17b9, + 0x1464: 0x1b19, 0x1465: 0x17d9, 0x1466: 0x1b49, 0x1467: 0x1841, 0x1468: 0x1b51, 0x1469: 0x1b59, + 0x146a: 0x1b61, 0x146b: 0x1921, 0x146c: 0x1929, 0x146d: 0x1959, 0x146e: 0x19b9, 0x146f: 0x1b31, + 0x1470: 0x1a09, 0x1471: 0x1b41, 0x1472: 0x1b69, 0x1473: 0x1b71, 0x1474: 0x1b79, 0x1475: 0x1b81, + 0x1476: 0x1b89, 0x1477: 0x1b91, 0x1478: 0x1b99, 0x1479: 0x1ba1, 0x147a: 0x1ba9, 0x147b: 0x1bb1, + 0x147c: 0x1bb9, 0x147d: 0x1bc1, 0x147e: 0x1bc9, 0x147f: 0x1bd1, + // Block 0x52, offset 0x1480 + 0x1480: 0x1bd9, 0x1481: 0x1be1, 0x1482: 0x1be9, 0x1483: 0x1bf1, 0x1484: 0x1bf9, 0x1485: 0x1c01, + 0x1486: 0x1c09, 0x1487: 0x1c11, 0x1488: 0x1c19, 0x1489: 0x1c21, 0x148a: 0x1c29, 0x148b: 0x1c31, + 0x148c: 0x1b59, 0x148d: 0x1c39, 0x148e: 0x1c41, 0x148f: 0x1c49, 0x1490: 0x1c51, 0x1491: 0x1b81, + 0x1492: 0x1b89, 0x1493: 0x1b91, 0x1494: 0x1b99, 0x1495: 0x1ba1, 0x1496: 0x1ba9, 0x1497: 0x1bb1, + 0x1498: 0x1bb9, 0x1499: 0x1bc1, 0x149a: 0x1bc9, 0x149b: 0x1bd1, 0x149c: 0x1bd9, 0x149d: 0x1be1, + 0x149e: 0x1be9, 0x149f: 0x1bf1, 0x14a0: 0x1bf9, 0x14a1: 0x1c01, 0x14a2: 0x1c09, 0x14a3: 0x1c11, + 0x14a4: 0x1c19, 0x14a5: 0x1c21, 0x14a6: 0x1c29, 0x14a7: 0x1c31, 0x14a8: 0x1b59, 0x14a9: 0x1c39, + 0x14aa: 0x1c41, 0x14ab: 0x1c49, 0x14ac: 0x1c51, 0x14ad: 0x1c21, 0x14ae: 0x1c29, 0x14af: 0x1c31, + 0x14b0: 0x1b59, 0x14b1: 0x1b51, 0x14b2: 0x1b61, 0x14b3: 0x1881, 0x14b4: 0x1829, 0x14b5: 0x1831, + 0x14b6: 0x1839, 0x14b7: 0x1c21, 0x14b8: 0x1c29, 0x14b9: 0x1c31, 0x14ba: 0x1881, 0x14bb: 0x1889, + 0x14bc: 0x1c59, 0x14bd: 0x1c59, 0x14be: 0x0018, 0x14bf: 0x0018, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0018, 0x14c1: 0x0018, 0x14c2: 0x0018, 0x14c3: 0x0018, 0x14c4: 0x0018, 0x14c5: 0x0018, + 0x14c6: 0x0018, 0x14c7: 0x0018, 0x14c8: 0x0018, 0x14c9: 0x0018, 0x14ca: 0x0018, 0x14cb: 0x0018, + 0x14cc: 0x0018, 0x14cd: 0x0018, 0x14ce: 0x0018, 0x14cf: 0x0018, 0x14d0: 0x1c61, 0x14d1: 0x1c69, + 0x14d2: 0x1c69, 0x14d3: 0x1c71, 0x14d4: 0x1c79, 0x14d5: 0x1c81, 0x14d6: 0x1c89, 0x14d7: 0x1c91, + 0x14d8: 0x1c99, 0x14d9: 0x1c99, 0x14da: 0x1ca1, 0x14db: 0x1ca9, 0x14dc: 0x1cb1, 0x14dd: 0x1cb9, + 0x14de: 0x1cc1, 0x14df: 0x1cc9, 0x14e0: 0x1cc9, 0x14e1: 0x1cd1, 0x14e2: 0x1cd9, 0x14e3: 0x1cd9, + 0x14e4: 0x1ce1, 0x14e5: 0x1ce1, 0x14e6: 0x1ce9, 0x14e7: 0x1cf1, 0x14e8: 0x1cf1, 0x14e9: 0x1cf9, + 0x14ea: 0x1d01, 0x14eb: 0x1d01, 0x14ec: 0x1d09, 0x14ed: 0x1d09, 0x14ee: 0x1d11, 0x14ef: 0x1d19, + 0x14f0: 0x1d19, 0x14f1: 0x1d21, 0x14f2: 0x1d21, 0x14f3: 0x1d29, 0x14f4: 0x1d31, 0x14f5: 0x1d39, + 0x14f6: 0x1d41, 0x14f7: 0x1d41, 0x14f8: 0x1d49, 0x14f9: 0x1d51, 0x14fa: 0x1d59, 0x14fb: 0x1d61, + 0x14fc: 0x1d69, 0x14fd: 0x1d69, 0x14fe: 0x1d71, 0x14ff: 0x1d79, + // Block 0x54, offset 0x1500 + 0x1500: 0x1f29, 0x1501: 0x1f31, 0x1502: 0x1f39, 0x1503: 0x1f11, 0x1504: 0x1d39, 0x1505: 0x1ce9, + 0x1506: 0x1f41, 0x1507: 0x1f49, 0x1508: 0x0040, 0x1509: 0x0040, 0x150a: 0x0040, 0x150b: 0x0040, + 0x150c: 0x0040, 0x150d: 0x0040, 0x150e: 0x0040, 0x150f: 0x0018, 0x1510: 0x0040, 0x1511: 0x0040, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0040, 0x1515: 0x0040, 0x1516: 0x0040, 0x1517: 0x0040, + 0x1518: 0x0040, 0x1519: 0x0040, 0x151a: 0x0040, 0x151b: 0x0040, 0x151c: 0x0040, 0x151d: 0x0040, + 0x151e: 0x0040, 0x151f: 0x0040, 0x1520: 0x0040, 0x1521: 0x0040, 0x1522: 0x0040, 0x1523: 0x0040, + 0x1524: 0x0040, 0x1525: 0x0040, 0x1526: 0x0040, 0x1527: 0x0040, 0x1528: 0x0040, 0x1529: 0x0040, + 0x152a: 0x0040, 0x152b: 0x0040, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x1f51, 0x1531: 0x1f59, 0x1532: 0x1f61, 0x1533: 0x1f69, 0x1534: 0x1f71, 0x1535: 0x1f79, + 0x1536: 0x1f81, 0x1537: 0x1f89, 0x1538: 0x1f91, 0x1539: 0x1f99, 0x153a: 0x1fa2, 0x153b: 0x1faa, + 0x153c: 0x1fb1, 0x153d: 0x0018, 0x153e: 0x0018, 0x153f: 0x0018, + // Block 0x55, offset 0x1540 + 0x1540: 0x33c0, 0x1541: 0x33c0, 0x1542: 0x33c0, 0x1543: 0x33c0, 0x1544: 0x33c0, 0x1545: 0x33c0, + 0x1546: 0x33c0, 0x1547: 0x33c0, 0x1548: 0x33c0, 0x1549: 0x33c0, 0x154a: 0x33c0, 0x154b: 0x33c0, + 0x154c: 0x33c0, 0x154d: 0x33c0, 0x154e: 0x33c0, 0x154f: 0x33c0, 0x1550: 0x1fba, 0x1551: 0x7d8d, + 0x1552: 0x0040, 0x1553: 0x1fc2, 0x1554: 0x0122, 0x1555: 0x1fca, 0x1556: 0x1fd2, 0x1557: 0x7dad, + 0x1558: 0x7dcd, 0x1559: 0x0040, 0x155a: 0x0040, 0x155b: 0x0040, 0x155c: 0x0040, 0x155d: 0x0040, + 0x155e: 0x0040, 0x155f: 0x0040, 0x1560: 0x3308, 0x1561: 0x3308, 0x1562: 0x3308, 0x1563: 0x3308, + 0x1564: 0x3308, 0x1565: 0x3308, 0x1566: 0x3308, 0x1567: 0x3308, 0x1568: 0x3308, 0x1569: 0x3308, + 0x156a: 0x3308, 0x156b: 0x3308, 0x156c: 0x3308, 0x156d: 0x3308, 0x156e: 0x3308, 0x156f: 0x3308, + 0x1570: 0x0040, 0x1571: 0x7ded, 0x1572: 0x7e0d, 0x1573: 0x1fda, 0x1574: 0x1fda, 0x1575: 0x072a, + 0x1576: 0x0732, 0x1577: 0x1fe2, 0x1578: 0x1fea, 0x1579: 0x7e2d, 0x157a: 0x7e4d, 0x157b: 0x7e6d, + 0x157c: 0x7e2d, 0x157d: 0x7e8d, 0x157e: 0x7ead, 0x157f: 0x7e8d, + // Block 0x56, offset 0x1580 + 0x1580: 0x7ecd, 0x1581: 0x7eed, 0x1582: 0x7f0d, 0x1583: 0x7eed, 0x1584: 0x7f2d, 0x1585: 0x0018, + 0x1586: 0x0018, 0x1587: 0x1ff2, 0x1588: 0x1ffa, 0x1589: 0x7f4e, 0x158a: 0x7f6e, 0x158b: 0x7f8e, + 0x158c: 0x7fae, 0x158d: 0x1fda, 0x158e: 0x1fda, 0x158f: 0x1fda, 0x1590: 0x1fba, 0x1591: 0x7fcd, + 0x1592: 0x0040, 0x1593: 0x0040, 0x1594: 0x0122, 0x1595: 0x1fc2, 0x1596: 0x1fd2, 0x1597: 0x1fca, + 0x1598: 0x7fed, 0x1599: 0x072a, 0x159a: 0x0732, 0x159b: 0x1fe2, 0x159c: 0x1fea, 0x159d: 0x7ecd, + 0x159e: 0x7f2d, 0x159f: 0x2002, 0x15a0: 0x200a, 0x15a1: 0x2012, 0x15a2: 0x071a, 0x15a3: 0x2019, + 0x15a4: 0x2022, 0x15a5: 0x202a, 0x15a6: 0x0722, 0x15a7: 0x0040, 0x15a8: 0x2032, 0x15a9: 0x203a, + 0x15aa: 0x2042, 0x15ab: 0x204a, 0x15ac: 0x0040, 0x15ad: 0x0040, 0x15ae: 0x0040, 0x15af: 0x0040, + 0x15b0: 0x800e, 0x15b1: 0x2051, 0x15b2: 0x802e, 0x15b3: 0x0808, 0x15b4: 0x804e, 0x15b5: 0x0040, + 0x15b6: 0x806e, 0x15b7: 0x2059, 0x15b8: 0x808e, 0x15b9: 0x2061, 0x15ba: 0x80ae, 0x15bb: 0x2069, + 0x15bc: 0x80ce, 0x15bd: 0x2071, 0x15be: 0x80ee, 0x15bf: 0x2079, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x2081, 0x15c1: 0x2089, 0x15c2: 0x2089, 0x15c3: 0x2091, 0x15c4: 0x2091, 0x15c5: 0x2099, + 0x15c6: 0x2099, 0x15c7: 0x20a1, 0x15c8: 0x20a1, 0x15c9: 0x20a9, 0x15ca: 0x20a9, 0x15cb: 0x20a9, + 0x15cc: 0x20a9, 0x15cd: 0x20b1, 0x15ce: 0x20b1, 0x15cf: 0x20b9, 0x15d0: 0x20b9, 0x15d1: 0x20b9, + 0x15d2: 0x20b9, 0x15d3: 0x20c1, 0x15d4: 0x20c1, 0x15d5: 0x20c9, 0x15d6: 0x20c9, 0x15d7: 0x20c9, + 0x15d8: 0x20c9, 0x15d9: 0x20d1, 0x15da: 0x20d1, 0x15db: 0x20d1, 0x15dc: 0x20d1, 0x15dd: 0x20d9, + 0x15de: 0x20d9, 0x15df: 0x20d9, 0x15e0: 0x20d9, 0x15e1: 0x20e1, 0x15e2: 0x20e1, 0x15e3: 0x20e1, + 0x15e4: 0x20e1, 0x15e5: 0x20e9, 0x15e6: 0x20e9, 0x15e7: 0x20e9, 0x15e8: 0x20e9, 0x15e9: 0x20f1, + 0x15ea: 0x20f1, 0x15eb: 0x20f9, 0x15ec: 0x20f9, 0x15ed: 0x2101, 0x15ee: 0x2101, 0x15ef: 0x2109, + 0x15f0: 0x2109, 0x15f1: 0x2111, 0x15f2: 0x2111, 0x15f3: 0x2111, 0x15f4: 0x2111, 0x15f5: 0x2119, + 0x15f6: 0x2119, 0x15f7: 0x2119, 0x15f8: 0x2119, 0x15f9: 0x2121, 0x15fa: 0x2121, 0x15fb: 0x2121, + 0x15fc: 0x2121, 0x15fd: 0x2129, 0x15fe: 0x2129, 0x15ff: 0x2129, + // Block 0x58, offset 0x1600 + 0x1600: 0x2129, 0x1601: 0x2131, 0x1602: 0x2131, 0x1603: 0x2131, 0x1604: 0x2131, 0x1605: 0x2139, + 0x1606: 0x2139, 0x1607: 0x2139, 0x1608: 0x2139, 0x1609: 0x2141, 0x160a: 0x2141, 0x160b: 0x2141, + 0x160c: 0x2141, 0x160d: 0x2149, 0x160e: 0x2149, 0x160f: 0x2149, 0x1610: 0x2149, 0x1611: 0x2151, + 0x1612: 0x2151, 0x1613: 0x2151, 0x1614: 0x2151, 0x1615: 0x2159, 0x1616: 0x2159, 0x1617: 0x2159, + 0x1618: 0x2159, 0x1619: 0x2161, 0x161a: 0x2161, 0x161b: 0x2161, 0x161c: 0x2161, 0x161d: 0x2169, + 0x161e: 0x2169, 0x161f: 0x2169, 0x1620: 0x2169, 0x1621: 0x2171, 0x1622: 0x2171, 0x1623: 0x2171, + 0x1624: 0x2171, 0x1625: 0x2179, 0x1626: 0x2179, 0x1627: 0x2179, 0x1628: 0x2179, 0x1629: 0x2181, + 0x162a: 0x2181, 0x162b: 0x2181, 0x162c: 0x2181, 0x162d: 0x2189, 0x162e: 0x2189, 0x162f: 0x1701, + 0x1630: 0x1701, 0x1631: 0x2191, 0x1632: 0x2191, 0x1633: 0x2191, 0x1634: 0x2191, 0x1635: 0x2199, + 0x1636: 0x2199, 0x1637: 0x21a1, 0x1638: 0x21a1, 0x1639: 0x21a9, 0x163a: 0x21a9, 0x163b: 0x21b1, + 0x163c: 0x21b1, 0x163d: 0x0040, 0x163e: 0x0040, 0x163f: 0x03c0, + // Block 0x59, offset 0x1640 + 0x1640: 0x0040, 0x1641: 0x1fca, 0x1642: 0x21ba, 0x1643: 0x2002, 0x1644: 0x203a, 0x1645: 0x2042, + 0x1646: 0x200a, 0x1647: 0x21c2, 0x1648: 0x072a, 0x1649: 0x0732, 0x164a: 0x2012, 0x164b: 0x071a, + 0x164c: 0x1fba, 0x164d: 0x2019, 0x164e: 0x0961, 0x164f: 0x21ca, 0x1650: 0x06e1, 0x1651: 0x0049, + 0x1652: 0x0029, 0x1653: 0x0031, 0x1654: 0x06e9, 0x1655: 0x06f1, 0x1656: 0x06f9, 0x1657: 0x0701, + 0x1658: 0x0709, 0x1659: 0x0711, 0x165a: 0x1fc2, 0x165b: 0x0122, 0x165c: 0x2022, 0x165d: 0x0722, + 0x165e: 0x202a, 0x165f: 0x1fd2, 0x1660: 0x204a, 0x1661: 0x0019, 0x1662: 0x02e9, 0x1663: 0x03d9, + 0x1664: 0x02f1, 0x1665: 0x02f9, 0x1666: 0x03f1, 0x1667: 0x0309, 0x1668: 0x00a9, 0x1669: 0x0311, + 0x166a: 0x00b1, 0x166b: 0x0319, 0x166c: 0x0101, 0x166d: 0x0321, 0x166e: 0x0329, 0x166f: 0x0051, + 0x1670: 0x0339, 0x1671: 0x0751, 0x1672: 0x00b9, 0x1673: 0x0089, 0x1674: 0x0341, 0x1675: 0x0349, + 0x1676: 0x0391, 0x1677: 0x00c1, 0x1678: 0x0109, 0x1679: 0x00c9, 0x167a: 0x04b1, 0x167b: 0x1ff2, + 0x167c: 0x2032, 0x167d: 0x1ffa, 0x167e: 0x21d2, 0x167f: 0x1fda, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0672, 0x1681: 0x0019, 0x1682: 0x02e9, 0x1683: 0x03d9, 0x1684: 0x02f1, 0x1685: 0x02f9, + 0x1686: 0x03f1, 0x1687: 0x0309, 0x1688: 0x00a9, 0x1689: 0x0311, 0x168a: 0x00b1, 0x168b: 0x0319, + 0x168c: 0x0101, 0x168d: 0x0321, 0x168e: 0x0329, 0x168f: 0x0051, 0x1690: 0x0339, 0x1691: 0x0751, + 0x1692: 0x00b9, 0x1693: 0x0089, 0x1694: 0x0341, 0x1695: 0x0349, 0x1696: 0x0391, 0x1697: 0x00c1, + 0x1698: 0x0109, 0x1699: 0x00c9, 0x169a: 0x04b1, 0x169b: 0x1fe2, 0x169c: 0x21da, 0x169d: 0x1fea, + 0x169e: 0x21e2, 0x169f: 0x810d, 0x16a0: 0x812d, 0x16a1: 0x0961, 0x16a2: 0x814d, 0x16a3: 0x814d, + 0x16a4: 0x816d, 0x16a5: 0x818d, 0x16a6: 0x81ad, 0x16a7: 0x81cd, 0x16a8: 0x81ed, 0x16a9: 0x820d, + 0x16aa: 0x822d, 0x16ab: 0x824d, 0x16ac: 0x826d, 0x16ad: 0x828d, 0x16ae: 0x82ad, 0x16af: 0x82cd, + 0x16b0: 0x82ed, 0x16b1: 0x830d, 0x16b2: 0x832d, 0x16b3: 0x834d, 0x16b4: 0x836d, 0x16b5: 0x838d, + 0x16b6: 0x83ad, 0x16b7: 0x83cd, 0x16b8: 0x83ed, 0x16b9: 0x840d, 0x16ba: 0x842d, 0x16bb: 0x844d, + 0x16bc: 0x81ed, 0x16bd: 0x846d, 0x16be: 0x848d, 0x16bf: 0x824d, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x84ad, 0x16c1: 0x84cd, 0x16c2: 0x84ed, 0x16c3: 0x850d, 0x16c4: 0x852d, 0x16c5: 0x854d, + 0x16c6: 0x856d, 0x16c7: 0x858d, 0x16c8: 0x850d, 0x16c9: 0x85ad, 0x16ca: 0x850d, 0x16cb: 0x85cd, + 0x16cc: 0x85cd, 0x16cd: 0x85ed, 0x16ce: 0x85ed, 0x16cf: 0x860d, 0x16d0: 0x854d, 0x16d1: 0x862d, + 0x16d2: 0x864d, 0x16d3: 0x862d, 0x16d4: 0x866d, 0x16d5: 0x864d, 0x16d6: 0x868d, 0x16d7: 0x868d, + 0x16d8: 0x86ad, 0x16d9: 0x86ad, 0x16da: 0x86cd, 0x16db: 0x86cd, 0x16dc: 0x864d, 0x16dd: 0x814d, + 0x16de: 0x86ed, 0x16df: 0x870d, 0x16e0: 0x0040, 0x16e1: 0x872d, 0x16e2: 0x874d, 0x16e3: 0x876d, + 0x16e4: 0x878d, 0x16e5: 0x876d, 0x16e6: 0x87ad, 0x16e7: 0x87cd, 0x16e8: 0x87ed, 0x16e9: 0x87ed, + 0x16ea: 0x880d, 0x16eb: 0x880d, 0x16ec: 0x882d, 0x16ed: 0x882d, 0x16ee: 0x880d, 0x16ef: 0x880d, + 0x16f0: 0x884d, 0x16f1: 0x886d, 0x16f2: 0x888d, 0x16f3: 0x88ad, 0x16f4: 0x88cd, 0x16f5: 0x88ed, + 0x16f6: 0x88ed, 0x16f7: 0x88ed, 0x16f8: 0x890d, 0x16f9: 0x890d, 0x16fa: 0x890d, 0x16fb: 0x890d, + 0x16fc: 0x87ed, 0x16fd: 0x87ed, 0x16fe: 0x87ed, 0x16ff: 0x0040, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0040, 0x1701: 0x0040, 0x1702: 0x874d, 0x1703: 0x872d, 0x1704: 0x892d, 0x1705: 0x872d, + 0x1706: 0x874d, 0x1707: 0x872d, 0x1708: 0x0040, 0x1709: 0x0040, 0x170a: 0x894d, 0x170b: 0x874d, + 0x170c: 0x896d, 0x170d: 0x892d, 0x170e: 0x896d, 0x170f: 0x874d, 0x1710: 0x0040, 0x1711: 0x0040, + 0x1712: 0x898d, 0x1713: 0x89ad, 0x1714: 0x88ad, 0x1715: 0x896d, 0x1716: 0x892d, 0x1717: 0x896d, + 0x1718: 0x0040, 0x1719: 0x0040, 0x171a: 0x89cd, 0x171b: 0x89ed, 0x171c: 0x89cd, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x21e9, 0x1721: 0x21f1, 0x1722: 0x21f9, 0x1723: 0x8a0e, + 0x1724: 0x2201, 0x1725: 0x2209, 0x1726: 0x8a2d, 0x1727: 0x0040, 0x1728: 0x8a4d, 0x1729: 0x8a6d, + 0x172a: 0x8a8d, 0x172b: 0x8a6d, 0x172c: 0x8aad, 0x172d: 0x8acd, 0x172e: 0x8aed, 0x172f: 0x0040, + 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0340, 0x173a: 0x0340, 0x173b: 0x0340, + 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, + // Block 0x5d, offset 0x1740 + 0x1740: 0x0008, 0x1741: 0x0008, 0x1742: 0x0008, 0x1743: 0x0008, 0x1744: 0x0008, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0008, 0x174e: 0x0008, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0008, + 0x1752: 0x0008, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0040, 0x1765: 0x0040, 0x1766: 0x0040, 0x1767: 0x0040, 0x1768: 0x0040, 0x1769: 0x0040, + 0x176a: 0x0040, 0x176b: 0x0040, 0x176c: 0x0040, 0x176d: 0x0040, 0x176e: 0x0040, 0x176f: 0x0018, + 0x1770: 0x8b3d, 0x1771: 0x8b55, 0x1772: 0x8b6d, 0x1773: 0x8b55, 0x1774: 0x8b85, 0x1775: 0x8b55, + 0x1776: 0x8b6d, 0x1777: 0x8b55, 0x1778: 0x8b3d, 0x1779: 0x8b9d, 0x177a: 0x8bb5, 0x177b: 0x0040, + 0x177c: 0x8bcd, 0x177d: 0x8b9d, 0x177e: 0x8bb5, 0x177f: 0x8b9d, + // Block 0x5e, offset 0x1780 + 0x1780: 0xe13d, 0x1781: 0xe14d, 0x1782: 0xe15d, 0x1783: 0xe14d, 0x1784: 0xe17d, 0x1785: 0xe14d, + 0x1786: 0xe15d, 0x1787: 0xe14d, 0x1788: 0xe13d, 0x1789: 0xe1cd, 0x178a: 0xe1dd, 0x178b: 0x0040, + 0x178c: 0xe1fd, 0x178d: 0xe1cd, 0x178e: 0xe1dd, 0x178f: 0xe1cd, 0x1790: 0xe13d, 0x1791: 0xe14d, + 0x1792: 0xe15d, 0x1793: 0x0040, 0x1794: 0xe17d, 0x1795: 0xe14d, 0x1796: 0x0040, 0x1797: 0x0008, + 0x1798: 0x0008, 0x1799: 0x0008, 0x179a: 0x0008, 0x179b: 0x0008, 0x179c: 0x0008, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x0040, 0x17a3: 0x0008, + 0x17a4: 0x0008, 0x17a5: 0x0008, 0x17a6: 0x0008, 0x17a7: 0x0008, 0x17a8: 0x0008, 0x17a9: 0x0008, + 0x17aa: 0x0008, 0x17ab: 0x0008, 0x17ac: 0x0008, 0x17ad: 0x0008, 0x17ae: 0x0008, 0x17af: 0x0008, + 0x17b0: 0x0008, 0x17b1: 0x0008, 0x17b2: 0x0040, 0x17b3: 0x0008, 0x17b4: 0x0008, 0x17b5: 0x0008, + 0x17b6: 0x0008, 0x17b7: 0x0008, 0x17b8: 0x0008, 0x17b9: 0x0008, 0x17ba: 0x0040, 0x17bb: 0x0008, + 0x17bc: 0x0008, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x0008, 0x17c1: 0x2211, 0x17c2: 0x2219, 0x17c3: 0x02e1, 0x17c4: 0x2221, 0x17c5: 0x2229, + 0x17c6: 0x0040, 0x17c7: 0x2231, 0x17c8: 0x2239, 0x17c9: 0x2241, 0x17ca: 0x2249, 0x17cb: 0x2251, + 0x17cc: 0x2259, 0x17cd: 0x2261, 0x17ce: 0x2269, 0x17cf: 0x2271, 0x17d0: 0x2279, 0x17d1: 0x2281, + 0x17d2: 0x2289, 0x17d3: 0x2291, 0x17d4: 0x2299, 0x17d5: 0x0741, 0x17d6: 0x22a1, 0x17d7: 0x22a9, + 0x17d8: 0x22b1, 0x17d9: 0x22b9, 0x17da: 0x22c1, 0x17db: 0x13d9, 0x17dc: 0x8be5, 0x17dd: 0x22c9, + 0x17de: 0x22d1, 0x17df: 0x8c05, 0x17e0: 0x22d9, 0x17e1: 0x8c25, 0x17e2: 0x22e1, 0x17e3: 0x22e9, + 0x17e4: 0x22f1, 0x17e5: 0x0751, 0x17e6: 0x22f9, 0x17e7: 0x8c45, 0x17e8: 0x0949, 0x17e9: 0x2301, + 0x17ea: 0x2309, 0x17eb: 0x2311, 0x17ec: 0x2319, 0x17ed: 0x2321, 0x17ee: 0x2329, 0x17ef: 0x2331, + 0x17f0: 0x2339, 0x17f1: 0x0040, 0x17f2: 0x2341, 0x17f3: 0x2349, 0x17f4: 0x2351, 0x17f5: 0x2359, + 0x17f6: 0x2361, 0x17f7: 0x2369, 0x17f8: 0x2371, 0x17f9: 0x8c65, 0x17fa: 0x8c85, 0x17fb: 0x0040, + 0x17fc: 0x0040, 0x17fd: 0x0040, 0x17fe: 0x0040, 0x17ff: 0x0040, + // Block 0x60, offset 0x1800 + 0x1800: 0x0a08, 0x1801: 0x0a08, 0x1802: 0x0a08, 0x1803: 0x0a08, 0x1804: 0x0a08, 0x1805: 0x0c08, + 0x1806: 0x0808, 0x1807: 0x0c08, 0x1808: 0x0818, 0x1809: 0x0c08, 0x180a: 0x0c08, 0x180b: 0x0808, + 0x180c: 0x0808, 0x180d: 0x0908, 0x180e: 0x0c08, 0x180f: 0x0c08, 0x1810: 0x0c08, 0x1811: 0x0c08, + 0x1812: 0x0c08, 0x1813: 0x0a08, 0x1814: 0x0a08, 0x1815: 0x0a08, 0x1816: 0x0a08, 0x1817: 0x0908, + 0x1818: 0x0a08, 0x1819: 0x0a08, 0x181a: 0x0a08, 0x181b: 0x0a08, 0x181c: 0x0a08, 0x181d: 0x0c08, + 0x181e: 0x0a08, 0x181f: 0x0a08, 0x1820: 0x0a08, 0x1821: 0x0c08, 0x1822: 0x0808, 0x1823: 0x0808, + 0x1824: 0x0c08, 0x1825: 0x3308, 0x1826: 0x3308, 0x1827: 0x0040, 0x1828: 0x0040, 0x1829: 0x0040, + 0x182a: 0x0040, 0x182b: 0x0a18, 0x182c: 0x0a18, 0x182d: 0x0a18, 0x182e: 0x0a18, 0x182f: 0x0c18, + 0x1830: 0x0818, 0x1831: 0x0818, 0x1832: 0x0818, 0x1833: 0x0818, 0x1834: 0x0818, 0x1835: 0x0818, + 0x1836: 0x0818, 0x1837: 0x0040, 0x1838: 0x0040, 0x1839: 0x0040, 0x183a: 0x0040, 0x183b: 0x0040, + 0x183c: 0x0040, 0x183d: 0x0040, 0x183e: 0x0040, 0x183f: 0x0040, + // Block 0x61, offset 0x1840 + 0x1840: 0x0a08, 0x1841: 0x0c08, 0x1842: 0x0a08, 0x1843: 0x0c08, 0x1844: 0x0c08, 0x1845: 0x0c08, + 0x1846: 0x0a08, 0x1847: 0x0a08, 0x1848: 0x0a08, 0x1849: 0x0c08, 0x184a: 0x0a08, 0x184b: 0x0a08, + 0x184c: 0x0c08, 0x184d: 0x0a08, 0x184e: 0x0c08, 0x184f: 0x0c08, 0x1850: 0x0a08, 0x1851: 0x0c08, + 0x1852: 0x0040, 0x1853: 0x0040, 0x1854: 0x0040, 0x1855: 0x0040, 0x1856: 0x0040, 0x1857: 0x0040, + 0x1858: 0x0040, 0x1859: 0x0818, 0x185a: 0x0818, 0x185b: 0x0818, 0x185c: 0x0818, 0x185d: 0x0040, + 0x185e: 0x0040, 0x185f: 0x0040, 0x1860: 0x0040, 0x1861: 0x0040, 0x1862: 0x0040, 0x1863: 0x0040, + 0x1864: 0x0040, 0x1865: 0x0040, 0x1866: 0x0040, 0x1867: 0x0040, 0x1868: 0x0040, 0x1869: 0x0c18, + 0x186a: 0x0c18, 0x186b: 0x0c18, 0x186c: 0x0c18, 0x186d: 0x0a18, 0x186e: 0x0a18, 0x186f: 0x0818, + 0x1870: 0x0040, 0x1871: 0x0040, 0x1872: 0x0040, 0x1873: 0x0040, 0x1874: 0x0040, 0x1875: 0x0040, + 0x1876: 0x0040, 0x1877: 0x0040, 0x1878: 0x0040, 0x1879: 0x0040, 0x187a: 0x0040, 0x187b: 0x0040, + 0x187c: 0x0040, 0x187d: 0x0040, 0x187e: 0x0040, 0x187f: 0x0040, + // Block 0x62, offset 0x1880 + 0x1880: 0x3308, 0x1881: 0x3308, 0x1882: 0x3008, 0x1883: 0x3008, 0x1884: 0x0040, 0x1885: 0x0008, + 0x1886: 0x0008, 0x1887: 0x0008, 0x1888: 0x0008, 0x1889: 0x0008, 0x188a: 0x0008, 0x188b: 0x0008, + 0x188c: 0x0008, 0x188d: 0x0040, 0x188e: 0x0040, 0x188f: 0x0008, 0x1890: 0x0008, 0x1891: 0x0040, + 0x1892: 0x0040, 0x1893: 0x0008, 0x1894: 0x0008, 0x1895: 0x0008, 0x1896: 0x0008, 0x1897: 0x0008, + 0x1898: 0x0008, 0x1899: 0x0008, 0x189a: 0x0008, 0x189b: 0x0008, 0x189c: 0x0008, 0x189d: 0x0008, + 0x189e: 0x0008, 0x189f: 0x0008, 0x18a0: 0x0008, 0x18a1: 0x0008, 0x18a2: 0x0008, 0x18a3: 0x0008, + 0x18a4: 0x0008, 0x18a5: 0x0008, 0x18a6: 0x0008, 0x18a7: 0x0008, 0x18a8: 0x0008, 0x18a9: 0x0040, + 0x18aa: 0x0008, 0x18ab: 0x0008, 0x18ac: 0x0008, 0x18ad: 0x0008, 0x18ae: 0x0008, 0x18af: 0x0008, + 0x18b0: 0x0008, 0x18b1: 0x0040, 0x18b2: 0x0008, 0x18b3: 0x0008, 0x18b4: 0x0040, 0x18b5: 0x0008, + 0x18b6: 0x0008, 0x18b7: 0x0008, 0x18b8: 0x0008, 0x18b9: 0x0008, 0x18ba: 0x0040, 0x18bb: 0x3308, + 0x18bc: 0x3308, 0x18bd: 0x0008, 0x18be: 0x3008, 0x18bf: 0x3008, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x3308, 0x18c1: 0x3008, 0x18c2: 0x3008, 0x18c3: 0x3008, 0x18c4: 0x3008, 0x18c5: 0x0040, + 0x18c6: 0x0040, 0x18c7: 0x3008, 0x18c8: 0x3008, 0x18c9: 0x0040, 0x18ca: 0x0040, 0x18cb: 0x3008, + 0x18cc: 0x3008, 0x18cd: 0x3808, 0x18ce: 0x0040, 0x18cf: 0x0040, 0x18d0: 0x0008, 0x18d1: 0x0040, + 0x18d2: 0x0040, 0x18d3: 0x0040, 0x18d4: 0x0040, 0x18d5: 0x0040, 0x18d6: 0x0040, 0x18d7: 0x3008, + 0x18d8: 0x0040, 0x18d9: 0x0040, 0x18da: 0x0040, 0x18db: 0x0040, 0x18dc: 0x0040, 0x18dd: 0x0008, + 0x18de: 0x0008, 0x18df: 0x0008, 0x18e0: 0x0008, 0x18e1: 0x0008, 0x18e2: 0x3008, 0x18e3: 0x3008, + 0x18e4: 0x0040, 0x18e5: 0x0040, 0x18e6: 0x3308, 0x18e7: 0x3308, 0x18e8: 0x3308, 0x18e9: 0x3308, + 0x18ea: 0x3308, 0x18eb: 0x3308, 0x18ec: 0x3308, 0x18ed: 0x0040, 0x18ee: 0x0040, 0x18ef: 0x0040, + 0x18f0: 0x3308, 0x18f1: 0x3308, 0x18f2: 0x3308, 0x18f3: 0x3308, 0x18f4: 0x3308, 0x18f5: 0x0040, + 0x18f6: 0x0040, 0x18f7: 0x0040, 0x18f8: 0x0040, 0x18f9: 0x0040, 0x18fa: 0x0040, 0x18fb: 0x0040, + 0x18fc: 0x0040, 0x18fd: 0x0040, 0x18fe: 0x0040, 0x18ff: 0x0040, + // Block 0x64, offset 0x1900 + 0x1900: 0x0008, 0x1901: 0x0008, 0x1902: 0x0008, 0x1903: 0x0008, 0x1904: 0x0008, 0x1905: 0x0008, + 0x1906: 0x0008, 0x1907: 0x0040, 0x1908: 0x0040, 0x1909: 0x0008, 0x190a: 0x0040, 0x190b: 0x0040, + 0x190c: 0x0008, 0x190d: 0x0008, 0x190e: 0x0008, 0x190f: 0x0008, 0x1910: 0x0008, 0x1911: 0x0008, + 0x1912: 0x0008, 0x1913: 0x0008, 0x1914: 0x0040, 0x1915: 0x0008, 0x1916: 0x0008, 0x1917: 0x0040, + 0x1918: 0x0008, 0x1919: 0x0008, 0x191a: 0x0008, 0x191b: 0x0008, 0x191c: 0x0008, 0x191d: 0x0008, + 0x191e: 0x0008, 0x191f: 0x0008, 0x1920: 0x0008, 0x1921: 0x0008, 0x1922: 0x0008, 0x1923: 0x0008, + 0x1924: 0x0008, 0x1925: 0x0008, 0x1926: 0x0008, 0x1927: 0x0008, 0x1928: 0x0008, 0x1929: 0x0008, + 0x192a: 0x0008, 0x192b: 0x0008, 0x192c: 0x0008, 0x192d: 0x0008, 0x192e: 0x0008, 0x192f: 0x0008, + 0x1930: 0x3008, 0x1931: 0x3008, 0x1932: 0x3008, 0x1933: 0x3008, 0x1934: 0x3008, 0x1935: 0x3008, + 0x1936: 0x0040, 0x1937: 0x3008, 0x1938: 0x3008, 0x1939: 0x0040, 0x193a: 0x0040, 0x193b: 0x3308, + 0x193c: 0x3308, 0x193d: 0x3808, 0x193e: 0x3b08, 0x193f: 0x0008, + // Block 0x65, offset 0x1940 + 0x1940: 0x0019, 0x1941: 0x02e9, 0x1942: 0x03d9, 0x1943: 0x02f1, 0x1944: 0x02f9, 0x1945: 0x03f1, + 0x1946: 0x0309, 0x1947: 0x00a9, 0x1948: 0x0311, 0x1949: 0x00b1, 0x194a: 0x0319, 0x194b: 0x0101, + 0x194c: 0x0321, 0x194d: 0x0329, 0x194e: 0x0051, 0x194f: 0x0339, 0x1950: 0x0751, 0x1951: 0x00b9, + 0x1952: 0x0089, 0x1953: 0x0341, 0x1954: 0x0349, 0x1955: 0x0391, 0x1956: 0x00c1, 0x1957: 0x0109, + 0x1958: 0x00c9, 0x1959: 0x04b1, 0x195a: 0x0019, 0x195b: 0x02e9, 0x195c: 0x03d9, 0x195d: 0x02f1, + 0x195e: 0x02f9, 0x195f: 0x03f1, 0x1960: 0x0309, 0x1961: 0x00a9, 0x1962: 0x0311, 0x1963: 0x00b1, + 0x1964: 0x0319, 0x1965: 0x0101, 0x1966: 0x0321, 0x1967: 0x0329, 0x1968: 0x0051, 0x1969: 0x0339, + 0x196a: 0x0751, 0x196b: 0x00b9, 0x196c: 0x0089, 0x196d: 0x0341, 0x196e: 0x0349, 0x196f: 0x0391, + 0x1970: 0x00c1, 0x1971: 0x0109, 0x1972: 0x00c9, 0x1973: 0x04b1, 0x1974: 0x0019, 0x1975: 0x02e9, + 0x1976: 0x03d9, 0x1977: 0x02f1, 0x1978: 0x02f9, 0x1979: 0x03f1, 0x197a: 0x0309, 0x197b: 0x00a9, + 0x197c: 0x0311, 0x197d: 0x00b1, 0x197e: 0x0319, 0x197f: 0x0101, + // Block 0x66, offset 0x1980 + 0x1980: 0x0321, 0x1981: 0x0329, 0x1982: 0x0051, 0x1983: 0x0339, 0x1984: 0x0751, 0x1985: 0x00b9, + 0x1986: 0x0089, 0x1987: 0x0341, 0x1988: 0x0349, 0x1989: 0x0391, 0x198a: 0x00c1, 0x198b: 0x0109, + 0x198c: 0x00c9, 0x198d: 0x04b1, 0x198e: 0x0019, 0x198f: 0x02e9, 0x1990: 0x03d9, 0x1991: 0x02f1, + 0x1992: 0x02f9, 0x1993: 0x03f1, 0x1994: 0x0309, 0x1995: 0x0040, 0x1996: 0x0311, 0x1997: 0x00b1, + 0x1998: 0x0319, 0x1999: 0x0101, 0x199a: 0x0321, 0x199b: 0x0329, 0x199c: 0x0051, 0x199d: 0x0339, + 0x199e: 0x0751, 0x199f: 0x00b9, 0x19a0: 0x0089, 0x19a1: 0x0341, 0x19a2: 0x0349, 0x19a3: 0x0391, + 0x19a4: 0x00c1, 0x19a5: 0x0109, 0x19a6: 0x00c9, 0x19a7: 0x04b1, 0x19a8: 0x0019, 0x19a9: 0x02e9, + 0x19aa: 0x03d9, 0x19ab: 0x02f1, 0x19ac: 0x02f9, 0x19ad: 0x03f1, 0x19ae: 0x0309, 0x19af: 0x00a9, + 0x19b0: 0x0311, 0x19b1: 0x00b1, 0x19b2: 0x0319, 0x19b3: 0x0101, 0x19b4: 0x0321, 0x19b5: 0x0329, + 0x19b6: 0x0051, 0x19b7: 0x0339, 0x19b8: 0x0751, 0x19b9: 0x00b9, 0x19ba: 0x0089, 0x19bb: 0x0341, + 0x19bc: 0x0349, 0x19bd: 0x0391, 0x19be: 0x00c1, 0x19bf: 0x0109, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x00c9, 0x19c1: 0x04b1, 0x19c2: 0x0019, 0x19c3: 0x02e9, 0x19c4: 0x03d9, 0x19c5: 0x02f1, + 0x19c6: 0x02f9, 0x19c7: 0x03f1, 0x19c8: 0x0309, 0x19c9: 0x00a9, 0x19ca: 0x0311, 0x19cb: 0x00b1, + 0x19cc: 0x0319, 0x19cd: 0x0101, 0x19ce: 0x0321, 0x19cf: 0x0329, 0x19d0: 0x0051, 0x19d1: 0x0339, + 0x19d2: 0x0751, 0x19d3: 0x00b9, 0x19d4: 0x0089, 0x19d5: 0x0341, 0x19d6: 0x0349, 0x19d7: 0x0391, + 0x19d8: 0x00c1, 0x19d9: 0x0109, 0x19da: 0x00c9, 0x19db: 0x04b1, 0x19dc: 0x0019, 0x19dd: 0x0040, + 0x19de: 0x03d9, 0x19df: 0x02f1, 0x19e0: 0x0040, 0x19e1: 0x0040, 0x19e2: 0x0309, 0x19e3: 0x0040, + 0x19e4: 0x0040, 0x19e5: 0x00b1, 0x19e6: 0x0319, 0x19e7: 0x0040, 0x19e8: 0x0040, 0x19e9: 0x0329, + 0x19ea: 0x0051, 0x19eb: 0x0339, 0x19ec: 0x0751, 0x19ed: 0x0040, 0x19ee: 0x0089, 0x19ef: 0x0341, + 0x19f0: 0x0349, 0x19f1: 0x0391, 0x19f2: 0x00c1, 0x19f3: 0x0109, 0x19f4: 0x00c9, 0x19f5: 0x04b1, + 0x19f6: 0x0019, 0x19f7: 0x02e9, 0x19f8: 0x03d9, 0x19f9: 0x02f1, 0x19fa: 0x0040, 0x19fb: 0x03f1, + 0x19fc: 0x0040, 0x19fd: 0x00a9, 0x19fe: 0x0311, 0x19ff: 0x00b1, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x0319, 0x1a01: 0x0101, 0x1a02: 0x0321, 0x1a03: 0x0329, 0x1a04: 0x0040, 0x1a05: 0x0339, + 0x1a06: 0x0751, 0x1a07: 0x00b9, 0x1a08: 0x0089, 0x1a09: 0x0341, 0x1a0a: 0x0349, 0x1a0b: 0x0391, + 0x1a0c: 0x00c1, 0x1a0d: 0x0109, 0x1a0e: 0x00c9, 0x1a0f: 0x04b1, 0x1a10: 0x0019, 0x1a11: 0x02e9, + 0x1a12: 0x03d9, 0x1a13: 0x02f1, 0x1a14: 0x02f9, 0x1a15: 0x03f1, 0x1a16: 0x0309, 0x1a17: 0x00a9, + 0x1a18: 0x0311, 0x1a19: 0x00b1, 0x1a1a: 0x0319, 0x1a1b: 0x0101, 0x1a1c: 0x0321, 0x1a1d: 0x0329, + 0x1a1e: 0x0051, 0x1a1f: 0x0339, 0x1a20: 0x0751, 0x1a21: 0x00b9, 0x1a22: 0x0089, 0x1a23: 0x0341, + 0x1a24: 0x0349, 0x1a25: 0x0391, 0x1a26: 0x00c1, 0x1a27: 0x0109, 0x1a28: 0x00c9, 0x1a29: 0x04b1, + 0x1a2a: 0x0019, 0x1a2b: 0x02e9, 0x1a2c: 0x03d9, 0x1a2d: 0x02f1, 0x1a2e: 0x02f9, 0x1a2f: 0x03f1, + 0x1a30: 0x0309, 0x1a31: 0x00a9, 0x1a32: 0x0311, 0x1a33: 0x00b1, 0x1a34: 0x0319, 0x1a35: 0x0101, + 0x1a36: 0x0321, 0x1a37: 0x0329, 0x1a38: 0x0051, 0x1a39: 0x0339, 0x1a3a: 0x0751, 0x1a3b: 0x00b9, + 0x1a3c: 0x0089, 0x1a3d: 0x0341, 0x1a3e: 0x0349, 0x1a3f: 0x0391, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x00c1, 0x1a41: 0x0109, 0x1a42: 0x00c9, 0x1a43: 0x04b1, 0x1a44: 0x0019, 0x1a45: 0x02e9, + 0x1a46: 0x0040, 0x1a47: 0x02f1, 0x1a48: 0x02f9, 0x1a49: 0x03f1, 0x1a4a: 0x0309, 0x1a4b: 0x0040, + 0x1a4c: 0x0040, 0x1a4d: 0x00b1, 0x1a4e: 0x0319, 0x1a4f: 0x0101, 0x1a50: 0x0321, 0x1a51: 0x0329, + 0x1a52: 0x0051, 0x1a53: 0x0339, 0x1a54: 0x0751, 0x1a55: 0x0040, 0x1a56: 0x0089, 0x1a57: 0x0341, + 0x1a58: 0x0349, 0x1a59: 0x0391, 0x1a5a: 0x00c1, 0x1a5b: 0x0109, 0x1a5c: 0x00c9, 0x1a5d: 0x0040, + 0x1a5e: 0x0019, 0x1a5f: 0x02e9, 0x1a60: 0x03d9, 0x1a61: 0x02f1, 0x1a62: 0x02f9, 0x1a63: 0x03f1, + 0x1a64: 0x0309, 0x1a65: 0x00a9, 0x1a66: 0x0311, 0x1a67: 0x00b1, 0x1a68: 0x0319, 0x1a69: 0x0101, + 0x1a6a: 0x0321, 0x1a6b: 0x0329, 0x1a6c: 0x0051, 0x1a6d: 0x0339, 0x1a6e: 0x0751, 0x1a6f: 0x00b9, + 0x1a70: 0x0089, 0x1a71: 0x0341, 0x1a72: 0x0349, 0x1a73: 0x0391, 0x1a74: 0x00c1, 0x1a75: 0x0109, + 0x1a76: 0x00c9, 0x1a77: 0x04b1, 0x1a78: 0x0019, 0x1a79: 0x02e9, 0x1a7a: 0x0040, 0x1a7b: 0x02f1, + 0x1a7c: 0x02f9, 0x1a7d: 0x03f1, 0x1a7e: 0x0309, 0x1a7f: 0x0040, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x0311, 0x1a81: 0x00b1, 0x1a82: 0x0319, 0x1a83: 0x0101, 0x1a84: 0x0321, 0x1a85: 0x0040, + 0x1a86: 0x0051, 0x1a87: 0x0040, 0x1a88: 0x0040, 0x1a89: 0x0040, 0x1a8a: 0x0089, 0x1a8b: 0x0341, + 0x1a8c: 0x0349, 0x1a8d: 0x0391, 0x1a8e: 0x00c1, 0x1a8f: 0x0109, 0x1a90: 0x00c9, 0x1a91: 0x0040, + 0x1a92: 0x0019, 0x1a93: 0x02e9, 0x1a94: 0x03d9, 0x1a95: 0x02f1, 0x1a96: 0x02f9, 0x1a97: 0x03f1, + 0x1a98: 0x0309, 0x1a99: 0x00a9, 0x1a9a: 0x0311, 0x1a9b: 0x00b1, 0x1a9c: 0x0319, 0x1a9d: 0x0101, + 0x1a9e: 0x0321, 0x1a9f: 0x0329, 0x1aa0: 0x0051, 0x1aa1: 0x0339, 0x1aa2: 0x0751, 0x1aa3: 0x00b9, + 0x1aa4: 0x0089, 0x1aa5: 0x0341, 0x1aa6: 0x0349, 0x1aa7: 0x0391, 0x1aa8: 0x00c1, 0x1aa9: 0x0109, + 0x1aaa: 0x00c9, 0x1aab: 0x04b1, 0x1aac: 0x0019, 0x1aad: 0x02e9, 0x1aae: 0x03d9, 0x1aaf: 0x02f1, + 0x1ab0: 0x02f9, 0x1ab1: 0x03f1, 0x1ab2: 0x0309, 0x1ab3: 0x00a9, 0x1ab4: 0x0311, 0x1ab5: 0x00b1, + 0x1ab6: 0x0319, 0x1ab7: 0x0101, 0x1ab8: 0x0321, 0x1ab9: 0x0329, 0x1aba: 0x0051, 0x1abb: 0x0339, + 0x1abc: 0x0751, 0x1abd: 0x00b9, 0x1abe: 0x0089, 0x1abf: 0x0341, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x0349, 0x1ac1: 0x0391, 0x1ac2: 0x00c1, 0x1ac3: 0x0109, 0x1ac4: 0x00c9, 0x1ac5: 0x04b1, + 0x1ac6: 0x0019, 0x1ac7: 0x02e9, 0x1ac8: 0x03d9, 0x1ac9: 0x02f1, 0x1aca: 0x02f9, 0x1acb: 0x03f1, + 0x1acc: 0x0309, 0x1acd: 0x00a9, 0x1ace: 0x0311, 0x1acf: 0x00b1, 0x1ad0: 0x0319, 0x1ad1: 0x0101, + 0x1ad2: 0x0321, 0x1ad3: 0x0329, 0x1ad4: 0x0051, 0x1ad5: 0x0339, 0x1ad6: 0x0751, 0x1ad7: 0x00b9, + 0x1ad8: 0x0089, 0x1ad9: 0x0341, 0x1ada: 0x0349, 0x1adb: 0x0391, 0x1adc: 0x00c1, 0x1add: 0x0109, + 0x1ade: 0x00c9, 0x1adf: 0x04b1, 0x1ae0: 0x0019, 0x1ae1: 0x02e9, 0x1ae2: 0x03d9, 0x1ae3: 0x02f1, + 0x1ae4: 0x02f9, 0x1ae5: 0x03f1, 0x1ae6: 0x0309, 0x1ae7: 0x00a9, 0x1ae8: 0x0311, 0x1ae9: 0x00b1, + 0x1aea: 0x0319, 0x1aeb: 0x0101, 0x1aec: 0x0321, 0x1aed: 0x0329, 0x1aee: 0x0051, 0x1aef: 0x0339, + 0x1af0: 0x0751, 0x1af1: 0x00b9, 0x1af2: 0x0089, 0x1af3: 0x0341, 0x1af4: 0x0349, 0x1af5: 0x0391, + 0x1af6: 0x00c1, 0x1af7: 0x0109, 0x1af8: 0x00c9, 0x1af9: 0x04b1, 0x1afa: 0x0019, 0x1afb: 0x02e9, + 0x1afc: 0x03d9, 0x1afd: 0x02f1, 0x1afe: 0x02f9, 0x1aff: 0x03f1, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x0309, 0x1b01: 0x00a9, 0x1b02: 0x0311, 0x1b03: 0x00b1, 0x1b04: 0x0319, 0x1b05: 0x0101, + 0x1b06: 0x0321, 0x1b07: 0x0329, 0x1b08: 0x0051, 0x1b09: 0x0339, 0x1b0a: 0x0751, 0x1b0b: 0x00b9, + 0x1b0c: 0x0089, 0x1b0d: 0x0341, 0x1b0e: 0x0349, 0x1b0f: 0x0391, 0x1b10: 0x00c1, 0x1b11: 0x0109, + 0x1b12: 0x00c9, 0x1b13: 0x04b1, 0x1b14: 0x0019, 0x1b15: 0x02e9, 0x1b16: 0x03d9, 0x1b17: 0x02f1, + 0x1b18: 0x02f9, 0x1b19: 0x03f1, 0x1b1a: 0x0309, 0x1b1b: 0x00a9, 0x1b1c: 0x0311, 0x1b1d: 0x00b1, + 0x1b1e: 0x0319, 0x1b1f: 0x0101, 0x1b20: 0x0321, 0x1b21: 0x0329, 0x1b22: 0x0051, 0x1b23: 0x0339, + 0x1b24: 0x0751, 0x1b25: 0x00b9, 0x1b26: 0x0089, 0x1b27: 0x0341, 0x1b28: 0x0349, 0x1b29: 0x0391, + 0x1b2a: 0x00c1, 0x1b2b: 0x0109, 0x1b2c: 0x00c9, 0x1b2d: 0x04b1, 0x1b2e: 0x0019, 0x1b2f: 0x02e9, + 0x1b30: 0x03d9, 0x1b31: 0x02f1, 0x1b32: 0x02f9, 0x1b33: 0x03f1, 0x1b34: 0x0309, 0x1b35: 0x00a9, + 0x1b36: 0x0311, 0x1b37: 0x00b1, 0x1b38: 0x0319, 0x1b39: 0x0101, 0x1b3a: 0x0321, 0x1b3b: 0x0329, + 0x1b3c: 0x0051, 0x1b3d: 0x0339, 0x1b3e: 0x0751, 0x1b3f: 0x00b9, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x0089, 0x1b41: 0x0341, 0x1b42: 0x0349, 0x1b43: 0x0391, 0x1b44: 0x00c1, 0x1b45: 0x0109, + 0x1b46: 0x00c9, 0x1b47: 0x04b1, 0x1b48: 0x0019, 0x1b49: 0x02e9, 0x1b4a: 0x03d9, 0x1b4b: 0x02f1, + 0x1b4c: 0x02f9, 0x1b4d: 0x03f1, 0x1b4e: 0x0309, 0x1b4f: 0x00a9, 0x1b50: 0x0311, 0x1b51: 0x00b1, + 0x1b52: 0x0319, 0x1b53: 0x0101, 0x1b54: 0x0321, 0x1b55: 0x0329, 0x1b56: 0x0051, 0x1b57: 0x0339, + 0x1b58: 0x0751, 0x1b59: 0x00b9, 0x1b5a: 0x0089, 0x1b5b: 0x0341, 0x1b5c: 0x0349, 0x1b5d: 0x0391, + 0x1b5e: 0x00c1, 0x1b5f: 0x0109, 0x1b60: 0x00c9, 0x1b61: 0x04b1, 0x1b62: 0x0019, 0x1b63: 0x02e9, + 0x1b64: 0x03d9, 0x1b65: 0x02f1, 0x1b66: 0x02f9, 0x1b67: 0x03f1, 0x1b68: 0x0309, 0x1b69: 0x00a9, + 0x1b6a: 0x0311, 0x1b6b: 0x00b1, 0x1b6c: 0x0319, 0x1b6d: 0x0101, 0x1b6e: 0x0321, 0x1b6f: 0x0329, + 0x1b70: 0x0051, 0x1b71: 0x0339, 0x1b72: 0x0751, 0x1b73: 0x00b9, 0x1b74: 0x0089, 0x1b75: 0x0341, + 0x1b76: 0x0349, 0x1b77: 0x0391, 0x1b78: 0x00c1, 0x1b79: 0x0109, 0x1b7a: 0x00c9, 0x1b7b: 0x04b1, + 0x1b7c: 0x0019, 0x1b7d: 0x02e9, 0x1b7e: 0x03d9, 0x1b7f: 0x02f1, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x02f9, 0x1b81: 0x03f1, 0x1b82: 0x0309, 0x1b83: 0x00a9, 0x1b84: 0x0311, 0x1b85: 0x00b1, + 0x1b86: 0x0319, 0x1b87: 0x0101, 0x1b88: 0x0321, 0x1b89: 0x0329, 0x1b8a: 0x0051, 0x1b8b: 0x0339, + 0x1b8c: 0x0751, 0x1b8d: 0x00b9, 0x1b8e: 0x0089, 0x1b8f: 0x0341, 0x1b90: 0x0349, 0x1b91: 0x0391, + 0x1b92: 0x00c1, 0x1b93: 0x0109, 0x1b94: 0x00c9, 0x1b95: 0x04b1, 0x1b96: 0x0019, 0x1b97: 0x02e9, + 0x1b98: 0x03d9, 0x1b99: 0x02f1, 0x1b9a: 0x02f9, 0x1b9b: 0x03f1, 0x1b9c: 0x0309, 0x1b9d: 0x00a9, + 0x1b9e: 0x0311, 0x1b9f: 0x00b1, 0x1ba0: 0x0319, 0x1ba1: 0x0101, 0x1ba2: 0x0321, 0x1ba3: 0x0329, + 0x1ba4: 0x0051, 0x1ba5: 0x0339, 0x1ba6: 0x0751, 0x1ba7: 0x00b9, 0x1ba8: 0x0089, 0x1ba9: 0x0341, + 0x1baa: 0x0349, 0x1bab: 0x0391, 0x1bac: 0x00c1, 0x1bad: 0x0109, 0x1bae: 0x00c9, 0x1baf: 0x04b1, + 0x1bb0: 0x0019, 0x1bb1: 0x02e9, 0x1bb2: 0x03d9, 0x1bb3: 0x02f1, 0x1bb4: 0x02f9, 0x1bb5: 0x03f1, + 0x1bb6: 0x0309, 0x1bb7: 0x00a9, 0x1bb8: 0x0311, 0x1bb9: 0x00b1, 0x1bba: 0x0319, 0x1bbb: 0x0101, + 0x1bbc: 0x0321, 0x1bbd: 0x0329, 0x1bbe: 0x0051, 0x1bbf: 0x0339, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0751, 0x1bc1: 0x00b9, 0x1bc2: 0x0089, 0x1bc3: 0x0341, 0x1bc4: 0x0349, 0x1bc5: 0x0391, + 0x1bc6: 0x00c1, 0x1bc7: 0x0109, 0x1bc8: 0x00c9, 0x1bc9: 0x04b1, 0x1bca: 0x0019, 0x1bcb: 0x02e9, + 0x1bcc: 0x03d9, 0x1bcd: 0x02f1, 0x1bce: 0x02f9, 0x1bcf: 0x03f1, 0x1bd0: 0x0309, 0x1bd1: 0x00a9, + 0x1bd2: 0x0311, 0x1bd3: 0x00b1, 0x1bd4: 0x0319, 0x1bd5: 0x0101, 0x1bd6: 0x0321, 0x1bd7: 0x0329, + 0x1bd8: 0x0051, 0x1bd9: 0x0339, 0x1bda: 0x0751, 0x1bdb: 0x00b9, 0x1bdc: 0x0089, 0x1bdd: 0x0341, + 0x1bde: 0x0349, 0x1bdf: 0x0391, 0x1be0: 0x00c1, 0x1be1: 0x0109, 0x1be2: 0x00c9, 0x1be3: 0x04b1, + 0x1be4: 0x23e1, 0x1be5: 0x23e9, 0x1be6: 0x0040, 0x1be7: 0x0040, 0x1be8: 0x23f1, 0x1be9: 0x0399, + 0x1bea: 0x03a1, 0x1beb: 0x03a9, 0x1bec: 0x23f9, 0x1bed: 0x2401, 0x1bee: 0x2409, 0x1bef: 0x04d1, + 0x1bf0: 0x05f9, 0x1bf1: 0x2411, 0x1bf2: 0x2419, 0x1bf3: 0x2421, 0x1bf4: 0x2429, 0x1bf5: 0x2431, + 0x1bf6: 0x2439, 0x1bf7: 0x0799, 0x1bf8: 0x03c1, 0x1bf9: 0x04d1, 0x1bfa: 0x2441, 0x1bfb: 0x2449, + 0x1bfc: 0x2451, 0x1bfd: 0x03b1, 0x1bfe: 0x03b9, 0x1bff: 0x2459, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0769, 0x1c01: 0x2461, 0x1c02: 0x23f1, 0x1c03: 0x0399, 0x1c04: 0x03a1, 0x1c05: 0x03a9, + 0x1c06: 0x23f9, 0x1c07: 0x2401, 0x1c08: 0x2409, 0x1c09: 0x04d1, 0x1c0a: 0x05f9, 0x1c0b: 0x2411, + 0x1c0c: 0x2419, 0x1c0d: 0x2421, 0x1c0e: 0x2429, 0x1c0f: 0x2431, 0x1c10: 0x2439, 0x1c11: 0x0799, + 0x1c12: 0x03c1, 0x1c13: 0x2441, 0x1c14: 0x2441, 0x1c15: 0x2449, 0x1c16: 0x2451, 0x1c17: 0x03b1, + 0x1c18: 0x03b9, 0x1c19: 0x2459, 0x1c1a: 0x0769, 0x1c1b: 0x2469, 0x1c1c: 0x23f9, 0x1c1d: 0x04d1, + 0x1c1e: 0x2411, 0x1c1f: 0x03b1, 0x1c20: 0x03c1, 0x1c21: 0x0799, 0x1c22: 0x23f1, 0x1c23: 0x0399, + 0x1c24: 0x03a1, 0x1c25: 0x03a9, 0x1c26: 0x23f9, 0x1c27: 0x2401, 0x1c28: 0x2409, 0x1c29: 0x04d1, + 0x1c2a: 0x05f9, 0x1c2b: 0x2411, 0x1c2c: 0x2419, 0x1c2d: 0x2421, 0x1c2e: 0x2429, 0x1c2f: 0x2431, + 0x1c30: 0x2439, 0x1c31: 0x0799, 0x1c32: 0x03c1, 0x1c33: 0x04d1, 0x1c34: 0x2441, 0x1c35: 0x2449, + 0x1c36: 0x2451, 0x1c37: 0x03b1, 0x1c38: 0x03b9, 0x1c39: 0x2459, 0x1c3a: 0x0769, 0x1c3b: 0x2461, + 0x1c3c: 0x23f1, 0x1c3d: 0x0399, 0x1c3e: 0x03a1, 0x1c3f: 0x03a9, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x23f9, 0x1c41: 0x2401, 0x1c42: 0x2409, 0x1c43: 0x04d1, 0x1c44: 0x05f9, 0x1c45: 0x2411, + 0x1c46: 0x2419, 0x1c47: 0x2421, 0x1c48: 0x2429, 0x1c49: 0x2431, 0x1c4a: 0x2439, 0x1c4b: 0x0799, + 0x1c4c: 0x03c1, 0x1c4d: 0x2441, 0x1c4e: 0x2441, 0x1c4f: 0x2449, 0x1c50: 0x2451, 0x1c51: 0x03b1, + 0x1c52: 0x03b9, 0x1c53: 0x2459, 0x1c54: 0x0769, 0x1c55: 0x2469, 0x1c56: 0x23f9, 0x1c57: 0x04d1, + 0x1c58: 0x2411, 0x1c59: 0x03b1, 0x1c5a: 0x03c1, 0x1c5b: 0x0799, 0x1c5c: 0x23f1, 0x1c5d: 0x0399, + 0x1c5e: 0x03a1, 0x1c5f: 0x03a9, 0x1c60: 0x23f9, 0x1c61: 0x2401, 0x1c62: 0x2409, 0x1c63: 0x04d1, + 0x1c64: 0x05f9, 0x1c65: 0x2411, 0x1c66: 0x2419, 0x1c67: 0x2421, 0x1c68: 0x2429, 0x1c69: 0x2431, + 0x1c6a: 0x2439, 0x1c6b: 0x0799, 0x1c6c: 0x03c1, 0x1c6d: 0x04d1, 0x1c6e: 0x2441, 0x1c6f: 0x2449, + 0x1c70: 0x2451, 0x1c71: 0x03b1, 0x1c72: 0x03b9, 0x1c73: 0x2459, 0x1c74: 0x0769, 0x1c75: 0x2461, + 0x1c76: 0x23f1, 0x1c77: 0x0399, 0x1c78: 0x03a1, 0x1c79: 0x03a9, 0x1c7a: 0x23f9, 0x1c7b: 0x2401, + 0x1c7c: 0x2409, 0x1c7d: 0x04d1, 0x1c7e: 0x05f9, 0x1c7f: 0x2411, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x2419, 0x1c81: 0x2421, 0x1c82: 0x2429, 0x1c83: 0x2431, 0x1c84: 0x2439, 0x1c85: 0x0799, + 0x1c86: 0x03c1, 0x1c87: 0x2441, 0x1c88: 0x2441, 0x1c89: 0x2449, 0x1c8a: 0x2451, 0x1c8b: 0x03b1, + 0x1c8c: 0x03b9, 0x1c8d: 0x2459, 0x1c8e: 0x0769, 0x1c8f: 0x2469, 0x1c90: 0x23f9, 0x1c91: 0x04d1, + 0x1c92: 0x2411, 0x1c93: 0x03b1, 0x1c94: 0x03c1, 0x1c95: 0x0799, 0x1c96: 0x23f1, 0x1c97: 0x0399, + 0x1c98: 0x03a1, 0x1c99: 0x03a9, 0x1c9a: 0x23f9, 0x1c9b: 0x2401, 0x1c9c: 0x2409, 0x1c9d: 0x04d1, + 0x1c9e: 0x05f9, 0x1c9f: 0x2411, 0x1ca0: 0x2419, 0x1ca1: 0x2421, 0x1ca2: 0x2429, 0x1ca3: 0x2431, + 0x1ca4: 0x2439, 0x1ca5: 0x0799, 0x1ca6: 0x03c1, 0x1ca7: 0x04d1, 0x1ca8: 0x2441, 0x1ca9: 0x2449, + 0x1caa: 0x2451, 0x1cab: 0x03b1, 0x1cac: 0x03b9, 0x1cad: 0x2459, 0x1cae: 0x0769, 0x1caf: 0x2461, + 0x1cb0: 0x23f1, 0x1cb1: 0x0399, 0x1cb2: 0x03a1, 0x1cb3: 0x03a9, 0x1cb4: 0x23f9, 0x1cb5: 0x2401, + 0x1cb6: 0x2409, 0x1cb7: 0x04d1, 0x1cb8: 0x05f9, 0x1cb9: 0x2411, 0x1cba: 0x2419, 0x1cbb: 0x2421, + 0x1cbc: 0x2429, 0x1cbd: 0x2431, 0x1cbe: 0x2439, 0x1cbf: 0x0799, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x03c1, 0x1cc1: 0x2441, 0x1cc2: 0x2441, 0x1cc3: 0x2449, 0x1cc4: 0x2451, 0x1cc5: 0x03b1, + 0x1cc6: 0x03b9, 0x1cc7: 0x2459, 0x1cc8: 0x0769, 0x1cc9: 0x2469, 0x1cca: 0x23f9, 0x1ccb: 0x04d1, + 0x1ccc: 0x2411, 0x1ccd: 0x03b1, 0x1cce: 0x03c1, 0x1ccf: 0x0799, 0x1cd0: 0x23f1, 0x1cd1: 0x0399, + 0x1cd2: 0x03a1, 0x1cd3: 0x03a9, 0x1cd4: 0x23f9, 0x1cd5: 0x2401, 0x1cd6: 0x2409, 0x1cd7: 0x04d1, + 0x1cd8: 0x05f9, 0x1cd9: 0x2411, 0x1cda: 0x2419, 0x1cdb: 0x2421, 0x1cdc: 0x2429, 0x1cdd: 0x2431, + 0x1cde: 0x2439, 0x1cdf: 0x0799, 0x1ce0: 0x03c1, 0x1ce1: 0x04d1, 0x1ce2: 0x2441, 0x1ce3: 0x2449, + 0x1ce4: 0x2451, 0x1ce5: 0x03b1, 0x1ce6: 0x03b9, 0x1ce7: 0x2459, 0x1ce8: 0x0769, 0x1ce9: 0x2461, + 0x1cea: 0x23f1, 0x1ceb: 0x0399, 0x1cec: 0x03a1, 0x1ced: 0x03a9, 0x1cee: 0x23f9, 0x1cef: 0x2401, + 0x1cf0: 0x2409, 0x1cf1: 0x04d1, 0x1cf2: 0x05f9, 0x1cf3: 0x2411, 0x1cf4: 0x2419, 0x1cf5: 0x2421, + 0x1cf6: 0x2429, 0x1cf7: 0x2431, 0x1cf8: 0x2439, 0x1cf9: 0x0799, 0x1cfa: 0x03c1, 0x1cfb: 0x2441, + 0x1cfc: 0x2441, 0x1cfd: 0x2449, 0x1cfe: 0x2451, 0x1cff: 0x03b1, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x03b9, 0x1d01: 0x2459, 0x1d02: 0x0769, 0x1d03: 0x2469, 0x1d04: 0x23f9, 0x1d05: 0x04d1, + 0x1d06: 0x2411, 0x1d07: 0x03b1, 0x1d08: 0x03c1, 0x1d09: 0x0799, 0x1d0a: 0x2471, 0x1d0b: 0x2471, + 0x1d0c: 0x0040, 0x1d0d: 0x0040, 0x1d0e: 0x06e1, 0x1d0f: 0x0049, 0x1d10: 0x0029, 0x1d11: 0x0031, + 0x1d12: 0x06e9, 0x1d13: 0x06f1, 0x1d14: 0x06f9, 0x1d15: 0x0701, 0x1d16: 0x0709, 0x1d17: 0x0711, + 0x1d18: 0x06e1, 0x1d19: 0x0049, 0x1d1a: 0x0029, 0x1d1b: 0x0031, 0x1d1c: 0x06e9, 0x1d1d: 0x06f1, + 0x1d1e: 0x06f9, 0x1d1f: 0x0701, 0x1d20: 0x0709, 0x1d21: 0x0711, 0x1d22: 0x06e1, 0x1d23: 0x0049, + 0x1d24: 0x0029, 0x1d25: 0x0031, 0x1d26: 0x06e9, 0x1d27: 0x06f1, 0x1d28: 0x06f9, 0x1d29: 0x0701, + 0x1d2a: 0x0709, 0x1d2b: 0x0711, 0x1d2c: 0x06e1, 0x1d2d: 0x0049, 0x1d2e: 0x0029, 0x1d2f: 0x0031, + 0x1d30: 0x06e9, 0x1d31: 0x06f1, 0x1d32: 0x06f9, 0x1d33: 0x0701, 0x1d34: 0x0709, 0x1d35: 0x0711, + 0x1d36: 0x06e1, 0x1d37: 0x0049, 0x1d38: 0x0029, 0x1d39: 0x0031, 0x1d3a: 0x06e9, 0x1d3b: 0x06f1, + 0x1d3c: 0x06f9, 0x1d3d: 0x0701, 0x1d3e: 0x0709, 0x1d3f: 0x0711, + // Block 0x75, offset 0x1d40 + 0x1d40: 0x3308, 0x1d41: 0x3308, 0x1d42: 0x3308, 0x1d43: 0x3308, 0x1d44: 0x3308, 0x1d45: 0x3308, + 0x1d46: 0x3308, 0x1d47: 0x0040, 0x1d48: 0x3308, 0x1d49: 0x3308, 0x1d4a: 0x3308, 0x1d4b: 0x3308, + 0x1d4c: 0x3308, 0x1d4d: 0x3308, 0x1d4e: 0x3308, 0x1d4f: 0x3308, 0x1d50: 0x3308, 0x1d51: 0x3308, + 0x1d52: 0x3308, 0x1d53: 0x3308, 0x1d54: 0x3308, 0x1d55: 0x3308, 0x1d56: 0x3308, 0x1d57: 0x3308, + 0x1d58: 0x3308, 0x1d59: 0x0040, 0x1d5a: 0x0040, 0x1d5b: 0x3308, 0x1d5c: 0x3308, 0x1d5d: 0x3308, + 0x1d5e: 0x3308, 0x1d5f: 0x3308, 0x1d60: 0x3308, 0x1d61: 0x3308, 0x1d62: 0x0040, 0x1d63: 0x3308, + 0x1d64: 0x3308, 0x1d65: 0x0040, 0x1d66: 0x3308, 0x1d67: 0x3308, 0x1d68: 0x3308, 0x1d69: 0x3308, + 0x1d6a: 0x3308, 0x1d6b: 0x0040, 0x1d6c: 0x0040, 0x1d6d: 0x0040, 0x1d6e: 0x0040, 0x1d6f: 0x0040, + 0x1d70: 0x2479, 0x1d71: 0x2481, 0x1d72: 0x02a9, 0x1d73: 0x2489, 0x1d74: 0x02b1, 0x1d75: 0x2491, + 0x1d76: 0x2499, 0x1d77: 0x24a1, 0x1d78: 0x24a9, 0x1d79: 0x24b1, 0x1d7a: 0x24b9, 0x1d7b: 0x24c1, + 0x1d7c: 0x02b9, 0x1d7d: 0x24c9, 0x1d7e: 0x24d1, 0x1d7f: 0x02c1, + // Block 0x76, offset 0x1d80 + 0x1d80: 0x02c9, 0x1d81: 0x24d9, 0x1d82: 0x24e1, 0x1d83: 0x24e9, 0x1d84: 0x24f1, 0x1d85: 0x24f9, + 0x1d86: 0x2501, 0x1d87: 0x2509, 0x1d88: 0x2511, 0x1d89: 0x2519, 0x1d8a: 0x2521, 0x1d8b: 0x2529, + 0x1d8c: 0x2531, 0x1d8d: 0x2539, 0x1d8e: 0x2541, 0x1d8f: 0x2549, 0x1d90: 0x2551, 0x1d91: 0x2479, + 0x1d92: 0x2481, 0x1d93: 0x02a9, 0x1d94: 0x2489, 0x1d95: 0x02b1, 0x1d96: 0x2491, 0x1d97: 0x2499, + 0x1d98: 0x24a1, 0x1d99: 0x24a9, 0x1d9a: 0x24b1, 0x1d9b: 0x24b9, 0x1d9c: 0x02b9, 0x1d9d: 0x24c9, + 0x1d9e: 0x02c1, 0x1d9f: 0x24d9, 0x1da0: 0x24e1, 0x1da1: 0x24e9, 0x1da2: 0x24f1, 0x1da3: 0x24f9, + 0x1da4: 0x2501, 0x1da5: 0x02d1, 0x1da6: 0x2509, 0x1da7: 0x2559, 0x1da8: 0x2531, 0x1da9: 0x2561, + 0x1daa: 0x2569, 0x1dab: 0x2571, 0x1dac: 0x2579, 0x1dad: 0x2581, 0x1dae: 0x0040, 0x1daf: 0x0040, + 0x1db0: 0x0040, 0x1db1: 0x0040, 0x1db2: 0x0040, 0x1db3: 0x0040, 0x1db4: 0x0040, 0x1db5: 0x0040, + 0x1db6: 0x0040, 0x1db7: 0x0040, 0x1db8: 0x0040, 0x1db9: 0x0040, 0x1dba: 0x0040, 0x1dbb: 0x0040, + 0x1dbc: 0x0040, 0x1dbd: 0x0040, 0x1dbe: 0x0040, 0x1dbf: 0x0040, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0xe115, 0x1dc1: 0xe115, 0x1dc2: 0xe135, 0x1dc3: 0xe135, 0x1dc4: 0xe115, 0x1dc5: 0xe115, + 0x1dc6: 0xe175, 0x1dc7: 0xe175, 0x1dc8: 0xe115, 0x1dc9: 0xe115, 0x1dca: 0xe135, 0x1dcb: 0xe135, + 0x1dcc: 0xe115, 0x1dcd: 0xe115, 0x1dce: 0xe1f5, 0x1dcf: 0xe1f5, 0x1dd0: 0xe115, 0x1dd1: 0xe115, + 0x1dd2: 0xe135, 0x1dd3: 0xe135, 0x1dd4: 0xe115, 0x1dd5: 0xe115, 0x1dd6: 0xe175, 0x1dd7: 0xe175, + 0x1dd8: 0xe115, 0x1dd9: 0xe115, 0x1dda: 0xe135, 0x1ddb: 0xe135, 0x1ddc: 0xe115, 0x1ddd: 0xe115, + 0x1dde: 0x8ca5, 0x1ddf: 0x8ca5, 0x1de0: 0x04b5, 0x1de1: 0x04b5, 0x1de2: 0x0a08, 0x1de3: 0x0a08, + 0x1de4: 0x0a08, 0x1de5: 0x0a08, 0x1de6: 0x0a08, 0x1de7: 0x0a08, 0x1de8: 0x0a08, 0x1de9: 0x0a08, + 0x1dea: 0x0a08, 0x1deb: 0x0a08, 0x1dec: 0x0a08, 0x1ded: 0x0a08, 0x1dee: 0x0a08, 0x1def: 0x0a08, + 0x1df0: 0x0a08, 0x1df1: 0x0a08, 0x1df2: 0x0a08, 0x1df3: 0x0a08, 0x1df4: 0x0a08, 0x1df5: 0x0a08, + 0x1df6: 0x0a08, 0x1df7: 0x0a08, 0x1df8: 0x0a08, 0x1df9: 0x0a08, 0x1dfa: 0x0a08, 0x1dfb: 0x0a08, + 0x1dfc: 0x0a08, 0x1dfd: 0x0a08, 0x1dfe: 0x0a08, 0x1dff: 0x0a08, + // Block 0x78, offset 0x1e00 + 0x1e00: 0x20b1, 0x1e01: 0x20b9, 0x1e02: 0x20d9, 0x1e03: 0x20f1, 0x1e04: 0x0040, 0x1e05: 0x2189, + 0x1e06: 0x2109, 0x1e07: 0x20e1, 0x1e08: 0x2131, 0x1e09: 0x2191, 0x1e0a: 0x2161, 0x1e0b: 0x2169, + 0x1e0c: 0x2171, 0x1e0d: 0x2179, 0x1e0e: 0x2111, 0x1e0f: 0x2141, 0x1e10: 0x2151, 0x1e11: 0x2121, + 0x1e12: 0x2159, 0x1e13: 0x2101, 0x1e14: 0x2119, 0x1e15: 0x20c9, 0x1e16: 0x20d1, 0x1e17: 0x20e9, + 0x1e18: 0x20f9, 0x1e19: 0x2129, 0x1e1a: 0x2139, 0x1e1b: 0x2149, 0x1e1c: 0x2589, 0x1e1d: 0x1689, + 0x1e1e: 0x2591, 0x1e1f: 0x2599, 0x1e20: 0x0040, 0x1e21: 0x20b9, 0x1e22: 0x20d9, 0x1e23: 0x0040, + 0x1e24: 0x2181, 0x1e25: 0x0040, 0x1e26: 0x0040, 0x1e27: 0x20e1, 0x1e28: 0x0040, 0x1e29: 0x2191, + 0x1e2a: 0x2161, 0x1e2b: 0x2169, 0x1e2c: 0x2171, 0x1e2d: 0x2179, 0x1e2e: 0x2111, 0x1e2f: 0x2141, + 0x1e30: 0x2151, 0x1e31: 0x2121, 0x1e32: 0x2159, 0x1e33: 0x0040, 0x1e34: 0x2119, 0x1e35: 0x20c9, + 0x1e36: 0x20d1, 0x1e37: 0x20e9, 0x1e38: 0x0040, 0x1e39: 0x2129, 0x1e3a: 0x0040, 0x1e3b: 0x2149, + 0x1e3c: 0x0040, 0x1e3d: 0x0040, 0x1e3e: 0x0040, 0x1e3f: 0x0040, + // Block 0x79, offset 0x1e40 + 0x1e40: 0x0040, 0x1e41: 0x0040, 0x1e42: 0x20d9, 0x1e43: 0x0040, 0x1e44: 0x0040, 0x1e45: 0x0040, + 0x1e46: 0x0040, 0x1e47: 0x20e1, 0x1e48: 0x0040, 0x1e49: 0x2191, 0x1e4a: 0x0040, 0x1e4b: 0x2169, + 0x1e4c: 0x0040, 0x1e4d: 0x2179, 0x1e4e: 0x2111, 0x1e4f: 0x2141, 0x1e50: 0x0040, 0x1e51: 0x2121, + 0x1e52: 0x2159, 0x1e53: 0x0040, 0x1e54: 0x2119, 0x1e55: 0x0040, 0x1e56: 0x0040, 0x1e57: 0x20e9, + 0x1e58: 0x0040, 0x1e59: 0x2129, 0x1e5a: 0x0040, 0x1e5b: 0x2149, 0x1e5c: 0x0040, 0x1e5d: 0x1689, + 0x1e5e: 0x0040, 0x1e5f: 0x2599, 0x1e60: 0x0040, 0x1e61: 0x20b9, 0x1e62: 0x20d9, 0x1e63: 0x0040, + 0x1e64: 0x2181, 0x1e65: 0x0040, 0x1e66: 0x0040, 0x1e67: 0x20e1, 0x1e68: 0x2131, 0x1e69: 0x2191, + 0x1e6a: 0x2161, 0x1e6b: 0x0040, 0x1e6c: 0x2171, 0x1e6d: 0x2179, 0x1e6e: 0x2111, 0x1e6f: 0x2141, + 0x1e70: 0x2151, 0x1e71: 0x2121, 0x1e72: 0x2159, 0x1e73: 0x0040, 0x1e74: 0x2119, 0x1e75: 0x20c9, + 0x1e76: 0x20d1, 0x1e77: 0x20e9, 0x1e78: 0x0040, 0x1e79: 0x2129, 0x1e7a: 0x2139, 0x1e7b: 0x2149, + 0x1e7c: 0x2589, 0x1e7d: 0x0040, 0x1e7e: 0x2591, 0x1e7f: 0x0040, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x20b1, 0x1e81: 0x20b9, 0x1e82: 0x20d9, 0x1e83: 0x20f1, 0x1e84: 0x2181, 0x1e85: 0x2189, + 0x1e86: 0x2109, 0x1e87: 0x20e1, 0x1e88: 0x2131, 0x1e89: 0x2191, 0x1e8a: 0x0040, 0x1e8b: 0x2169, + 0x1e8c: 0x2171, 0x1e8d: 0x2179, 0x1e8e: 0x2111, 0x1e8f: 0x2141, 0x1e90: 0x2151, 0x1e91: 0x2121, + 0x1e92: 0x2159, 0x1e93: 0x2101, 0x1e94: 0x2119, 0x1e95: 0x20c9, 0x1e96: 0x20d1, 0x1e97: 0x20e9, + 0x1e98: 0x20f9, 0x1e99: 0x2129, 0x1e9a: 0x2139, 0x1e9b: 0x2149, 0x1e9c: 0x0040, 0x1e9d: 0x0040, + 0x1e9e: 0x0040, 0x1e9f: 0x0040, 0x1ea0: 0x0040, 0x1ea1: 0x20b9, 0x1ea2: 0x20d9, 0x1ea3: 0x20f1, + 0x1ea4: 0x0040, 0x1ea5: 0x2189, 0x1ea6: 0x2109, 0x1ea7: 0x20e1, 0x1ea8: 0x2131, 0x1ea9: 0x2191, + 0x1eaa: 0x0040, 0x1eab: 0x2169, 0x1eac: 0x2171, 0x1ead: 0x2179, 0x1eae: 0x2111, 0x1eaf: 0x2141, + 0x1eb0: 0x2151, 0x1eb1: 0x2121, 0x1eb2: 0x2159, 0x1eb3: 0x2101, 0x1eb4: 0x2119, 0x1eb5: 0x20c9, + 0x1eb6: 0x20d1, 0x1eb7: 0x20e9, 0x1eb8: 0x20f9, 0x1eb9: 0x2129, 0x1eba: 0x2139, 0x1ebb: 0x2149, + 0x1ebc: 0x0040, 0x1ebd: 0x0040, 0x1ebe: 0x0040, 0x1ebf: 0x0040, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x0040, 0x1ec1: 0x25a2, 0x1ec2: 0x25aa, 0x1ec3: 0x25b2, 0x1ec4: 0x25ba, 0x1ec5: 0x25c2, + 0x1ec6: 0x25ca, 0x1ec7: 0x25d2, 0x1ec8: 0x25da, 0x1ec9: 0x25e2, 0x1eca: 0x25ea, 0x1ecb: 0x0018, + 0x1ecc: 0x0018, 0x1ecd: 0x0018, 0x1ece: 0x0018, 0x1ecf: 0x0018, 0x1ed0: 0x25f2, 0x1ed1: 0x25fa, + 0x1ed2: 0x2602, 0x1ed3: 0x260a, 0x1ed4: 0x2612, 0x1ed5: 0x261a, 0x1ed6: 0x2622, 0x1ed7: 0x262a, + 0x1ed8: 0x2632, 0x1ed9: 0x263a, 0x1eda: 0x2642, 0x1edb: 0x264a, 0x1edc: 0x2652, 0x1edd: 0x265a, + 0x1ede: 0x2662, 0x1edf: 0x266a, 0x1ee0: 0x2672, 0x1ee1: 0x267a, 0x1ee2: 0x2682, 0x1ee3: 0x268a, + 0x1ee4: 0x2692, 0x1ee5: 0x269a, 0x1ee6: 0x26a2, 0x1ee7: 0x26aa, 0x1ee8: 0x26b2, 0x1ee9: 0x26ba, + 0x1eea: 0x26c1, 0x1eeb: 0x03d9, 0x1eec: 0x00b9, 0x1eed: 0x1239, 0x1eee: 0x26c9, 0x1eef: 0x0018, + 0x1ef0: 0x0019, 0x1ef1: 0x02e9, 0x1ef2: 0x03d9, 0x1ef3: 0x02f1, 0x1ef4: 0x02f9, 0x1ef5: 0x03f1, + 0x1ef6: 0x0309, 0x1ef7: 0x00a9, 0x1ef8: 0x0311, 0x1ef9: 0x00b1, 0x1efa: 0x0319, 0x1efb: 0x0101, + 0x1efc: 0x0321, 0x1efd: 0x0329, 0x1efe: 0x0051, 0x1eff: 0x0339, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0x0751, 0x1f01: 0x00b9, 0x1f02: 0x0089, 0x1f03: 0x0341, 0x1f04: 0x0349, 0x1f05: 0x0391, + 0x1f06: 0x00c1, 0x1f07: 0x0109, 0x1f08: 0x00c9, 0x1f09: 0x04b1, 0x1f0a: 0x26d1, 0x1f0b: 0x11f9, + 0x1f0c: 0x26d9, 0x1f0d: 0x04d9, 0x1f0e: 0x26e1, 0x1f0f: 0x26e9, 0x1f10: 0x0018, 0x1f11: 0x0018, + 0x1f12: 0x0018, 0x1f13: 0x0018, 0x1f14: 0x0018, 0x1f15: 0x0018, 0x1f16: 0x0018, 0x1f17: 0x0018, + 0x1f18: 0x0018, 0x1f19: 0x0018, 0x1f1a: 0x0018, 0x1f1b: 0x0018, 0x1f1c: 0x0018, 0x1f1d: 0x0018, + 0x1f1e: 0x0018, 0x1f1f: 0x0018, 0x1f20: 0x0018, 0x1f21: 0x0018, 0x1f22: 0x0018, 0x1f23: 0x0018, + 0x1f24: 0x0018, 0x1f25: 0x0018, 0x1f26: 0x0018, 0x1f27: 0x0018, 0x1f28: 0x0018, 0x1f29: 0x0018, + 0x1f2a: 0x26f1, 0x1f2b: 0x26f9, 0x1f2c: 0x2701, 0x1f2d: 0x0018, 0x1f2e: 0x0018, 0x1f2f: 0x0018, + 0x1f30: 0x0018, 0x1f31: 0x0018, 0x1f32: 0x0018, 0x1f33: 0x0018, 0x1f34: 0x0018, 0x1f35: 0x0018, + 0x1f36: 0x0018, 0x1f37: 0x0018, 0x1f38: 0x0018, 0x1f39: 0x0018, 0x1f3a: 0x0018, 0x1f3b: 0x0018, + 0x1f3c: 0x0018, 0x1f3d: 0x0018, 0x1f3e: 0x0018, 0x1f3f: 0x0018, + // Block 0x7d, offset 0x1f40 + 0x1f40: 0x2711, 0x1f41: 0x2719, 0x1f42: 0x2721, 0x1f43: 0x0040, 0x1f44: 0x0040, 0x1f45: 0x0040, + 0x1f46: 0x0040, 0x1f47: 0x0040, 0x1f48: 0x0040, 0x1f49: 0x0040, 0x1f4a: 0x0040, 0x1f4b: 0x0040, + 0x1f4c: 0x0040, 0x1f4d: 0x0040, 0x1f4e: 0x0040, 0x1f4f: 0x0040, 0x1f50: 0x2729, 0x1f51: 0x2731, + 0x1f52: 0x2739, 0x1f53: 0x2741, 0x1f54: 0x2749, 0x1f55: 0x2751, 0x1f56: 0x2759, 0x1f57: 0x2761, + 0x1f58: 0x2769, 0x1f59: 0x2771, 0x1f5a: 0x2779, 0x1f5b: 0x2781, 0x1f5c: 0x2789, 0x1f5d: 0x2791, + 0x1f5e: 0x2799, 0x1f5f: 0x27a1, 0x1f60: 0x27a9, 0x1f61: 0x27b1, 0x1f62: 0x27b9, 0x1f63: 0x27c1, + 0x1f64: 0x27c9, 0x1f65: 0x27d1, 0x1f66: 0x27d9, 0x1f67: 0x27e1, 0x1f68: 0x27e9, 0x1f69: 0x27f1, + 0x1f6a: 0x27f9, 0x1f6b: 0x2801, 0x1f6c: 0x2809, 0x1f6d: 0x2811, 0x1f6e: 0x2819, 0x1f6f: 0x2821, + 0x1f70: 0x2829, 0x1f71: 0x2831, 0x1f72: 0x2839, 0x1f73: 0x2841, 0x1f74: 0x2849, 0x1f75: 0x2851, + 0x1f76: 0x2859, 0x1f77: 0x2861, 0x1f78: 0x2869, 0x1f79: 0x2871, 0x1f7a: 0x2879, 0x1f7b: 0x2881, + 0x1f7c: 0x0040, 0x1f7d: 0x0040, 0x1f7e: 0x0040, 0x1f7f: 0x0040, + // Block 0x7e, offset 0x1f80 + 0x1f80: 0x28e1, 0x1f81: 0x28e9, 0x1f82: 0x28f1, 0x1f83: 0x8cbd, 0x1f84: 0x28f9, 0x1f85: 0x2901, + 0x1f86: 0x2909, 0x1f87: 0x2911, 0x1f88: 0x2919, 0x1f89: 0x2921, 0x1f8a: 0x2929, 0x1f8b: 0x2931, + 0x1f8c: 0x2939, 0x1f8d: 0x8cdd, 0x1f8e: 0x2941, 0x1f8f: 0x2949, 0x1f90: 0x2951, 0x1f91: 0x2959, + 0x1f92: 0x8cfd, 0x1f93: 0x2961, 0x1f94: 0x2969, 0x1f95: 0x2799, 0x1f96: 0x8d1d, 0x1f97: 0x2971, + 0x1f98: 0x2979, 0x1f99: 0x2981, 0x1f9a: 0x2989, 0x1f9b: 0x2991, 0x1f9c: 0x8d3d, 0x1f9d: 0x2999, + 0x1f9e: 0x29a1, 0x1f9f: 0x29a9, 0x1fa0: 0x29b1, 0x1fa1: 0x29b9, 0x1fa2: 0x2871, 0x1fa3: 0x29c1, + 0x1fa4: 0x29c9, 0x1fa5: 0x29d1, 0x1fa6: 0x29d9, 0x1fa7: 0x29e1, 0x1fa8: 0x29e9, 0x1fa9: 0x29f1, + 0x1faa: 0x29f9, 0x1fab: 0x2a01, 0x1fac: 0x2a09, 0x1fad: 0x2a11, 0x1fae: 0x2a19, 0x1faf: 0x2a21, + 0x1fb0: 0x2a29, 0x1fb1: 0x2a31, 0x1fb2: 0x2a31, 0x1fb3: 0x2a31, 0x1fb4: 0x8d5d, 0x1fb5: 0x2a39, + 0x1fb6: 0x2a41, 0x1fb7: 0x2a49, 0x1fb8: 0x8d7d, 0x1fb9: 0x2a51, 0x1fba: 0x2a59, 0x1fbb: 0x2a61, + 0x1fbc: 0x2a69, 0x1fbd: 0x2a71, 0x1fbe: 0x2a79, 0x1fbf: 0x2a81, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x2a89, 0x1fc1: 0x2a91, 0x1fc2: 0x2a99, 0x1fc3: 0x2aa1, 0x1fc4: 0x2aa9, 0x1fc5: 0x2ab1, + 0x1fc6: 0x2ab1, 0x1fc7: 0x2ab9, 0x1fc8: 0x2ac1, 0x1fc9: 0x2ac9, 0x1fca: 0x2ad1, 0x1fcb: 0x2ad9, + 0x1fcc: 0x2ae1, 0x1fcd: 0x2ae9, 0x1fce: 0x2af1, 0x1fcf: 0x2af9, 0x1fd0: 0x2b01, 0x1fd1: 0x2b09, + 0x1fd2: 0x2b11, 0x1fd3: 0x2b19, 0x1fd4: 0x2b21, 0x1fd5: 0x2b29, 0x1fd6: 0x2b31, 0x1fd7: 0x2b39, + 0x1fd8: 0x2b41, 0x1fd9: 0x8d9d, 0x1fda: 0x2b49, 0x1fdb: 0x2b51, 0x1fdc: 0x2b59, 0x1fdd: 0x2751, + 0x1fde: 0x2b61, 0x1fdf: 0x2b69, 0x1fe0: 0x8dbd, 0x1fe1: 0x8ddd, 0x1fe2: 0x2b71, 0x1fe3: 0x2b79, + 0x1fe4: 0x2b81, 0x1fe5: 0x2b89, 0x1fe6: 0x2b91, 0x1fe7: 0x2b99, 0x1fe8: 0x2040, 0x1fe9: 0x2ba1, + 0x1fea: 0x2ba9, 0x1feb: 0x2ba9, 0x1fec: 0x8dfd, 0x1fed: 0x2bb1, 0x1fee: 0x2bb9, 0x1fef: 0x2bc1, + 0x1ff0: 0x2bc9, 0x1ff1: 0x8e1d, 0x1ff2: 0x2bd1, 0x1ff3: 0x2bd9, 0x1ff4: 0x2040, 0x1ff5: 0x2be1, + 0x1ff6: 0x2be9, 0x1ff7: 0x2bf1, 0x1ff8: 0x2bf9, 0x1ff9: 0x2c01, 0x1ffa: 0x2c09, 0x1ffb: 0x8e3d, + 0x1ffc: 0x2c11, 0x1ffd: 0x8e5d, 0x1ffe: 0x2c19, 0x1fff: 0x2c21, + // Block 0x80, offset 0x2000 + 0x2000: 0x2c29, 0x2001: 0x2c31, 0x2002: 0x2c39, 0x2003: 0x2c41, 0x2004: 0x2c49, 0x2005: 0x2c51, + 0x2006: 0x2c59, 0x2007: 0x2c61, 0x2008: 0x2c69, 0x2009: 0x8e7d, 0x200a: 0x2c71, 0x200b: 0x2c79, + 0x200c: 0x2c81, 0x200d: 0x2c89, 0x200e: 0x2c91, 0x200f: 0x8e9d, 0x2010: 0x2c99, 0x2011: 0x8ebd, + 0x2012: 0x8edd, 0x2013: 0x2ca1, 0x2014: 0x2ca9, 0x2015: 0x2ca9, 0x2016: 0x2cb1, 0x2017: 0x8efd, + 0x2018: 0x8f1d, 0x2019: 0x2cb9, 0x201a: 0x2cc1, 0x201b: 0x2cc9, 0x201c: 0x2cd1, 0x201d: 0x2cd9, + 0x201e: 0x2ce1, 0x201f: 0x2ce9, 0x2020: 0x2cf1, 0x2021: 0x2cf9, 0x2022: 0x2d01, 0x2023: 0x2d09, + 0x2024: 0x8f3d, 0x2025: 0x2d11, 0x2026: 0x2d19, 0x2027: 0x2d21, 0x2028: 0x2d29, 0x2029: 0x2d21, + 0x202a: 0x2d31, 0x202b: 0x2d39, 0x202c: 0x2d41, 0x202d: 0x2d49, 0x202e: 0x2d51, 0x202f: 0x2d59, + 0x2030: 0x2d61, 0x2031: 0x2d69, 0x2032: 0x2d71, 0x2033: 0x2d79, 0x2034: 0x2d81, 0x2035: 0x2d89, + 0x2036: 0x2d91, 0x2037: 0x2d99, 0x2038: 0x8f5d, 0x2039: 0x2da1, 0x203a: 0x2da9, 0x203b: 0x2db1, + 0x203c: 0x2db9, 0x203d: 0x2dc1, 0x203e: 0x8f7d, 0x203f: 0x2dc9, + // Block 0x81, offset 0x2040 + 0x2040: 0x2dd1, 0x2041: 0x2dd9, 0x2042: 0x2de1, 0x2043: 0x2de9, 0x2044: 0x2df1, 0x2045: 0x2df9, + 0x2046: 0x2e01, 0x2047: 0x2e09, 0x2048: 0x2e11, 0x2049: 0x2e19, 0x204a: 0x8f9d, 0x204b: 0x2e21, + 0x204c: 0x2e29, 0x204d: 0x2e31, 0x204e: 0x2e39, 0x204f: 0x2e41, 0x2050: 0x2e49, 0x2051: 0x2e51, + 0x2052: 0x2e59, 0x2053: 0x2e61, 0x2054: 0x2e69, 0x2055: 0x2e71, 0x2056: 0x2e79, 0x2057: 0x2e81, + 0x2058: 0x2e89, 0x2059: 0x2e91, 0x205a: 0x2e99, 0x205b: 0x2ea1, 0x205c: 0x2ea9, 0x205d: 0x8fbd, + 0x205e: 0x2eb1, 0x205f: 0x2eb9, 0x2060: 0x2ec1, 0x2061: 0x2ec9, 0x2062: 0x2ed1, 0x2063: 0x8fdd, + 0x2064: 0x2ed9, 0x2065: 0x2ee1, 0x2066: 0x2ee9, 0x2067: 0x2ef1, 0x2068: 0x2ef9, 0x2069: 0x2f01, + 0x206a: 0x2f09, 0x206b: 0x2f11, 0x206c: 0x7f0d, 0x206d: 0x2f19, 0x206e: 0x2f21, 0x206f: 0x2f29, + 0x2070: 0x8ffd, 0x2071: 0x2f31, 0x2072: 0x2f39, 0x2073: 0x2f41, 0x2074: 0x2f49, 0x2075: 0x2f51, + 0x2076: 0x2f59, 0x2077: 0x901d, 0x2078: 0x903d, 0x2079: 0x905d, 0x207a: 0x2f61, 0x207b: 0x907d, + 0x207c: 0x2f69, 0x207d: 0x2f71, 0x207e: 0x2f79, 0x207f: 0x2f81, + // Block 0x82, offset 0x2080 + 0x2080: 0x2f89, 0x2081: 0x2f91, 0x2082: 0x2f99, 0x2083: 0x2fa1, 0x2084: 0x2fa9, 0x2085: 0x2fb1, + 0x2086: 0x909d, 0x2087: 0x2fb9, 0x2088: 0x2fc1, 0x2089: 0x2fc9, 0x208a: 0x2fd1, 0x208b: 0x2fd9, + 0x208c: 0x2fe1, 0x208d: 0x90bd, 0x208e: 0x2fe9, 0x208f: 0x2ff1, 0x2090: 0x90dd, 0x2091: 0x90fd, + 0x2092: 0x2ff9, 0x2093: 0x3001, 0x2094: 0x3009, 0x2095: 0x3011, 0x2096: 0x3019, 0x2097: 0x3021, + 0x2098: 0x3029, 0x2099: 0x3031, 0x209a: 0x3039, 0x209b: 0x911d, 0x209c: 0x3041, 0x209d: 0x913d, + 0x209e: 0x3049, 0x209f: 0x2040, 0x20a0: 0x3051, 0x20a1: 0x3059, 0x20a2: 0x3061, 0x20a3: 0x915d, + 0x20a4: 0x3069, 0x20a5: 0x3071, 0x20a6: 0x917d, 0x20a7: 0x919d, 0x20a8: 0x3079, 0x20a9: 0x3081, + 0x20aa: 0x3089, 0x20ab: 0x3091, 0x20ac: 0x3099, 0x20ad: 0x3099, 0x20ae: 0x30a1, 0x20af: 0x30a9, + 0x20b0: 0x30b1, 0x20b1: 0x30b9, 0x20b2: 0x30c1, 0x20b3: 0x30c9, 0x20b4: 0x30d1, 0x20b5: 0x91bd, + 0x20b6: 0x30d9, 0x20b7: 0x91dd, 0x20b8: 0x30e1, 0x20b9: 0x91fd, 0x20ba: 0x30e9, 0x20bb: 0x921d, + 0x20bc: 0x923d, 0x20bd: 0x925d, 0x20be: 0x30f1, 0x20bf: 0x30f9, + // Block 0x83, offset 0x20c0 + 0x20c0: 0x3101, 0x20c1: 0x927d, 0x20c2: 0x929d, 0x20c3: 0x92bd, 0x20c4: 0x92dd, 0x20c5: 0x3109, + 0x20c6: 0x3111, 0x20c7: 0x3111, 0x20c8: 0x3119, 0x20c9: 0x3121, 0x20ca: 0x3129, 0x20cb: 0x3131, + 0x20cc: 0x3139, 0x20cd: 0x92fd, 0x20ce: 0x3141, 0x20cf: 0x3149, 0x20d0: 0x3151, 0x20d1: 0x3159, + 0x20d2: 0x931d, 0x20d3: 0x3161, 0x20d4: 0x933d, 0x20d5: 0x935d, 0x20d6: 0x3169, 0x20d7: 0x3171, + 0x20d8: 0x3179, 0x20d9: 0x3181, 0x20da: 0x3189, 0x20db: 0x3191, 0x20dc: 0x937d, 0x20dd: 0x939d, + 0x20de: 0x93bd, 0x20df: 0x2040, 0x20e0: 0x3199, 0x20e1: 0x93dd, 0x20e2: 0x31a1, 0x20e3: 0x31a9, + 0x20e4: 0x31b1, 0x20e5: 0x93fd, 0x20e6: 0x31b9, 0x20e7: 0x31c1, 0x20e8: 0x31c9, 0x20e9: 0x31d1, + 0x20ea: 0x31d9, 0x20eb: 0x941d, 0x20ec: 0x31e1, 0x20ed: 0x31e9, 0x20ee: 0x31f1, 0x20ef: 0x31f9, + 0x20f0: 0x3201, 0x20f1: 0x3209, 0x20f2: 0x943d, 0x20f3: 0x945d, 0x20f4: 0x3211, 0x20f5: 0x947d, + 0x20f6: 0x3219, 0x20f7: 0x949d, 0x20f8: 0x3221, 0x20f9: 0x3229, 0x20fa: 0x3231, 0x20fb: 0x94bd, + 0x20fc: 0x94dd, 0x20fd: 0x3239, 0x20fe: 0x94fd, 0x20ff: 0x3241, + // Block 0x84, offset 0x2100 + 0x2100: 0x951d, 0x2101: 0x3249, 0x2102: 0x3251, 0x2103: 0x3259, 0x2104: 0x3261, 0x2105: 0x3269, + 0x2106: 0x3271, 0x2107: 0x953d, 0x2108: 0x955d, 0x2109: 0x957d, 0x210a: 0x959d, 0x210b: 0x2ca1, + 0x210c: 0x3279, 0x210d: 0x3281, 0x210e: 0x3289, 0x210f: 0x3291, 0x2110: 0x3299, 0x2111: 0x32a1, + 0x2112: 0x32a9, 0x2113: 0x32b1, 0x2114: 0x32b9, 0x2115: 0x32c1, 0x2116: 0x32c9, 0x2117: 0x95bd, + 0x2118: 0x32d1, 0x2119: 0x32d9, 0x211a: 0x32e1, 0x211b: 0x32e9, 0x211c: 0x32f1, 0x211d: 0x32f9, + 0x211e: 0x3301, 0x211f: 0x3309, 0x2120: 0x3311, 0x2121: 0x3319, 0x2122: 0x3321, 0x2123: 0x3329, + 0x2124: 0x95dd, 0x2125: 0x95fd, 0x2126: 0x961d, 0x2127: 0x3331, 0x2128: 0x3339, 0x2129: 0x3341, + 0x212a: 0x3349, 0x212b: 0x963d, 0x212c: 0x3351, 0x212d: 0x965d, 0x212e: 0x3359, 0x212f: 0x3361, + 0x2130: 0x967d, 0x2131: 0x969d, 0x2132: 0x3369, 0x2133: 0x3371, 0x2134: 0x3379, 0x2135: 0x3381, + 0x2136: 0x3389, 0x2137: 0x3391, 0x2138: 0x3399, 0x2139: 0x33a1, 0x213a: 0x33a9, 0x213b: 0x33b1, + 0x213c: 0x33b9, 0x213d: 0x33c1, 0x213e: 0x33c9, 0x213f: 0x2040, + // Block 0x85, offset 0x2140 + 0x2140: 0x33d1, 0x2141: 0x33d9, 0x2142: 0x33e1, 0x2143: 0x33e9, 0x2144: 0x33f1, 0x2145: 0x96bd, + 0x2146: 0x33f9, 0x2147: 0x3401, 0x2148: 0x3409, 0x2149: 0x3411, 0x214a: 0x3419, 0x214b: 0x96dd, + 0x214c: 0x96fd, 0x214d: 0x3421, 0x214e: 0x3429, 0x214f: 0x3431, 0x2150: 0x3439, 0x2151: 0x3441, + 0x2152: 0x3449, 0x2153: 0x971d, 0x2154: 0x3451, 0x2155: 0x3459, 0x2156: 0x3461, 0x2157: 0x3469, + 0x2158: 0x973d, 0x2159: 0x975d, 0x215a: 0x3471, 0x215b: 0x3479, 0x215c: 0x3481, 0x215d: 0x977d, + 0x215e: 0x3489, 0x215f: 0x3491, 0x2160: 0x684d, 0x2161: 0x979d, 0x2162: 0x3499, 0x2163: 0x34a1, + 0x2164: 0x34a9, 0x2165: 0x97bd, 0x2166: 0x34b1, 0x2167: 0x34b9, 0x2168: 0x34c1, 0x2169: 0x34c9, + 0x216a: 0x34d1, 0x216b: 0x34d9, 0x216c: 0x34e1, 0x216d: 0x97dd, 0x216e: 0x34e9, 0x216f: 0x34f1, + 0x2170: 0x34f9, 0x2171: 0x97fd, 0x2172: 0x3501, 0x2173: 0x3509, 0x2174: 0x3511, 0x2175: 0x3519, + 0x2176: 0x7b6d, 0x2177: 0x981d, 0x2178: 0x3521, 0x2179: 0x3529, 0x217a: 0x3531, 0x217b: 0x983d, + 0x217c: 0x3539, 0x217d: 0x985d, 0x217e: 0x3541, 0x217f: 0x3541, + // Block 0x86, offset 0x2180 + 0x2180: 0x3549, 0x2181: 0x987d, 0x2182: 0x3551, 0x2183: 0x3559, 0x2184: 0x3561, 0x2185: 0x3569, + 0x2186: 0x3571, 0x2187: 0x3579, 0x2188: 0x3581, 0x2189: 0x989d, 0x218a: 0x3589, 0x218b: 0x3591, + 0x218c: 0x3599, 0x218d: 0x35a1, 0x218e: 0x35a9, 0x218f: 0x35b1, 0x2190: 0x98bd, 0x2191: 0x35b9, + 0x2192: 0x98dd, 0x2193: 0x98fd, 0x2194: 0x991d, 0x2195: 0x35c1, 0x2196: 0x35c9, 0x2197: 0x35d1, + 0x2198: 0x35d9, 0x2199: 0x35e1, 0x219a: 0x35e9, 0x219b: 0x35f1, 0x219c: 0x35f9, 0x219d: 0x993d, + 0x219e: 0x0040, 0x219f: 0x0040, 0x21a0: 0x0040, 0x21a1: 0x0040, 0x21a2: 0x0040, 0x21a3: 0x0040, + 0x21a4: 0x0040, 0x21a5: 0x0040, 0x21a6: 0x0040, 0x21a7: 0x0040, 0x21a8: 0x0040, 0x21a9: 0x0040, + 0x21aa: 0x0040, 0x21ab: 0x0040, 0x21ac: 0x0040, 0x21ad: 0x0040, 0x21ae: 0x0040, 0x21af: 0x0040, + 0x21b0: 0x0040, 0x21b1: 0x0040, 0x21b2: 0x0040, 0x21b3: 0x0040, 0x21b4: 0x0040, 0x21b5: 0x0040, + 0x21b6: 0x0040, 0x21b7: 0x0040, 0x21b8: 0x0040, 0x21b9: 0x0040, 0x21ba: 0x0040, 0x21bb: 0x0040, + 0x21bc: 0x0040, 0x21bd: 0x0040, 0x21be: 0x0040, 0x21bf: 0x0040, +} + +// idnaIndex: 39 blocks, 2496 entries, 4992 bytes +// Block 0 is the zero block. +var idnaIndex = [2496]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x85, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x04, 0xc7: 0x05, + 0xc8: 0x06, 0xc9: 0x86, 0xca: 0x87, 0xcb: 0x07, 0xcc: 0x88, 0xcd: 0x08, 0xce: 0x09, 0xcf: 0x0a, + 0xd0: 0x89, 0xd1: 0x0b, 0xd2: 0x0c, 0xd3: 0x0d, 0xd4: 0x0e, 0xd5: 0x8a, 0xd6: 0x8b, 0xd7: 0x8c, + 0xd8: 0x0f, 0xd9: 0x10, 0xda: 0x8d, 0xdb: 0x11, 0xdc: 0x12, 0xdd: 0x8e, 0xde: 0x8f, 0xdf: 0x90, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x07, 0xea: 0x08, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x09, 0xee: 0x0a, 0xef: 0x0b, + 0xf0: 0x20, 0xf1: 0x21, 0xf2: 0x21, 0xf3: 0x23, 0xf4: 0x24, + // Block 0x4, offset 0x100 + 0x120: 0x91, 0x121: 0x13, 0x122: 0x14, 0x123: 0x92, 0x124: 0x93, 0x125: 0x15, 0x126: 0x16, 0x127: 0x17, + 0x128: 0x18, 0x129: 0x19, 0x12a: 0x1a, 0x12b: 0x1b, 0x12c: 0x1c, 0x12d: 0x1d, 0x12e: 0x1e, 0x12f: 0x94, + 0x130: 0x95, 0x131: 0x1f, 0x132: 0x20, 0x133: 0x21, 0x134: 0x96, 0x135: 0x22, 0x136: 0x97, 0x137: 0x98, + 0x138: 0x99, 0x139: 0x9a, 0x13a: 0x23, 0x13b: 0x9b, 0x13c: 0x9c, 0x13d: 0x24, 0x13e: 0x25, 0x13f: 0x9d, + // Block 0x5, offset 0x140 + 0x140: 0x9e, 0x141: 0x9f, 0x142: 0xa0, 0x143: 0xa1, 0x144: 0xa2, 0x145: 0xa3, 0x146: 0xa4, 0x147: 0xa5, + 0x148: 0xa6, 0x149: 0xa7, 0x14a: 0xa8, 0x14b: 0xa9, 0x14c: 0xaa, 0x14d: 0xab, 0x14e: 0xac, 0x14f: 0xad, + 0x150: 0xae, 0x151: 0xa6, 0x152: 0xa6, 0x153: 0xa6, 0x154: 0xa6, 0x155: 0xa6, 0x156: 0xa6, 0x157: 0xa6, + 0x158: 0xa6, 0x159: 0xaf, 0x15a: 0xb0, 0x15b: 0xb1, 0x15c: 0xb2, 0x15d: 0xb3, 0x15e: 0xb4, 0x15f: 0xb5, + 0x160: 0xb6, 0x161: 0xb7, 0x162: 0xb8, 0x163: 0xb9, 0x164: 0xba, 0x165: 0xbb, 0x166: 0xbc, 0x167: 0xbd, + 0x168: 0xbe, 0x169: 0xbf, 0x16a: 0xc0, 0x16b: 0xc1, 0x16c: 0xc2, 0x16d: 0xc3, 0x16e: 0xc4, 0x16f: 0xc5, + 0x170: 0xc6, 0x171: 0xc7, 0x172: 0xc8, 0x173: 0xc9, 0x174: 0x26, 0x175: 0x27, 0x176: 0x28, 0x177: 0x88, + 0x178: 0x29, 0x179: 0x29, 0x17a: 0x2a, 0x17b: 0x29, 0x17c: 0xca, 0x17d: 0x2b, 0x17e: 0x2c, 0x17f: 0x2d, + // Block 0x6, offset 0x180 + 0x180: 0x2e, 0x181: 0x2f, 0x182: 0x30, 0x183: 0xcb, 0x184: 0x31, 0x185: 0x32, 0x186: 0xcc, 0x187: 0xa2, + 0x188: 0xcd, 0x189: 0xce, 0x18a: 0xa2, 0x18b: 0xa2, 0x18c: 0xcf, 0x18d: 0xa2, 0x18e: 0xa2, 0x18f: 0xa2, + 0x190: 0xd0, 0x191: 0x33, 0x192: 0x34, 0x193: 0x35, 0x194: 0xa2, 0x195: 0xa2, 0x196: 0xa2, 0x197: 0xa2, + 0x198: 0xa2, 0x199: 0xa2, 0x19a: 0xa2, 0x19b: 0xa2, 0x19c: 0xa2, 0x19d: 0xa2, 0x19e: 0xa2, 0x19f: 0xa2, + 0x1a0: 0xa2, 0x1a1: 0xa2, 0x1a2: 0xa2, 0x1a3: 0xa2, 0x1a4: 0xa2, 0x1a5: 0xa2, 0x1a6: 0xa2, 0x1a7: 0xa2, + 0x1a8: 0xd1, 0x1a9: 0xd2, 0x1aa: 0xa2, 0x1ab: 0xd3, 0x1ac: 0xa2, 0x1ad: 0xd4, 0x1ae: 0xd5, 0x1af: 0xa2, + 0x1b0: 0xd6, 0x1b1: 0x36, 0x1b2: 0x29, 0x1b3: 0x37, 0x1b4: 0xd7, 0x1b5: 0xd8, 0x1b6: 0xd9, 0x1b7: 0xda, + 0x1b8: 0xdb, 0x1b9: 0xdc, 0x1ba: 0xdd, 0x1bb: 0xde, 0x1bc: 0xdf, 0x1bd: 0xe0, 0x1be: 0xe1, 0x1bf: 0x38, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x39, 0x1c1: 0xe2, 0x1c2: 0xe3, 0x1c3: 0xe4, 0x1c4: 0xe5, 0x1c5: 0x3a, 0x1c6: 0x3b, 0x1c7: 0xe6, + 0x1c8: 0xe7, 0x1c9: 0x3c, 0x1ca: 0x3d, 0x1cb: 0x3e, 0x1cc: 0xe8, 0x1cd: 0xe9, 0x1ce: 0x3f, 0x1cf: 0x40, + 0x1d0: 0xa6, 0x1d1: 0xa6, 0x1d2: 0xa6, 0x1d3: 0xa6, 0x1d4: 0xa6, 0x1d5: 0xa6, 0x1d6: 0xa6, 0x1d7: 0xa6, + 0x1d8: 0xa6, 0x1d9: 0xa6, 0x1da: 0xa6, 0x1db: 0xa6, 0x1dc: 0xa6, 0x1dd: 0xa6, 0x1de: 0xa6, 0x1df: 0xa6, + 0x1e0: 0xa6, 0x1e1: 0xa6, 0x1e2: 0xa6, 0x1e3: 0xa6, 0x1e4: 0xa6, 0x1e5: 0xa6, 0x1e6: 0xa6, 0x1e7: 0xa6, + 0x1e8: 0xa6, 0x1e9: 0xa6, 0x1ea: 0xa6, 0x1eb: 0xa6, 0x1ec: 0xa6, 0x1ed: 0xa6, 0x1ee: 0xa6, 0x1ef: 0xa6, + 0x1f0: 0xa6, 0x1f1: 0xa6, 0x1f2: 0xa6, 0x1f3: 0xa6, 0x1f4: 0xa6, 0x1f5: 0xa6, 0x1f6: 0xa6, 0x1f7: 0xa6, + 0x1f8: 0xa6, 0x1f9: 0xa6, 0x1fa: 0xa6, 0x1fb: 0xa6, 0x1fc: 0xa6, 0x1fd: 0xa6, 0x1fe: 0xa6, 0x1ff: 0xa6, + // Block 0x8, offset 0x200 + 0x200: 0xa6, 0x201: 0xa6, 0x202: 0xa6, 0x203: 0xa6, 0x204: 0xa6, 0x205: 0xa6, 0x206: 0xa6, 0x207: 0xa6, + 0x208: 0xa6, 0x209: 0xa6, 0x20a: 0xa6, 0x20b: 0xa6, 0x20c: 0xa6, 0x20d: 0xa6, 0x20e: 0xa6, 0x20f: 0xa6, + 0x210: 0xa6, 0x211: 0xa6, 0x212: 0xa6, 0x213: 0xa6, 0x214: 0xa6, 0x215: 0xa6, 0x216: 0xa6, 0x217: 0xa6, + 0x218: 0xa6, 0x219: 0xa6, 0x21a: 0xa6, 0x21b: 0xa6, 0x21c: 0xa6, 0x21d: 0xa6, 0x21e: 0xa6, 0x21f: 0xa6, + 0x220: 0xa6, 0x221: 0xa6, 0x222: 0xa6, 0x223: 0xa6, 0x224: 0xa6, 0x225: 0xa6, 0x226: 0xa6, 0x227: 0xa6, + 0x228: 0xa6, 0x229: 0xa6, 0x22a: 0xa6, 0x22b: 0xa6, 0x22c: 0xa6, 0x22d: 0xa6, 0x22e: 0xa6, 0x22f: 0xa6, + 0x230: 0xa6, 0x231: 0xa6, 0x232: 0xa6, 0x233: 0xa6, 0x234: 0xa6, 0x235: 0xa6, 0x236: 0xa6, 0x237: 0xa2, + 0x238: 0xa6, 0x239: 0xa6, 0x23a: 0xa6, 0x23b: 0xa6, 0x23c: 0xa6, 0x23d: 0xa6, 0x23e: 0xa6, 0x23f: 0xa6, + // Block 0x9, offset 0x240 + 0x240: 0xa6, 0x241: 0xa6, 0x242: 0xa6, 0x243: 0xa6, 0x244: 0xa6, 0x245: 0xa6, 0x246: 0xa6, 0x247: 0xa6, + 0x248: 0xa6, 0x249: 0xa6, 0x24a: 0xa6, 0x24b: 0xa6, 0x24c: 0xa6, 0x24d: 0xa6, 0x24e: 0xa6, 0x24f: 0xa6, + 0x250: 0xa6, 0x251: 0xa6, 0x252: 0xa6, 0x253: 0xa6, 0x254: 0xa6, 0x255: 0xa6, 0x256: 0xa6, 0x257: 0xa6, + 0x258: 0xa6, 0x259: 0xa6, 0x25a: 0xa6, 0x25b: 0xa6, 0x25c: 0xa6, 0x25d: 0xa6, 0x25e: 0xa6, 0x25f: 0xa6, + 0x260: 0xa6, 0x261: 0xa6, 0x262: 0xa6, 0x263: 0xa6, 0x264: 0xa6, 0x265: 0xa6, 0x266: 0xa6, 0x267: 0xa6, + 0x268: 0xa6, 0x269: 0xa6, 0x26a: 0xa6, 0x26b: 0xa6, 0x26c: 0xa6, 0x26d: 0xa6, 0x26e: 0xa6, 0x26f: 0xa6, + 0x270: 0xa6, 0x271: 0xa6, 0x272: 0xa6, 0x273: 0xa6, 0x274: 0xa6, 0x275: 0xa6, 0x276: 0xa6, 0x277: 0xa6, + 0x278: 0xa6, 0x279: 0xa6, 0x27a: 0xa6, 0x27b: 0xa6, 0x27c: 0xa6, 0x27d: 0xa6, 0x27e: 0xa6, 0x27f: 0xa6, + // Block 0xa, offset 0x280 + 0x280: 0xa6, 0x281: 0xa6, 0x282: 0xa6, 0x283: 0xa6, 0x284: 0xa6, 0x285: 0xa6, 0x286: 0xa6, 0x287: 0xa6, + 0x288: 0xa6, 0x289: 0xa6, 0x28a: 0xa6, 0x28b: 0xa6, 0x28c: 0xa6, 0x28d: 0xa6, 0x28e: 0xa6, 0x28f: 0xa6, + 0x290: 0xa6, 0x291: 0xa6, 0x292: 0xea, 0x293: 0xeb, 0x294: 0xa6, 0x295: 0xa6, 0x296: 0xa6, 0x297: 0xa6, + 0x298: 0xec, 0x299: 0x41, 0x29a: 0x42, 0x29b: 0xed, 0x29c: 0x43, 0x29d: 0x44, 0x29e: 0x45, 0x29f: 0x46, + 0x2a0: 0xee, 0x2a1: 0xef, 0x2a2: 0xf0, 0x2a3: 0xf1, 0x2a4: 0xf2, 0x2a5: 0xf3, 0x2a6: 0xf4, 0x2a7: 0xf5, + 0x2a8: 0xf6, 0x2a9: 0xf7, 0x2aa: 0xf8, 0x2ab: 0xf9, 0x2ac: 0xfa, 0x2ad: 0xfb, 0x2ae: 0xfc, 0x2af: 0xfd, + 0x2b0: 0xa6, 0x2b1: 0xa6, 0x2b2: 0xa6, 0x2b3: 0xa6, 0x2b4: 0xa6, 0x2b5: 0xa6, 0x2b6: 0xa6, 0x2b7: 0xa6, + 0x2b8: 0xa6, 0x2b9: 0xa6, 0x2ba: 0xa6, 0x2bb: 0xa6, 0x2bc: 0xa6, 0x2bd: 0xa6, 0x2be: 0xa6, 0x2bf: 0xa6, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xa6, 0x2c1: 0xa6, 0x2c2: 0xa6, 0x2c3: 0xa6, 0x2c4: 0xa6, 0x2c5: 0xa6, 0x2c6: 0xa6, 0x2c7: 0xa6, + 0x2c8: 0xa6, 0x2c9: 0xa6, 0x2ca: 0xa6, 0x2cb: 0xa6, 0x2cc: 0xa6, 0x2cd: 0xa6, 0x2ce: 0xa6, 0x2cf: 0xa6, + 0x2d0: 0xa6, 0x2d1: 0xa6, 0x2d2: 0xa6, 0x2d3: 0xa6, 0x2d4: 0xa6, 0x2d5: 0xa6, 0x2d6: 0xa6, 0x2d7: 0xa6, + 0x2d8: 0xa6, 0x2d9: 0xa6, 0x2da: 0xa6, 0x2db: 0xa6, 0x2dc: 0xa6, 0x2dd: 0xa6, 0x2de: 0xfe, 0x2df: 0xff, + // Block 0xc, offset 0x300 + 0x300: 0x100, 0x301: 0x100, 0x302: 0x100, 0x303: 0x100, 0x304: 0x100, 0x305: 0x100, 0x306: 0x100, 0x307: 0x100, + 0x308: 0x100, 0x309: 0x100, 0x30a: 0x100, 0x30b: 0x100, 0x30c: 0x100, 0x30d: 0x100, 0x30e: 0x100, 0x30f: 0x100, + 0x310: 0x100, 0x311: 0x100, 0x312: 0x100, 0x313: 0x100, 0x314: 0x100, 0x315: 0x100, 0x316: 0x100, 0x317: 0x100, + 0x318: 0x100, 0x319: 0x100, 0x31a: 0x100, 0x31b: 0x100, 0x31c: 0x100, 0x31d: 0x100, 0x31e: 0x100, 0x31f: 0x100, + 0x320: 0x100, 0x321: 0x100, 0x322: 0x100, 0x323: 0x100, 0x324: 0x100, 0x325: 0x100, 0x326: 0x100, 0x327: 0x100, + 0x328: 0x100, 0x329: 0x100, 0x32a: 0x100, 0x32b: 0x100, 0x32c: 0x100, 0x32d: 0x100, 0x32e: 0x100, 0x32f: 0x100, + 0x330: 0x100, 0x331: 0x100, 0x332: 0x100, 0x333: 0x100, 0x334: 0x100, 0x335: 0x100, 0x336: 0x100, 0x337: 0x100, + 0x338: 0x100, 0x339: 0x100, 0x33a: 0x100, 0x33b: 0x100, 0x33c: 0x100, 0x33d: 0x100, 0x33e: 0x100, 0x33f: 0x100, + // Block 0xd, offset 0x340 + 0x340: 0x100, 0x341: 0x100, 0x342: 0x100, 0x343: 0x100, 0x344: 0x100, 0x345: 0x100, 0x346: 0x100, 0x347: 0x100, + 0x348: 0x100, 0x349: 0x100, 0x34a: 0x100, 0x34b: 0x100, 0x34c: 0x100, 0x34d: 0x100, 0x34e: 0x100, 0x34f: 0x100, + 0x350: 0x100, 0x351: 0x100, 0x352: 0x100, 0x353: 0x100, 0x354: 0x100, 0x355: 0x100, 0x356: 0x100, 0x357: 0x100, + 0x358: 0x100, 0x359: 0x100, 0x35a: 0x100, 0x35b: 0x100, 0x35c: 0x100, 0x35d: 0x100, 0x35e: 0x100, 0x35f: 0x100, + 0x360: 0x100, 0x361: 0x100, 0x362: 0x100, 0x363: 0x100, 0x364: 0x101, 0x365: 0x102, 0x366: 0x103, 0x367: 0x104, + 0x368: 0x47, 0x369: 0x105, 0x36a: 0x106, 0x36b: 0x48, 0x36c: 0x49, 0x36d: 0x4a, 0x36e: 0x4b, 0x36f: 0x4c, + 0x370: 0x107, 0x371: 0x4d, 0x372: 0x4e, 0x373: 0x4f, 0x374: 0x50, 0x375: 0x51, 0x376: 0x108, 0x377: 0x52, + 0x378: 0x53, 0x379: 0x54, 0x37a: 0x55, 0x37b: 0x56, 0x37c: 0x57, 0x37d: 0x58, 0x37e: 0x59, 0x37f: 0x5a, + // Block 0xe, offset 0x380 + 0x380: 0x109, 0x381: 0x10a, 0x382: 0xa6, 0x383: 0x10b, 0x384: 0x10c, 0x385: 0xa2, 0x386: 0x10d, 0x387: 0x10e, + 0x388: 0x100, 0x389: 0x100, 0x38a: 0x10f, 0x38b: 0x110, 0x38c: 0x111, 0x38d: 0x112, 0x38e: 0x113, 0x38f: 0x114, + 0x390: 0x115, 0x391: 0xa6, 0x392: 0x116, 0x393: 0x117, 0x394: 0x118, 0x395: 0x5b, 0x396: 0x5c, 0x397: 0x100, + 0x398: 0xa6, 0x399: 0xa6, 0x39a: 0xa6, 0x39b: 0xa6, 0x39c: 0x119, 0x39d: 0x11a, 0x39e: 0x5d, 0x39f: 0x100, + 0x3a0: 0x11b, 0x3a1: 0x11c, 0x3a2: 0x11d, 0x3a3: 0x11e, 0x3a4: 0x11f, 0x3a5: 0x100, 0x3a6: 0x120, 0x3a7: 0x121, + 0x3a8: 0x122, 0x3a9: 0x123, 0x3aa: 0x124, 0x3ab: 0x5e, 0x3ac: 0x125, 0x3ad: 0x126, 0x3ae: 0x5f, 0x3af: 0x100, + 0x3b0: 0x127, 0x3b1: 0x128, 0x3b2: 0x129, 0x3b3: 0x12a, 0x3b4: 0x12b, 0x3b5: 0x100, 0x3b6: 0x100, 0x3b7: 0x100, + 0x3b8: 0x100, 0x3b9: 0x12c, 0x3ba: 0x12d, 0x3bb: 0x12e, 0x3bc: 0x12f, 0x3bd: 0x130, 0x3be: 0x131, 0x3bf: 0x132, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x133, 0x3c1: 0x134, 0x3c2: 0x135, 0x3c3: 0x136, 0x3c4: 0x137, 0x3c5: 0x138, 0x3c6: 0x139, 0x3c7: 0x13a, + 0x3c8: 0x13b, 0x3c9: 0x13c, 0x3ca: 0x13d, 0x3cb: 0x13e, 0x3cc: 0x60, 0x3cd: 0x61, 0x3ce: 0x100, 0x3cf: 0x100, + 0x3d0: 0x13f, 0x3d1: 0x140, 0x3d2: 0x141, 0x3d3: 0x142, 0x3d4: 0x100, 0x3d5: 0x100, 0x3d6: 0x143, 0x3d7: 0x144, + 0x3d8: 0x145, 0x3d9: 0x146, 0x3da: 0x147, 0x3db: 0x148, 0x3dc: 0x149, 0x3dd: 0x14a, 0x3de: 0x100, 0x3df: 0x100, + 0x3e0: 0x14b, 0x3e1: 0x100, 0x3e2: 0x14c, 0x3e3: 0x14d, 0x3e4: 0x62, 0x3e5: 0x14e, 0x3e6: 0x14f, 0x3e7: 0x150, + 0x3e8: 0x151, 0x3e9: 0x152, 0x3ea: 0x153, 0x3eb: 0x154, 0x3ec: 0x155, 0x3ed: 0x100, 0x3ee: 0x100, 0x3ef: 0x100, + 0x3f0: 0x156, 0x3f1: 0x157, 0x3f2: 0x158, 0x3f3: 0x100, 0x3f4: 0x159, 0x3f5: 0x15a, 0x3f6: 0x15b, 0x3f7: 0x100, + 0x3f8: 0x100, 0x3f9: 0x100, 0x3fa: 0x100, 0x3fb: 0x15c, 0x3fc: 0x15d, 0x3fd: 0x15e, 0x3fe: 0x15f, 0x3ff: 0x160, + // Block 0x10, offset 0x400 + 0x400: 0xa6, 0x401: 0xa6, 0x402: 0xa6, 0x403: 0xa6, 0x404: 0xa6, 0x405: 0xa6, 0x406: 0xa6, 0x407: 0xa6, + 0x408: 0xa6, 0x409: 0xa6, 0x40a: 0xa6, 0x40b: 0xa6, 0x40c: 0xa6, 0x40d: 0xa6, 0x40e: 0x161, 0x40f: 0x100, + 0x410: 0xa2, 0x411: 0x162, 0x412: 0xa6, 0x413: 0xa6, 0x414: 0xa6, 0x415: 0x163, 0x416: 0x100, 0x417: 0x100, + 0x418: 0x100, 0x419: 0x100, 0x41a: 0x100, 0x41b: 0x100, 0x41c: 0x100, 0x41d: 0x100, 0x41e: 0x100, 0x41f: 0x100, + 0x420: 0x100, 0x421: 0x100, 0x422: 0x100, 0x423: 0x100, 0x424: 0x100, 0x425: 0x100, 0x426: 0x100, 0x427: 0x100, + 0x428: 0x100, 0x429: 0x100, 0x42a: 0x100, 0x42b: 0x100, 0x42c: 0x100, 0x42d: 0x100, 0x42e: 0x100, 0x42f: 0x100, + 0x430: 0x100, 0x431: 0x100, 0x432: 0x100, 0x433: 0x100, 0x434: 0x100, 0x435: 0x100, 0x436: 0x100, 0x437: 0x100, + 0x438: 0x100, 0x439: 0x100, 0x43a: 0x100, 0x43b: 0x100, 0x43c: 0x100, 0x43d: 0x100, 0x43e: 0x164, 0x43f: 0x165, + // Block 0x11, offset 0x440 + 0x440: 0xa6, 0x441: 0xa6, 0x442: 0xa6, 0x443: 0xa6, 0x444: 0xa6, 0x445: 0xa6, 0x446: 0xa6, 0x447: 0xa6, + 0x448: 0xa6, 0x449: 0xa6, 0x44a: 0xa6, 0x44b: 0xa6, 0x44c: 0xa6, 0x44d: 0xa6, 0x44e: 0xa6, 0x44f: 0xa6, + 0x450: 0x166, 0x451: 0x167, 0x452: 0x100, 0x453: 0x100, 0x454: 0x100, 0x455: 0x100, 0x456: 0x100, 0x457: 0x100, + 0x458: 0x100, 0x459: 0x100, 0x45a: 0x100, 0x45b: 0x100, 0x45c: 0x100, 0x45d: 0x100, 0x45e: 0x100, 0x45f: 0x100, + 0x460: 0x100, 0x461: 0x100, 0x462: 0x100, 0x463: 0x100, 0x464: 0x100, 0x465: 0x100, 0x466: 0x100, 0x467: 0x100, + 0x468: 0x100, 0x469: 0x100, 0x46a: 0x100, 0x46b: 0x100, 0x46c: 0x100, 0x46d: 0x100, 0x46e: 0x100, 0x46f: 0x100, + 0x470: 0x100, 0x471: 0x100, 0x472: 0x100, 0x473: 0x100, 0x474: 0x100, 0x475: 0x100, 0x476: 0x100, 0x477: 0x100, + 0x478: 0x100, 0x479: 0x100, 0x47a: 0x100, 0x47b: 0x100, 0x47c: 0x100, 0x47d: 0x100, 0x47e: 0x100, 0x47f: 0x100, + // Block 0x12, offset 0x480 + 0x480: 0x100, 0x481: 0x100, 0x482: 0x100, 0x483: 0x100, 0x484: 0x100, 0x485: 0x100, 0x486: 0x100, 0x487: 0x100, + 0x488: 0x100, 0x489: 0x100, 0x48a: 0x100, 0x48b: 0x100, 0x48c: 0x100, 0x48d: 0x100, 0x48e: 0x100, 0x48f: 0x100, + 0x490: 0xa6, 0x491: 0xa6, 0x492: 0xa6, 0x493: 0xa6, 0x494: 0xa6, 0x495: 0xa6, 0x496: 0xa6, 0x497: 0xa6, + 0x498: 0xa6, 0x499: 0x14a, 0x49a: 0x100, 0x49b: 0x100, 0x49c: 0x100, 0x49d: 0x100, 0x49e: 0x100, 0x49f: 0x100, + 0x4a0: 0x100, 0x4a1: 0x100, 0x4a2: 0x100, 0x4a3: 0x100, 0x4a4: 0x100, 0x4a5: 0x100, 0x4a6: 0x100, 0x4a7: 0x100, + 0x4a8: 0x100, 0x4a9: 0x100, 0x4aa: 0x100, 0x4ab: 0x100, 0x4ac: 0x100, 0x4ad: 0x100, 0x4ae: 0x100, 0x4af: 0x100, + 0x4b0: 0x100, 0x4b1: 0x100, 0x4b2: 0x100, 0x4b3: 0x100, 0x4b4: 0x100, 0x4b5: 0x100, 0x4b6: 0x100, 0x4b7: 0x100, + 0x4b8: 0x100, 0x4b9: 0x100, 0x4ba: 0x100, 0x4bb: 0x100, 0x4bc: 0x100, 0x4bd: 0x100, 0x4be: 0x100, 0x4bf: 0x100, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x100, 0x4c1: 0x100, 0x4c2: 0x100, 0x4c3: 0x100, 0x4c4: 0x100, 0x4c5: 0x100, 0x4c6: 0x100, 0x4c7: 0x100, + 0x4c8: 0x100, 0x4c9: 0x100, 0x4ca: 0x100, 0x4cb: 0x100, 0x4cc: 0x100, 0x4cd: 0x100, 0x4ce: 0x100, 0x4cf: 0x100, + 0x4d0: 0x100, 0x4d1: 0x100, 0x4d2: 0x100, 0x4d3: 0x100, 0x4d4: 0x100, 0x4d5: 0x100, 0x4d6: 0x100, 0x4d7: 0x100, + 0x4d8: 0x100, 0x4d9: 0x100, 0x4da: 0x100, 0x4db: 0x100, 0x4dc: 0x100, 0x4dd: 0x100, 0x4de: 0x100, 0x4df: 0x100, + 0x4e0: 0xa6, 0x4e1: 0xa6, 0x4e2: 0xa6, 0x4e3: 0xa6, 0x4e4: 0xa6, 0x4e5: 0xa6, 0x4e6: 0xa6, 0x4e7: 0xa6, + 0x4e8: 0x154, 0x4e9: 0x168, 0x4ea: 0x169, 0x4eb: 0x16a, 0x4ec: 0x16b, 0x4ed: 0x16c, 0x4ee: 0x16d, 0x4ef: 0x100, + 0x4f0: 0x100, 0x4f1: 0x100, 0x4f2: 0x100, 0x4f3: 0x100, 0x4f4: 0x100, 0x4f5: 0x100, 0x4f6: 0x100, 0x4f7: 0x100, + 0x4f8: 0x100, 0x4f9: 0x16e, 0x4fa: 0x16f, 0x4fb: 0x100, 0x4fc: 0xa6, 0x4fd: 0x170, 0x4fe: 0x171, 0x4ff: 0x172, + // Block 0x14, offset 0x500 + 0x500: 0xa6, 0x501: 0xa6, 0x502: 0xa6, 0x503: 0xa6, 0x504: 0xa6, 0x505: 0xa6, 0x506: 0xa6, 0x507: 0xa6, + 0x508: 0xa6, 0x509: 0xa6, 0x50a: 0xa6, 0x50b: 0xa6, 0x50c: 0xa6, 0x50d: 0xa6, 0x50e: 0xa6, 0x50f: 0xa6, + 0x510: 0xa6, 0x511: 0xa6, 0x512: 0xa6, 0x513: 0xa6, 0x514: 0xa6, 0x515: 0xa6, 0x516: 0xa6, 0x517: 0xa6, + 0x518: 0xa6, 0x519: 0xa6, 0x51a: 0xa6, 0x51b: 0xa6, 0x51c: 0xa6, 0x51d: 0xa6, 0x51e: 0xa6, 0x51f: 0x173, + 0x520: 0xa6, 0x521: 0xa6, 0x522: 0xa6, 0x523: 0xa6, 0x524: 0xa6, 0x525: 0xa6, 0x526: 0xa6, 0x527: 0xa6, + 0x528: 0xa6, 0x529: 0xa6, 0x52a: 0xa6, 0x52b: 0xa6, 0x52c: 0xa6, 0x52d: 0xa6, 0x52e: 0xa6, 0x52f: 0xa6, + 0x530: 0xa6, 0x531: 0xa6, 0x532: 0xa6, 0x533: 0x174, 0x534: 0x175, 0x535: 0x100, 0x536: 0x100, 0x537: 0x100, + 0x538: 0x100, 0x539: 0x100, 0x53a: 0x100, 0x53b: 0x100, 0x53c: 0x100, 0x53d: 0x100, 0x53e: 0x100, 0x53f: 0x100, + // Block 0x15, offset 0x540 + 0x540: 0x100, 0x541: 0x100, 0x542: 0x100, 0x543: 0x100, 0x544: 0x100, 0x545: 0x100, 0x546: 0x100, 0x547: 0x100, + 0x548: 0x100, 0x549: 0x100, 0x54a: 0x100, 0x54b: 0x100, 0x54c: 0x100, 0x54d: 0x100, 0x54e: 0x100, 0x54f: 0x100, + 0x550: 0x100, 0x551: 0x100, 0x552: 0x100, 0x553: 0x100, 0x554: 0x100, 0x555: 0x100, 0x556: 0x100, 0x557: 0x100, + 0x558: 0x100, 0x559: 0x100, 0x55a: 0x100, 0x55b: 0x100, 0x55c: 0x100, 0x55d: 0x100, 0x55e: 0x100, 0x55f: 0x100, + 0x560: 0x100, 0x561: 0x100, 0x562: 0x100, 0x563: 0x100, 0x564: 0x100, 0x565: 0x100, 0x566: 0x100, 0x567: 0x100, + 0x568: 0x100, 0x569: 0x100, 0x56a: 0x100, 0x56b: 0x100, 0x56c: 0x100, 0x56d: 0x100, 0x56e: 0x100, 0x56f: 0x100, + 0x570: 0x100, 0x571: 0x100, 0x572: 0x100, 0x573: 0x100, 0x574: 0x100, 0x575: 0x100, 0x576: 0x100, 0x577: 0x100, + 0x578: 0x100, 0x579: 0x100, 0x57a: 0x100, 0x57b: 0x100, 0x57c: 0x100, 0x57d: 0x100, 0x57e: 0x100, 0x57f: 0x176, + // Block 0x16, offset 0x580 + 0x580: 0xa6, 0x581: 0xa6, 0x582: 0xa6, 0x583: 0xa6, 0x584: 0x177, 0x585: 0x178, 0x586: 0xa6, 0x587: 0xa6, + 0x588: 0xa6, 0x589: 0xa6, 0x58a: 0xa6, 0x58b: 0x179, 0x58c: 0x100, 0x58d: 0x100, 0x58e: 0x100, 0x58f: 0x100, + 0x590: 0x100, 0x591: 0x100, 0x592: 0x100, 0x593: 0x100, 0x594: 0x100, 0x595: 0x100, 0x596: 0x100, 0x597: 0x100, + 0x598: 0x100, 0x599: 0x100, 0x59a: 0x100, 0x59b: 0x100, 0x59c: 0x100, 0x59d: 0x100, 0x59e: 0x100, 0x59f: 0x100, + 0x5a0: 0x100, 0x5a1: 0x100, 0x5a2: 0x100, 0x5a3: 0x100, 0x5a4: 0x100, 0x5a5: 0x100, 0x5a6: 0x100, 0x5a7: 0x100, + 0x5a8: 0x100, 0x5a9: 0x100, 0x5aa: 0x100, 0x5ab: 0x100, 0x5ac: 0x100, 0x5ad: 0x100, 0x5ae: 0x100, 0x5af: 0x100, + 0x5b0: 0xa6, 0x5b1: 0x17a, 0x5b2: 0x17b, 0x5b3: 0x100, 0x5b4: 0x100, 0x5b5: 0x100, 0x5b6: 0x100, 0x5b7: 0x100, + 0x5b8: 0x100, 0x5b9: 0x100, 0x5ba: 0x100, 0x5bb: 0x100, 0x5bc: 0x100, 0x5bd: 0x100, 0x5be: 0x100, 0x5bf: 0x100, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x100, 0x5c1: 0x100, 0x5c2: 0x100, 0x5c3: 0x100, 0x5c4: 0x100, 0x5c5: 0x100, 0x5c6: 0x100, 0x5c7: 0x100, + 0x5c8: 0x100, 0x5c9: 0x100, 0x5ca: 0x100, 0x5cb: 0x100, 0x5cc: 0x100, 0x5cd: 0x100, 0x5ce: 0x100, 0x5cf: 0x100, + 0x5d0: 0x100, 0x5d1: 0x100, 0x5d2: 0x100, 0x5d3: 0x100, 0x5d4: 0x100, 0x5d5: 0x100, 0x5d6: 0x100, 0x5d7: 0x100, + 0x5d8: 0x100, 0x5d9: 0x100, 0x5da: 0x100, 0x5db: 0x100, 0x5dc: 0x100, 0x5dd: 0x100, 0x5de: 0x100, 0x5df: 0x100, + 0x5e0: 0x100, 0x5e1: 0x100, 0x5e2: 0x100, 0x5e3: 0x100, 0x5e4: 0x100, 0x5e5: 0x100, 0x5e6: 0x100, 0x5e7: 0x100, + 0x5e8: 0x100, 0x5e9: 0x100, 0x5ea: 0x100, 0x5eb: 0x100, 0x5ec: 0x100, 0x5ed: 0x100, 0x5ee: 0x100, 0x5ef: 0x100, + 0x5f0: 0x100, 0x5f1: 0x100, 0x5f2: 0x100, 0x5f3: 0x100, 0x5f4: 0x100, 0x5f5: 0x100, 0x5f6: 0x100, 0x5f7: 0x100, + 0x5f8: 0x100, 0x5f9: 0x100, 0x5fa: 0x100, 0x5fb: 0x100, 0x5fc: 0x17c, 0x5fd: 0x17d, 0x5fe: 0xa2, 0x5ff: 0x17e, + // Block 0x18, offset 0x600 + 0x600: 0xa2, 0x601: 0xa2, 0x602: 0xa2, 0x603: 0x17f, 0x604: 0x180, 0x605: 0x181, 0x606: 0x182, 0x607: 0x183, + 0x608: 0xa2, 0x609: 0x184, 0x60a: 0x100, 0x60b: 0x185, 0x60c: 0xa2, 0x60d: 0x186, 0x60e: 0x100, 0x60f: 0x100, + 0x610: 0x63, 0x611: 0x64, 0x612: 0x65, 0x613: 0x66, 0x614: 0x67, 0x615: 0x68, 0x616: 0x69, 0x617: 0x6a, + 0x618: 0x6b, 0x619: 0x6c, 0x61a: 0x6d, 0x61b: 0x6e, 0x61c: 0x6f, 0x61d: 0x70, 0x61e: 0x71, 0x61f: 0x72, + 0x620: 0xa2, 0x621: 0xa2, 0x622: 0xa2, 0x623: 0xa2, 0x624: 0xa2, 0x625: 0xa2, 0x626: 0xa2, 0x627: 0xa2, + 0x628: 0x187, 0x629: 0x188, 0x62a: 0x189, 0x62b: 0x100, 0x62c: 0x100, 0x62d: 0x100, 0x62e: 0x100, 0x62f: 0x100, + 0x630: 0x100, 0x631: 0x100, 0x632: 0x100, 0x633: 0x100, 0x634: 0x100, 0x635: 0x100, 0x636: 0x100, 0x637: 0x100, + 0x638: 0x100, 0x639: 0x100, 0x63a: 0x100, 0x63b: 0x100, 0x63c: 0x18a, 0x63d: 0x100, 0x63e: 0x100, 0x63f: 0x100, + // Block 0x19, offset 0x640 + 0x640: 0x73, 0x641: 0x74, 0x642: 0x18b, 0x643: 0x100, 0x644: 0x18c, 0x645: 0x18d, 0x646: 0x100, 0x647: 0x100, + 0x648: 0x100, 0x649: 0x100, 0x64a: 0x18e, 0x64b: 0x18f, 0x64c: 0x100, 0x64d: 0x100, 0x64e: 0x100, 0x64f: 0x100, + 0x650: 0x100, 0x651: 0x100, 0x652: 0x100, 0x653: 0x190, 0x654: 0x100, 0x655: 0x100, 0x656: 0x100, 0x657: 0x100, + 0x658: 0x100, 0x659: 0x100, 0x65a: 0x100, 0x65b: 0x100, 0x65c: 0x100, 0x65d: 0x100, 0x65e: 0x100, 0x65f: 0x191, + 0x660: 0x127, 0x661: 0x127, 0x662: 0x127, 0x663: 0x192, 0x664: 0x75, 0x665: 0x193, 0x666: 0x100, 0x667: 0x100, + 0x668: 0x100, 0x669: 0x100, 0x66a: 0x100, 0x66b: 0x100, 0x66c: 0x100, 0x66d: 0x100, 0x66e: 0x100, 0x66f: 0x100, + 0x670: 0x100, 0x671: 0x194, 0x672: 0x195, 0x673: 0x100, 0x674: 0x196, 0x675: 0x100, 0x676: 0x100, 0x677: 0x100, + 0x678: 0x76, 0x679: 0x77, 0x67a: 0x78, 0x67b: 0x197, 0x67c: 0x100, 0x67d: 0x100, 0x67e: 0x100, 0x67f: 0x100, + // Block 0x1a, offset 0x680 + 0x680: 0x198, 0x681: 0xa2, 0x682: 0x199, 0x683: 0x19a, 0x684: 0x79, 0x685: 0x7a, 0x686: 0x19b, 0x687: 0x19c, + 0x688: 0x7b, 0x689: 0x19d, 0x68a: 0x100, 0x68b: 0x100, 0x68c: 0xa2, 0x68d: 0xa2, 0x68e: 0xa2, 0x68f: 0xa2, + 0x690: 0xa2, 0x691: 0xa2, 0x692: 0xa2, 0x693: 0xa2, 0x694: 0xa2, 0x695: 0xa2, 0x696: 0xa2, 0x697: 0xa2, + 0x698: 0xa2, 0x699: 0xa2, 0x69a: 0xa2, 0x69b: 0x19e, 0x69c: 0xa2, 0x69d: 0x19f, 0x69e: 0xa2, 0x69f: 0x1a0, + 0x6a0: 0x1a1, 0x6a1: 0x1a2, 0x6a2: 0x1a3, 0x6a3: 0x100, 0x6a4: 0xa2, 0x6a5: 0xa2, 0x6a6: 0xa2, 0x6a7: 0xa2, + 0x6a8: 0xa2, 0x6a9: 0x1a4, 0x6aa: 0x1a5, 0x6ab: 0x1a6, 0x6ac: 0xa2, 0x6ad: 0xa2, 0x6ae: 0x1a7, 0x6af: 0x1a8, + 0x6b0: 0x100, 0x6b1: 0x100, 0x6b2: 0x100, 0x6b3: 0x100, 0x6b4: 0x100, 0x6b5: 0x100, 0x6b6: 0x100, 0x6b7: 0x100, + 0x6b8: 0x100, 0x6b9: 0x100, 0x6ba: 0x100, 0x6bb: 0x100, 0x6bc: 0x100, 0x6bd: 0x100, 0x6be: 0x100, 0x6bf: 0x100, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0xa6, 0x6c1: 0xa6, 0x6c2: 0xa6, 0x6c3: 0xa6, 0x6c4: 0xa6, 0x6c5: 0xa6, 0x6c6: 0xa6, 0x6c7: 0xa6, + 0x6c8: 0xa6, 0x6c9: 0xa6, 0x6ca: 0xa6, 0x6cb: 0xa6, 0x6cc: 0xa6, 0x6cd: 0xa6, 0x6ce: 0xa6, 0x6cf: 0xa6, + 0x6d0: 0xa6, 0x6d1: 0xa6, 0x6d2: 0xa6, 0x6d3: 0xa6, 0x6d4: 0xa6, 0x6d5: 0xa6, 0x6d6: 0xa6, 0x6d7: 0xa6, + 0x6d8: 0xa6, 0x6d9: 0xa6, 0x6da: 0xa6, 0x6db: 0x1a9, 0x6dc: 0xa6, 0x6dd: 0xa6, 0x6de: 0xa6, 0x6df: 0xa6, + 0x6e0: 0xa6, 0x6e1: 0xa6, 0x6e2: 0xa6, 0x6e3: 0xa6, 0x6e4: 0xa6, 0x6e5: 0xa6, 0x6e6: 0xa6, 0x6e7: 0xa6, + 0x6e8: 0xa6, 0x6e9: 0xa6, 0x6ea: 0xa6, 0x6eb: 0xa6, 0x6ec: 0xa6, 0x6ed: 0xa6, 0x6ee: 0xa6, 0x6ef: 0xa6, + 0x6f0: 0xa6, 0x6f1: 0xa6, 0x6f2: 0xa6, 0x6f3: 0xa6, 0x6f4: 0xa6, 0x6f5: 0xa6, 0x6f6: 0xa6, 0x6f7: 0xa6, + 0x6f8: 0xa6, 0x6f9: 0xa6, 0x6fa: 0xa6, 0x6fb: 0xa6, 0x6fc: 0xa6, 0x6fd: 0xa6, 0x6fe: 0xa6, 0x6ff: 0xa6, + // Block 0x1c, offset 0x700 + 0x700: 0xa6, 0x701: 0xa6, 0x702: 0xa6, 0x703: 0xa6, 0x704: 0xa6, 0x705: 0xa6, 0x706: 0xa6, 0x707: 0xa6, + 0x708: 0xa6, 0x709: 0xa6, 0x70a: 0xa6, 0x70b: 0xa6, 0x70c: 0xa6, 0x70d: 0xa6, 0x70e: 0xa6, 0x70f: 0xa6, + 0x710: 0xa6, 0x711: 0xa6, 0x712: 0xa6, 0x713: 0xa6, 0x714: 0xa6, 0x715: 0xa6, 0x716: 0xa6, 0x717: 0xa6, + 0x718: 0xa6, 0x719: 0xa6, 0x71a: 0xa6, 0x71b: 0xa6, 0x71c: 0x1aa, 0x71d: 0xa6, 0x71e: 0xa6, 0x71f: 0xa6, + 0x720: 0x1ab, 0x721: 0xa6, 0x722: 0xa6, 0x723: 0xa6, 0x724: 0xa6, 0x725: 0xa6, 0x726: 0xa6, 0x727: 0xa6, + 0x728: 0xa6, 0x729: 0xa6, 0x72a: 0xa6, 0x72b: 0xa6, 0x72c: 0xa6, 0x72d: 0xa6, 0x72e: 0xa6, 0x72f: 0xa6, + 0x730: 0xa6, 0x731: 0xa6, 0x732: 0xa6, 0x733: 0xa6, 0x734: 0xa6, 0x735: 0xa6, 0x736: 0xa6, 0x737: 0xa6, + 0x738: 0xa6, 0x739: 0xa6, 0x73a: 0xa6, 0x73b: 0xa6, 0x73c: 0xa6, 0x73d: 0xa6, 0x73e: 0xa6, 0x73f: 0xa6, + // Block 0x1d, offset 0x740 + 0x740: 0xa6, 0x741: 0xa6, 0x742: 0xa6, 0x743: 0xa6, 0x744: 0xa6, 0x745: 0xa6, 0x746: 0xa6, 0x747: 0xa6, + 0x748: 0xa6, 0x749: 0xa6, 0x74a: 0xa6, 0x74b: 0xa6, 0x74c: 0xa6, 0x74d: 0xa6, 0x74e: 0xa6, 0x74f: 0xa6, + 0x750: 0xa6, 0x751: 0xa6, 0x752: 0xa6, 0x753: 0xa6, 0x754: 0xa6, 0x755: 0xa6, 0x756: 0xa6, 0x757: 0xa6, + 0x758: 0xa6, 0x759: 0xa6, 0x75a: 0xa6, 0x75b: 0xa6, 0x75c: 0xa6, 0x75d: 0xa6, 0x75e: 0xa6, 0x75f: 0xa6, + 0x760: 0xa6, 0x761: 0xa6, 0x762: 0xa6, 0x763: 0xa6, 0x764: 0xa6, 0x765: 0xa6, 0x766: 0xa6, 0x767: 0xa6, + 0x768: 0xa6, 0x769: 0xa6, 0x76a: 0xa6, 0x76b: 0xa6, 0x76c: 0xa6, 0x76d: 0xa6, 0x76e: 0xa6, 0x76f: 0xa6, + 0x770: 0xa6, 0x771: 0xa6, 0x772: 0xa6, 0x773: 0xa6, 0x774: 0xa6, 0x775: 0xa6, 0x776: 0xa6, 0x777: 0xa6, + 0x778: 0xa6, 0x779: 0xa6, 0x77a: 0x1ac, 0x77b: 0xa6, 0x77c: 0xa6, 0x77d: 0xa6, 0x77e: 0xa6, 0x77f: 0xa6, + // Block 0x1e, offset 0x780 + 0x780: 0xa6, 0x781: 0xa6, 0x782: 0xa6, 0x783: 0xa6, 0x784: 0xa6, 0x785: 0xa6, 0x786: 0xa6, 0x787: 0xa6, + 0x788: 0xa6, 0x789: 0xa6, 0x78a: 0xa6, 0x78b: 0xa6, 0x78c: 0xa6, 0x78d: 0xa6, 0x78e: 0xa6, 0x78f: 0xa6, + 0x790: 0xa6, 0x791: 0xa6, 0x792: 0xa6, 0x793: 0xa6, 0x794: 0xa6, 0x795: 0xa6, 0x796: 0xa6, 0x797: 0xa6, + 0x798: 0xa6, 0x799: 0xa6, 0x79a: 0xa6, 0x79b: 0xa6, 0x79c: 0xa6, 0x79d: 0xa6, 0x79e: 0xa6, 0x79f: 0xa6, + 0x7a0: 0xa6, 0x7a1: 0xa6, 0x7a2: 0xa6, 0x7a3: 0xa6, 0x7a4: 0xa6, 0x7a5: 0xa6, 0x7a6: 0xa6, 0x7a7: 0xa6, + 0x7a8: 0xa6, 0x7a9: 0xa6, 0x7aa: 0xa6, 0x7ab: 0xa6, 0x7ac: 0xa6, 0x7ad: 0xa6, 0x7ae: 0xa6, 0x7af: 0x1ad, + 0x7b0: 0x100, 0x7b1: 0x100, 0x7b2: 0x100, 0x7b3: 0x100, 0x7b4: 0x100, 0x7b5: 0x100, 0x7b6: 0x100, 0x7b7: 0x100, + 0x7b8: 0x100, 0x7b9: 0x100, 0x7ba: 0x100, 0x7bb: 0x100, 0x7bc: 0x100, 0x7bd: 0x100, 0x7be: 0x100, 0x7bf: 0x100, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x100, 0x7c1: 0x100, 0x7c2: 0x100, 0x7c3: 0x100, 0x7c4: 0x100, 0x7c5: 0x100, 0x7c6: 0x100, 0x7c7: 0x100, + 0x7c8: 0x100, 0x7c9: 0x100, 0x7ca: 0x100, 0x7cb: 0x100, 0x7cc: 0x100, 0x7cd: 0x100, 0x7ce: 0x100, 0x7cf: 0x100, + 0x7d0: 0x100, 0x7d1: 0x100, 0x7d2: 0x100, 0x7d3: 0x100, 0x7d4: 0x100, 0x7d5: 0x100, 0x7d6: 0x100, 0x7d7: 0x100, + 0x7d8: 0x100, 0x7d9: 0x100, 0x7da: 0x100, 0x7db: 0x100, 0x7dc: 0x100, 0x7dd: 0x100, 0x7de: 0x100, 0x7df: 0x100, + 0x7e0: 0x7c, 0x7e1: 0x7d, 0x7e2: 0x7e, 0x7e3: 0x7f, 0x7e4: 0x80, 0x7e5: 0x81, 0x7e6: 0x82, 0x7e7: 0x83, + 0x7e8: 0x84, 0x7e9: 0x100, 0x7ea: 0x100, 0x7eb: 0x100, 0x7ec: 0x100, 0x7ed: 0x100, 0x7ee: 0x100, 0x7ef: 0x100, + 0x7f0: 0x100, 0x7f1: 0x100, 0x7f2: 0x100, 0x7f3: 0x100, 0x7f4: 0x100, 0x7f5: 0x100, 0x7f6: 0x100, 0x7f7: 0x100, + 0x7f8: 0x100, 0x7f9: 0x100, 0x7fa: 0x100, 0x7fb: 0x100, 0x7fc: 0x100, 0x7fd: 0x100, 0x7fe: 0x100, 0x7ff: 0x100, + // Block 0x20, offset 0x800 + 0x800: 0xa6, 0x801: 0xa6, 0x802: 0xa6, 0x803: 0xa6, 0x804: 0xa6, 0x805: 0xa6, 0x806: 0xa6, 0x807: 0xa6, + 0x808: 0xa6, 0x809: 0xa6, 0x80a: 0xa6, 0x80b: 0xa6, 0x80c: 0xa6, 0x80d: 0x1ae, 0x80e: 0xa6, 0x80f: 0xa6, + 0x810: 0xa6, 0x811: 0xa6, 0x812: 0xa6, 0x813: 0xa6, 0x814: 0xa6, 0x815: 0xa6, 0x816: 0xa6, 0x817: 0xa6, + 0x818: 0xa6, 0x819: 0xa6, 0x81a: 0xa6, 0x81b: 0xa6, 0x81c: 0xa6, 0x81d: 0xa6, 0x81e: 0xa6, 0x81f: 0xa6, + 0x820: 0xa6, 0x821: 0xa6, 0x822: 0xa6, 0x823: 0xa6, 0x824: 0xa6, 0x825: 0xa6, 0x826: 0xa6, 0x827: 0xa6, + 0x828: 0xa6, 0x829: 0xa6, 0x82a: 0xa6, 0x82b: 0xa6, 0x82c: 0xa6, 0x82d: 0xa6, 0x82e: 0xa6, 0x82f: 0xa6, + 0x830: 0xa6, 0x831: 0xa6, 0x832: 0xa6, 0x833: 0xa6, 0x834: 0xa6, 0x835: 0xa6, 0x836: 0xa6, 0x837: 0xa6, + 0x838: 0xa6, 0x839: 0xa6, 0x83a: 0xa6, 0x83b: 0xa6, 0x83c: 0xa6, 0x83d: 0xa6, 0x83e: 0xa6, 0x83f: 0xa6, + // Block 0x21, offset 0x840 + 0x840: 0xa6, 0x841: 0xa6, 0x842: 0xa6, 0x843: 0xa6, 0x844: 0xa6, 0x845: 0xa6, 0x846: 0xa6, 0x847: 0xa6, + 0x848: 0xa6, 0x849: 0xa6, 0x84a: 0xa6, 0x84b: 0xa6, 0x84c: 0xa6, 0x84d: 0xa6, 0x84e: 0x1af, 0x84f: 0x100, + 0x850: 0x100, 0x851: 0x100, 0x852: 0x100, 0x853: 0x100, 0x854: 0x100, 0x855: 0x100, 0x856: 0x100, 0x857: 0x100, + 0x858: 0x100, 0x859: 0x100, 0x85a: 0x100, 0x85b: 0x100, 0x85c: 0x100, 0x85d: 0x100, 0x85e: 0x100, 0x85f: 0x100, + 0x860: 0x100, 0x861: 0x100, 0x862: 0x100, 0x863: 0x100, 0x864: 0x100, 0x865: 0x100, 0x866: 0x100, 0x867: 0x100, + 0x868: 0x100, 0x869: 0x100, 0x86a: 0x100, 0x86b: 0x100, 0x86c: 0x100, 0x86d: 0x100, 0x86e: 0x100, 0x86f: 0x100, + 0x870: 0x100, 0x871: 0x100, 0x872: 0x100, 0x873: 0x100, 0x874: 0x100, 0x875: 0x100, 0x876: 0x100, 0x877: 0x100, + 0x878: 0x100, 0x879: 0x100, 0x87a: 0x100, 0x87b: 0x100, 0x87c: 0x100, 0x87d: 0x100, 0x87e: 0x100, 0x87f: 0x100, + // Block 0x22, offset 0x880 + 0x890: 0x0c, 0x891: 0x0d, 0x892: 0x0e, 0x893: 0x0f, 0x894: 0x10, 0x895: 0x0a, 0x896: 0x11, 0x897: 0x07, + 0x898: 0x12, 0x899: 0x0a, 0x89a: 0x13, 0x89b: 0x14, 0x89c: 0x15, 0x89d: 0x16, 0x89e: 0x17, 0x89f: 0x18, + 0x8a0: 0x07, 0x8a1: 0x07, 0x8a2: 0x07, 0x8a3: 0x07, 0x8a4: 0x07, 0x8a5: 0x07, 0x8a6: 0x07, 0x8a7: 0x07, + 0x8a8: 0x07, 0x8a9: 0x07, 0x8aa: 0x19, 0x8ab: 0x1a, 0x8ac: 0x1b, 0x8ad: 0x07, 0x8ae: 0x1c, 0x8af: 0x1d, + 0x8b0: 0x07, 0x8b1: 0x1e, 0x8b2: 0x1f, 0x8b3: 0x0a, 0x8b4: 0x0a, 0x8b5: 0x0a, 0x8b6: 0x0a, 0x8b7: 0x0a, + 0x8b8: 0x0a, 0x8b9: 0x0a, 0x8ba: 0x0a, 0x8bb: 0x0a, 0x8bc: 0x0a, 0x8bd: 0x0a, 0x8be: 0x0a, 0x8bf: 0x0a, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0a, 0x8c1: 0x0a, 0x8c2: 0x0a, 0x8c3: 0x0a, 0x8c4: 0x0a, 0x8c5: 0x0a, 0x8c6: 0x0a, 0x8c7: 0x0a, + 0x8c8: 0x0a, 0x8c9: 0x0a, 0x8ca: 0x0a, 0x8cb: 0x0a, 0x8cc: 0x0a, 0x8cd: 0x0a, 0x8ce: 0x0a, 0x8cf: 0x0a, + 0x8d0: 0x0a, 0x8d1: 0x0a, 0x8d2: 0x0a, 0x8d3: 0x0a, 0x8d4: 0x0a, 0x8d5: 0x0a, 0x8d6: 0x0a, 0x8d7: 0x0a, + 0x8d8: 0x0a, 0x8d9: 0x0a, 0x8da: 0x0a, 0x8db: 0x0a, 0x8dc: 0x0a, 0x8dd: 0x0a, 0x8de: 0x0a, 0x8df: 0x0a, + 0x8e0: 0x0a, 0x8e1: 0x0a, 0x8e2: 0x0a, 0x8e3: 0x0a, 0x8e4: 0x0a, 0x8e5: 0x0a, 0x8e6: 0x0a, 0x8e7: 0x0a, + 0x8e8: 0x0a, 0x8e9: 0x0a, 0x8ea: 0x0a, 0x8eb: 0x0a, 0x8ec: 0x0a, 0x8ed: 0x0a, 0x8ee: 0x0a, 0x8ef: 0x0a, + 0x8f0: 0x0a, 0x8f1: 0x0a, 0x8f2: 0x0a, 0x8f3: 0x0a, 0x8f4: 0x0a, 0x8f5: 0x0a, 0x8f6: 0x0a, 0x8f7: 0x0a, + 0x8f8: 0x0a, 0x8f9: 0x0a, 0x8fa: 0x0a, 0x8fb: 0x0a, 0x8fc: 0x0a, 0x8fd: 0x0a, 0x8fe: 0x0a, 0x8ff: 0x0a, + // Block 0x24, offset 0x900 + 0x900: 0x1b0, 0x901: 0x1b1, 0x902: 0x100, 0x903: 0x100, 0x904: 0x1b2, 0x905: 0x1b2, 0x906: 0x1b2, 0x907: 0x1b3, + 0x908: 0x100, 0x909: 0x100, 0x90a: 0x100, 0x90b: 0x100, 0x90c: 0x100, 0x90d: 0x100, 0x90e: 0x100, 0x90f: 0x100, + 0x910: 0x100, 0x911: 0x100, 0x912: 0x100, 0x913: 0x100, 0x914: 0x100, 0x915: 0x100, 0x916: 0x100, 0x917: 0x100, + 0x918: 0x100, 0x919: 0x100, 0x91a: 0x100, 0x91b: 0x100, 0x91c: 0x100, 0x91d: 0x100, 0x91e: 0x100, 0x91f: 0x100, + 0x920: 0x100, 0x921: 0x100, 0x922: 0x100, 0x923: 0x100, 0x924: 0x100, 0x925: 0x100, 0x926: 0x100, 0x927: 0x100, + 0x928: 0x100, 0x929: 0x100, 0x92a: 0x100, 0x92b: 0x100, 0x92c: 0x100, 0x92d: 0x100, 0x92e: 0x100, 0x92f: 0x100, + 0x930: 0x100, 0x931: 0x100, 0x932: 0x100, 0x933: 0x100, 0x934: 0x100, 0x935: 0x100, 0x936: 0x100, 0x937: 0x100, + 0x938: 0x100, 0x939: 0x100, 0x93a: 0x100, 0x93b: 0x100, 0x93c: 0x100, 0x93d: 0x100, 0x93e: 0x100, 0x93f: 0x100, + // Block 0x25, offset 0x940 + 0x940: 0x0a, 0x941: 0x0a, 0x942: 0x0a, 0x943: 0x0a, 0x944: 0x0a, 0x945: 0x0a, 0x946: 0x0a, 0x947: 0x0a, + 0x948: 0x0a, 0x949: 0x0a, 0x94a: 0x0a, 0x94b: 0x0a, 0x94c: 0x0a, 0x94d: 0x0a, 0x94e: 0x0a, 0x94f: 0x0a, + 0x950: 0x0a, 0x951: 0x0a, 0x952: 0x0a, 0x953: 0x0a, 0x954: 0x0a, 0x955: 0x0a, 0x956: 0x0a, 0x957: 0x0a, + 0x958: 0x0a, 0x959: 0x0a, 0x95a: 0x0a, 0x95b: 0x0a, 0x95c: 0x0a, 0x95d: 0x0a, 0x95e: 0x0a, 0x95f: 0x0a, + 0x960: 0x22, 0x961: 0x0a, 0x962: 0x0a, 0x963: 0x0a, 0x964: 0x0a, 0x965: 0x0a, 0x966: 0x0a, 0x967: 0x0a, + 0x968: 0x0a, 0x969: 0x0a, 0x96a: 0x0a, 0x96b: 0x0a, 0x96c: 0x0a, 0x96d: 0x0a, 0x96e: 0x0a, 0x96f: 0x0a, + 0x970: 0x0a, 0x971: 0x0a, 0x972: 0x0a, 0x973: 0x0a, 0x974: 0x0a, 0x975: 0x0a, 0x976: 0x0a, 0x977: 0x0a, + 0x978: 0x0a, 0x979: 0x0a, 0x97a: 0x0a, 0x97b: 0x0a, 0x97c: 0x0a, 0x97d: 0x0a, 0x97e: 0x0a, 0x97f: 0x0a, + // Block 0x26, offset 0x980 + 0x980: 0x0a, 0x981: 0x0a, 0x982: 0x0a, 0x983: 0x0a, 0x984: 0x0a, 0x985: 0x0a, 0x986: 0x0a, 0x987: 0x0a, + 0x988: 0x0a, 0x989: 0x0a, 0x98a: 0x0a, 0x98b: 0x0a, 0x98c: 0x0a, 0x98d: 0x0a, 0x98e: 0x0a, 0x98f: 0x0a, +} + +// idnaSparseOffset: 303 entries, 606 bytes +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x7e, 0x87, 0x97, 0xa6, 0xb1, 0xbe, 0xcf, 0xd9, 0xe0, 0xed, 0xfe, 0x105, 0x110, 0x11f, 0x12d, 0x137, 0x139, 0x13e, 0x141, 0x144, 0x146, 0x152, 0x15d, 0x165, 0x16b, 0x171, 0x176, 0x17b, 0x17e, 0x182, 0x188, 0x18d, 0x198, 0x1a2, 0x1a8, 0x1b9, 0x1c4, 0x1c7, 0x1cf, 0x1d2, 0x1df, 0x1e7, 0x1eb, 0x1f2, 0x1fa, 0x20a, 0x216, 0x219, 0x223, 0x22f, 0x23b, 0x247, 0x24f, 0x254, 0x261, 0x272, 0x27d, 0x282, 0x28b, 0x293, 0x299, 0x29e, 0x2a1, 0x2a5, 0x2ab, 0x2af, 0x2b3, 0x2b7, 0x2bc, 0x2c4, 0x2cb, 0x2d6, 0x2e0, 0x2e4, 0x2e7, 0x2ed, 0x2f1, 0x2f3, 0x2f6, 0x2f8, 0x2fb, 0x305, 0x308, 0x317, 0x31b, 0x31f, 0x321, 0x32a, 0x32e, 0x333, 0x338, 0x33e, 0x34e, 0x354, 0x358, 0x367, 0x36c, 0x374, 0x37e, 0x389, 0x391, 0x3a2, 0x3ab, 0x3bb, 0x3c8, 0x3d4, 0x3d9, 0x3e6, 0x3ea, 0x3ef, 0x3f1, 0x3f3, 0x3f7, 0x3f9, 0x3fd, 0x406, 0x40c, 0x410, 0x420, 0x42a, 0x42f, 0x432, 0x438, 0x43f, 0x444, 0x448, 0x44e, 0x453, 0x45c, 0x461, 0x467, 0x46e, 0x475, 0x47c, 0x480, 0x483, 0x488, 0x494, 0x49a, 0x49f, 0x4a6, 0x4ae, 0x4b3, 0x4b7, 0x4c7, 0x4ce, 0x4d2, 0x4d6, 0x4dd, 0x4df, 0x4e2, 0x4e5, 0x4e9, 0x4f2, 0x4f6, 0x4fe, 0x501, 0x509, 0x514, 0x523, 0x52f, 0x535, 0x542, 0x54e, 0x556, 0x55f, 0x56a, 0x571, 0x580, 0x58d, 0x591, 0x59e, 0x5a7, 0x5ab, 0x5ba, 0x5c2, 0x5cd, 0x5d6, 0x5dc, 0x5e4, 0x5ed, 0x5f9, 0x5fc, 0x608, 0x60b, 0x614, 0x617, 0x61c, 0x625, 0x62a, 0x637, 0x642, 0x64b, 0x656, 0x659, 0x65c, 0x666, 0x66f, 0x67b, 0x688, 0x695, 0x6a3, 0x6aa, 0x6b5, 0x6bc, 0x6c0, 0x6c4, 0x6c7, 0x6cc, 0x6cf, 0x6d2, 0x6d6, 0x6d9, 0x6de, 0x6e5, 0x6e8, 0x6f0, 0x6f4, 0x6ff, 0x702, 0x705, 0x708, 0x70e, 0x714, 0x71d, 0x720, 0x723, 0x726, 0x72e, 0x733, 0x73c, 0x73f, 0x744, 0x74e, 0x752, 0x756, 0x759, 0x75c, 0x760, 0x76f, 0x77b, 0x77f, 0x784, 0x789, 0x78e, 0x792, 0x797, 0x7a0, 0x7a5, 0x7a9, 0x7af, 0x7b5, 0x7ba, 0x7c0, 0x7c6, 0x7d0, 0x7d6, 0x7df, 0x7e2, 0x7e5, 0x7e9, 0x7ed, 0x7f1, 0x7f7, 0x7fd, 0x802, 0x805, 0x815, 0x81c, 0x820, 0x827, 0x82b, 0x831, 0x838, 0x83f, 0x845, 0x84e, 0x852, 0x860, 0x863, 0x866, 0x86a, 0x86e, 0x871, 0x875, 0x878, 0x87d, 0x87f, 0x881} + +// idnaSparseValues: 2180 entries, 8720 bytes +var idnaSparseValues = [2180]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x07}, + {value: 0xe105, lo: 0x80, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x97}, + {value: 0xe105, lo: 0x98, hi: 0x9e}, + {value: 0x001f, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbf}, + // Block 0x1, offset 0x8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0xe01d, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0335, lo: 0x83, hi: 0x83}, + {value: 0x034d, lo: 0x84, hi: 0x84}, + {value: 0x0365, lo: 0x85, hi: 0x85}, + {value: 0xe00d, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0xe00d, lo: 0x88, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x89}, + {value: 0xe00d, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe00d, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0x8d}, + {value: 0xe00d, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0xbf}, + // Block 0x2, offset 0x19 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x00a9, lo: 0xb0, hi: 0xb0}, + {value: 0x037d, lo: 0xb1, hi: 0xb1}, + {value: 0x00b1, lo: 0xb2, hi: 0xb2}, + {value: 0x00b9, lo: 0xb3, hi: 0xb3}, + {value: 0x034d, lo: 0xb4, hi: 0xb4}, + {value: 0x0395, lo: 0xb5, hi: 0xb5}, + {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, + {value: 0x00c1, lo: 0xb7, hi: 0xb7}, + {value: 0x00c9, lo: 0xb8, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbf}, + // Block 0x3, offset 0x25 + {value: 0x0000, lo: 0x01}, + {value: 0x3308, lo: 0x80, hi: 0xbf}, + // Block 0x4, offset 0x27 + {value: 0x0000, lo: 0x04}, + {value: 0x03f5, lo: 0x80, hi: 0x8f}, + {value: 0xe105, lo: 0x90, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x5, offset 0x2c + {value: 0x0000, lo: 0x06}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x0545, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x6, offset 0x33 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0131, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0018, lo: 0x89, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x3308, lo: 0x91, hi: 0xbd}, + {value: 0x0818, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x7, offset 0x3e + {value: 0x0000, lo: 0x0b}, + {value: 0x0818, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x82}, + {value: 0x0818, lo: 0x83, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x85}, + {value: 0x0818, lo: 0x86, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xae}, + {value: 0x0808, lo: 0xaf, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x8, offset 0x4a + {value: 0x0000, lo: 0x03}, + {value: 0x0a08, lo: 0x80, hi: 0x87}, + {value: 0x0c08, lo: 0x88, hi: 0x99}, + {value: 0x0a08, lo: 0x9a, hi: 0xbf}, + // Block 0x9, offset 0x4e + {value: 0x0000, lo: 0x0e}, + {value: 0x3308, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0c08, lo: 0x8d, hi: 0x8d}, + {value: 0x0a08, lo: 0x8e, hi: 0x98}, + {value: 0x0c08, lo: 0x99, hi: 0x9b}, + {value: 0x0a08, lo: 0x9c, hi: 0xaa}, + {value: 0x0c08, lo: 0xab, hi: 0xac}, + {value: 0x0a08, lo: 0xad, hi: 0xb0}, + {value: 0x0c08, lo: 0xb1, hi: 0xb1}, + {value: 0x0a08, lo: 0xb2, hi: 0xb2}, + {value: 0x0c08, lo: 0xb3, hi: 0xb4}, + {value: 0x0a08, lo: 0xb5, hi: 0xb7}, + {value: 0x0c08, lo: 0xb8, hi: 0xb9}, + {value: 0x0a08, lo: 0xba, hi: 0xbf}, + // Block 0xa, offset 0x5d + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xb0}, + {value: 0x0808, lo: 0xb1, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xb, offset 0x62 + {value: 0x0000, lo: 0x09}, + {value: 0x0808, lo: 0x80, hi: 0x89}, + {value: 0x0a08, lo: 0x8a, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xb3}, + {value: 0x0808, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb9}, + {value: 0x0818, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x0818, lo: 0xbe, hi: 0xbf}, + // Block 0xc, offset 0x6c + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x99}, + {value: 0x0808, lo: 0x9a, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0xa3}, + {value: 0x0808, lo: 0xa4, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa7}, + {value: 0x0808, lo: 0xa8, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0818, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xd, offset 0x78 + {value: 0x0000, lo: 0x05}, + {value: 0x0a08, lo: 0x80, hi: 0x88}, + {value: 0x0808, lo: 0x89, hi: 0x89}, + {value: 0x3308, lo: 0x8a, hi: 0xa1}, + {value: 0x0840, lo: 0xa2, hi: 0xa2}, + {value: 0x3308, lo: 0xa3, hi: 0xbf}, + // Block 0xe, offset 0x7e + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0xf, offset 0x87 + {value: 0x0000, lo: 0x0f}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x85}, + {value: 0x3008, lo: 0x86, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x3008, lo: 0x8a, hi: 0x8c}, + {value: 0x3b08, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x10, offset 0x97 + {value: 0x0000, lo: 0x0e}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbf}, + // Block 0x11, offset 0xa6 + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xba}, + {value: 0x3b08, lo: 0xbb, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x12, offset 0xb1 + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x13, offset 0xbe + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x89}, + {value: 0x3b08, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x3008, lo: 0x8f, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x3008, lo: 0x98, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb1}, + {value: 0x3008, lo: 0xb2, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x14, offset 0xcf + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x01f1, lo: 0xb3, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb9}, + {value: 0x3b08, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x15, offset 0xd9 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0xbf}, + // Block 0x16, offset 0xe0 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x3308, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0201, lo: 0x9c, hi: 0x9c}, + {value: 0x0209, lo: 0x9d, hi: 0x9d}, + {value: 0x0008, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x17, offset 0xed + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe03d, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xb8}, + {value: 0x3308, lo: 0xb9, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x18, offset 0xfe + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0x19, offset 0x105 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x3008, lo: 0xab, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xb0}, + {value: 0x3008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x1a, offset 0x110 + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x3008, lo: 0x96, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x3308, lo: 0x9e, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x3008, lo: 0xa2, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbf}, + // Block 0x1b, offset 0x11f + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x3008, lo: 0x87, hi: 0x8c}, + {value: 0x3308, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x3008, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x3008, lo: 0x9a, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1c, offset 0x12d + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x86}, + {value: 0x055d, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8c}, + {value: 0x055d, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0xe105, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0x137 + {value: 0x0000, lo: 0x01}, + {value: 0x0018, lo: 0x80, hi: 0xbf}, + // Block 0x1e, offset 0x139 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa0}, + {value: 0x2018, lo: 0xa1, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x1f, offset 0x13e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa7}, + {value: 0x2018, lo: 0xa8, hi: 0xbf}, + // Block 0x20, offset 0x141 + {value: 0x0000, lo: 0x02}, + {value: 0x2018, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0xbf}, + // Block 0x21, offset 0x144 + {value: 0x0000, lo: 0x01}, + {value: 0x0008, lo: 0x80, hi: 0xbf}, + // Block 0x22, offset 0x146 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x23, offset 0x152 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x15d + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x25, offset 0x165 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x26, offset 0x16b + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x27, offset 0x171 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x28, offset 0x176 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x29, offset 0x17b + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x2a, offset 0x17e + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xbf}, + // Block 0x2b, offset 0x182 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x2c, offset 0x188 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x2d, offset 0x18d + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x93}, + {value: 0x3b08, lo: 0x94, hi: 0x94}, + {value: 0x3808, lo: 0x95, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x3808, lo: 0xb4, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x2e, offset 0x198 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x2f, offset 0x1a2 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xb3}, + {value: 0x3340, lo: 0xb4, hi: 0xb5}, + {value: 0x3008, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x30, offset 0x1a8 + {value: 0x0000, lo: 0x10}, + {value: 0x3008, lo: 0x80, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x3008, lo: 0x87, hi: 0x88}, + {value: 0x3308, lo: 0x89, hi: 0x91}, + {value: 0x3b08, lo: 0x92, hi: 0x92}, + {value: 0x3308, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0x96}, + {value: 0x0008, lo: 0x97, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x31, offset 0x1b9 + {value: 0x0000, lo: 0x0a}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x86}, + {value: 0x0218, lo: 0x87, hi: 0x87}, + {value: 0x0018, lo: 0x88, hi: 0x8a}, + {value: 0x33c0, lo: 0x8b, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x33c0, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xbf}, + // Block 0x32, offset 0x1c4 + {value: 0x0000, lo: 0x02}, + {value: 0x0208, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x33, offset 0x1c7 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x0208, lo: 0x87, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xa9}, + {value: 0x0208, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x34, offset 0x1cf + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x35, offset 0x1d2 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb8}, + {value: 0x3308, lo: 0xb9, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x36, offset 0x1df + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x37, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x38, offset 0x1eb + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0028, lo: 0x9a, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xbf}, + // Block 0x39, offset 0x1f2 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x3308, lo: 0x97, hi: 0x98}, + {value: 0x3008, lo: 0x99, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1fa + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x94}, + {value: 0x3008, lo: 0x95, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3b08, lo: 0xa0, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xac}, + {value: 0x3008, lo: 0xad, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x3b, offset 0x20a + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xbd}, + {value: 0x3318, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x3c, offset 0x216 + {value: 0x0000, lo: 0x02}, + {value: 0x3308, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0xbf}, + // Block 0x3d, offset 0x219 + {value: 0x0000, lo: 0x09}, + {value: 0x3308, lo: 0x80, hi: 0x83}, + {value: 0x3008, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x3008, lo: 0xbd, hi: 0xbf}, + // Block 0x3e, offset 0x223 + {value: 0x0000, lo: 0x0b}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x3808, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x3f, offset 0x22f + {value: 0x0000, lo: 0x0b}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa9}, + {value: 0x3808, lo: 0xaa, hi: 0xaa}, + {value: 0x3b08, lo: 0xab, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xbf}, + // Block 0x40, offset 0x23b + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa9}, + {value: 0x3008, lo: 0xaa, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb1}, + {value: 0x3808, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbf}, + // Block 0x41, offset 0x247 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x3008, lo: 0xa4, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x42, offset 0x24f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x43, offset 0x254 + {value: 0x0000, lo: 0x0c}, + {value: 0x02a9, lo: 0x80, hi: 0x80}, + {value: 0x02b1, lo: 0x81, hi: 0x81}, + {value: 0x02b9, lo: 0x82, hi: 0x82}, + {value: 0x02c1, lo: 0x83, hi: 0x83}, + {value: 0x02c9, lo: 0x84, hi: 0x85}, + {value: 0x02d1, lo: 0x86, hi: 0x86}, + {value: 0x02d9, lo: 0x87, hi: 0x87}, + {value: 0x057d, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x059d, lo: 0x90, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x059d, lo: 0xbd, hi: 0xbf}, + // Block 0x44, offset 0x261 + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x92}, + {value: 0x0018, lo: 0x93, hi: 0x93}, + {value: 0x3308, lo: 0x94, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa8}, + {value: 0x0008, lo: 0xa9, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x3008, lo: 0xb7, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x45, offset 0x272 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x87}, + {value: 0xe045, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0xe045, lo: 0x98, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0xe045, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbf}, + // Block 0x46, offset 0x27d + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x8f}, + {value: 0x3318, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x47, offset 0x282 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x0851, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x48, offset 0x28b + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0859, lo: 0xac, hi: 0xac}, + {value: 0x0861, lo: 0xad, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xae}, + {value: 0x0869, lo: 0xaf, hi: 0xaf}, + {value: 0x0871, lo: 0xb0, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x49, offset 0x293 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x9f}, + {value: 0x0080, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xad}, + {value: 0x0080, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x4a, offset 0x299 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xa8}, + {value: 0x09dd, lo: 0xa9, hi: 0xa9}, + {value: 0x09fd, lo: 0xaa, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xbf}, + // Block 0x4b, offset 0x29e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xbf}, + // Block 0x4c, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0929, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0xbf}, + // Block 0x4d, offset 0x2a5 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0e7e, lo: 0xb4, hi: 0xb4}, + {value: 0x0932, lo: 0xb5, hi: 0xb5}, + {value: 0x0e9e, lo: 0xb6, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x4e, offset 0x2ab + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9b}, + {value: 0x0939, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0xbf}, + // Block 0x4f, offset 0x2af + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x50, offset 0x2b3 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0xbf}, + // Block 0x51, offset 0x2b7 + {value: 0x0000, lo: 0x04}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x03f5, lo: 0x90, hi: 0x9f}, + {value: 0x0ebd, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x52, offset 0x2bc + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x53, offset 0x2c4 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xae}, + {value: 0xe075, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0x54, offset 0x2cb + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x55, offset 0x2d6 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xbf}, + // Block 0x56, offset 0x2e0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x57, offset 0x2e4 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x58, offset 0x2e7 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9e}, + {value: 0x0ef5, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x59, offset 0x2ed + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb2}, + {value: 0x0f15, lo: 0xb3, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x5a, offset 0x2f1 + {value: 0x0020, lo: 0x01}, + {value: 0x0f35, lo: 0x80, hi: 0xbf}, + // Block 0x5b, offset 0x2f3 + {value: 0x0020, lo: 0x02}, + {value: 0x1735, lo: 0x80, hi: 0x8f}, + {value: 0x1915, lo: 0x90, hi: 0xbf}, + // Block 0x5c, offset 0x2f6 + {value: 0x0020, lo: 0x01}, + {value: 0x1f15, lo: 0x80, hi: 0xbf}, + // Block 0x5d, offset 0x2f8 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x5e, offset 0x2fb + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x3308, lo: 0x99, hi: 0x9a}, + {value: 0x096a, lo: 0x9b, hi: 0x9b}, + {value: 0x0972, lo: 0x9c, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9e}, + {value: 0x0979, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x5f, offset 0x305 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x0981, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x308 + {value: 0x0000, lo: 0x0e}, + {value: 0x0040, lo: 0x80, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb0}, + {value: 0x2a35, lo: 0xb1, hi: 0xb1}, + {value: 0x2a55, lo: 0xb2, hi: 0xb2}, + {value: 0x2a75, lo: 0xb3, hi: 0xb3}, + {value: 0x2a95, lo: 0xb4, hi: 0xb4}, + {value: 0x2a75, lo: 0xb5, hi: 0xb5}, + {value: 0x2ab5, lo: 0xb6, hi: 0xb6}, + {value: 0x2ad5, lo: 0xb7, hi: 0xb7}, + {value: 0x2af5, lo: 0xb8, hi: 0xb9}, + {value: 0x2b15, lo: 0xba, hi: 0xbb}, + {value: 0x2b35, lo: 0xbc, hi: 0xbd}, + {value: 0x2b15, lo: 0xbe, hi: 0xbf}, + // Block 0x61, offset 0x317 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x62, offset 0x31b + {value: 0x0008, lo: 0x03}, + {value: 0x098a, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0a82, lo: 0xa0, hi: 0xbf}, + // Block 0x63, offset 0x31f + {value: 0x0008, lo: 0x01}, + {value: 0x0d19, lo: 0x80, hi: 0xbf}, + // Block 0x64, offset 0x321 + {value: 0x0008, lo: 0x08}, + {value: 0x0f19, lo: 0x80, hi: 0xb0}, + {value: 0x4045, lo: 0xb1, hi: 0xb1}, + {value: 0x10a1, lo: 0xb2, hi: 0xb3}, + {value: 0x4065, lo: 0xb4, hi: 0xb4}, + {value: 0x10b1, lo: 0xb5, hi: 0xb7}, + {value: 0x4085, lo: 0xb8, hi: 0xb8}, + {value: 0x4085, lo: 0xb9, hi: 0xb9}, + {value: 0x10c9, lo: 0xba, hi: 0xbf}, + // Block 0x65, offset 0x32a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x66, offset 0x32e + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x67, offset 0x333 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xbf}, + // Block 0x68, offset 0x338 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb1}, + {value: 0x0018, lo: 0xb2, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x69, offset 0x33e + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0x85}, + {value: 0x3b08, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x3308, lo: 0x8b, hi: 0x8b}, + {value: 0x0008, lo: 0x8c, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xab}, + {value: 0x3b08, lo: 0xac, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x6a, offset 0x34e + {value: 0x0000, lo: 0x05}, + {value: 0x0208, lo: 0x80, hi: 0xb1}, + {value: 0x0108, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6b, offset 0x354 + {value: 0x0000, lo: 0x03}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xbf}, + // Block 0x6c, offset 0x358 + {value: 0x0000, lo: 0x0e}, + {value: 0x3008, lo: 0x80, hi: 0x83}, + {value: 0x3b08, lo: 0x84, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xba}, + {value: 0x0008, lo: 0xbb, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x367 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x6e, offset 0x36c + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x91}, + {value: 0x3008, lo: 0x92, hi: 0x92}, + {value: 0x3808, lo: 0x93, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x6f, offset 0x374 + {value: 0x0000, lo: 0x09}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb9}, + {value: 0x3008, lo: 0xba, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x70, offset 0x37e + {value: 0x0000, lo: 0x0a}, + {value: 0x3808, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x71, offset 0x389 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x72, offset 0x391 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8b}, + {value: 0x3308, lo: 0x8c, hi: 0x8c}, + {value: 0x3008, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x3008, lo: 0xbd, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0x73, offset 0x3a2 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbf}, + // Block 0x74, offset 0x3ab + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x9a}, + {value: 0x0008, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xaa}, + {value: 0x3008, lo: 0xab, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb5}, + {value: 0x3b08, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x75, offset 0x3bb + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x90}, + {value: 0x0008, lo: 0x91, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x76, offset 0x3c8 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x449d, lo: 0x9c, hi: 0x9c}, + {value: 0x44b5, lo: 0x9d, hi: 0x9d}, + {value: 0x0941, lo: 0x9e, hi: 0x9e}, + {value: 0xe06d, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa8}, + {value: 0x13f9, lo: 0xa9, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x44cd, lo: 0xb0, hi: 0xbf}, + // Block 0x77, offset 0x3d4 + {value: 0x0000, lo: 0x04}, + {value: 0x44ed, lo: 0x80, hi: 0x8f}, + {value: 0x450d, lo: 0x90, hi: 0x9f}, + {value: 0x452d, lo: 0xa0, hi: 0xaf}, + {value: 0x450d, lo: 0xb0, hi: 0xbf}, + // Block 0x78, offset 0x3d9 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3b08, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x79, offset 0x3e6 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x7a, offset 0x3ea + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x7b, offset 0x3ef + {value: 0x0000, lo: 0x01}, + {value: 0x0040, lo: 0x80, hi: 0xbf}, + // Block 0x7c, offset 0x3f1 + {value: 0x0020, lo: 0x01}, + {value: 0x454d, lo: 0x80, hi: 0xbf}, + // Block 0x7d, offset 0x3f3 + {value: 0x0020, lo: 0x03}, + {value: 0x4d4d, lo: 0x80, hi: 0x94}, + {value: 0x4b0d, lo: 0x95, hi: 0x95}, + {value: 0x4fed, lo: 0x96, hi: 0xbf}, + // Block 0x7e, offset 0x3f7 + {value: 0x0020, lo: 0x01}, + {value: 0x552d, lo: 0x80, hi: 0xbf}, + // Block 0x7f, offset 0x3f9 + {value: 0x0020, lo: 0x03}, + {value: 0x5d2d, lo: 0x80, hi: 0x84}, + {value: 0x568d, lo: 0x85, hi: 0x85}, + {value: 0x5dcd, lo: 0x86, hi: 0xbf}, + // Block 0x80, offset 0x3fd + {value: 0x0020, lo: 0x08}, + {value: 0x6b8d, lo: 0x80, hi: 0x8f}, + {value: 0x6d4d, lo: 0x90, hi: 0x90}, + {value: 0x6d8d, lo: 0x91, hi: 0xab}, + {value: 0x1401, lo: 0xac, hi: 0xac}, + {value: 0x70ed, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x710d, lo: 0xb0, hi: 0xbf}, + // Block 0x81, offset 0x406 + {value: 0x0020, lo: 0x05}, + {value: 0x730d, lo: 0x80, hi: 0xad}, + {value: 0x656d, lo: 0xae, hi: 0xae}, + {value: 0x78cd, lo: 0xaf, hi: 0xb5}, + {value: 0x6f8d, lo: 0xb6, hi: 0xb6}, + {value: 0x79ad, lo: 0xb7, hi: 0xbf}, + // Block 0x82, offset 0x40c + {value: 0x0008, lo: 0x03}, + {value: 0x1751, lo: 0x80, hi: 0x82}, + {value: 0x1741, lo: 0x83, hi: 0x83}, + {value: 0x1769, lo: 0x84, hi: 0xbf}, + // Block 0x83, offset 0x410 + {value: 0x0008, lo: 0x0f}, + {value: 0x1d81, lo: 0x80, hi: 0x83}, + {value: 0x1d99, lo: 0x84, hi: 0x85}, + {value: 0x1da1, lo: 0x86, hi: 0x87}, + {value: 0x1da9, lo: 0x88, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x1de9, lo: 0x92, hi: 0x97}, + {value: 0x1e11, lo: 0x98, hi: 0x9c}, + {value: 0x1e31, lo: 0x9d, hi: 0xb3}, + {value: 0x1d71, lo: 0xb4, hi: 0xb4}, + {value: 0x1d81, lo: 0xb5, hi: 0xb5}, + {value: 0x1ee9, lo: 0xb6, hi: 0xbb}, + {value: 0x1f09, lo: 0xbc, hi: 0xbc}, + {value: 0x1ef9, lo: 0xbd, hi: 0xbd}, + {value: 0x1f19, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x420 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x85, offset 0x42a + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x86, offset 0x42f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x87, offset 0x432 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x88, offset 0x438 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x89, offset 0x43f + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x444 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8b, offset 0x448 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x8c, offset 0x44e + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xbf}, + // Block 0x8d, offset 0x453 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x8e, offset 0x45c + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8f, offset 0x461 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x90, offset 0x467 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x97}, + {value: 0x8b0d, lo: 0x98, hi: 0x9f}, + {value: 0x8b25, lo: 0xa0, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xbf}, + // Block 0x91, offset 0x46e + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x8b25, lo: 0xb0, hi: 0xb7}, + {value: 0x8b0d, lo: 0xb8, hi: 0xbf}, + // Block 0x92, offset 0x475 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x93, offset 0x47c + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x94, offset 0x480 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x95, offset 0x483 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xbf}, + // Block 0x96, offset 0x488 + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0808, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0808, lo: 0x8a, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb6}, + {value: 0x0808, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbb}, + {value: 0x0808, lo: 0xbc, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x0808, lo: 0xbf, hi: 0xbf}, + // Block 0x97, offset 0x494 + {value: 0x0000, lo: 0x05}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0818, lo: 0x97, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb6}, + {value: 0x0818, lo: 0xb7, hi: 0xbf}, + // Block 0x98, offset 0x49a + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa6}, + {value: 0x0818, lo: 0xa7, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x99, offset 0x49f + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb3}, + {value: 0x0808, lo: 0xb4, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x0818, lo: 0xbb, hi: 0xbf}, + // Block 0x9a, offset 0x4a6 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0818, lo: 0x96, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0818, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x4ae + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbb}, + {value: 0x0818, lo: 0xbc, hi: 0xbd}, + {value: 0x0808, lo: 0xbe, hi: 0xbf}, + // Block 0x9c, offset 0x4b3 + {value: 0x0000, lo: 0x03}, + {value: 0x0818, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x0818, lo: 0x92, hi: 0xbf}, + // Block 0x9d, offset 0x4b7 + {value: 0x0000, lo: 0x0f}, + {value: 0x0808, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8b}, + {value: 0x3308, lo: 0x8c, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x94}, + {value: 0x0808, lo: 0x95, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x98}, + {value: 0x0808, lo: 0x99, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x4c7 + {value: 0x0000, lo: 0x06}, + {value: 0x0818, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0818, lo: 0x90, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xbc}, + {value: 0x0818, lo: 0xbd, hi: 0xbf}, + // Block 0x9f, offset 0x4ce + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0x9c}, + {value: 0x0818, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xa0, offset 0x4d2 + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xbf}, + // Block 0xa1, offset 0x4d6 + {value: 0x0000, lo: 0x06}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0818, lo: 0x98, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb7}, + {value: 0x0818, lo: 0xb8, hi: 0xbf}, + // Block 0xa2, offset 0x4dd + {value: 0x0000, lo: 0x01}, + {value: 0x0808, lo: 0x80, hi: 0xbf}, + // Block 0xa3, offset 0x4df + {value: 0x0000, lo: 0x02}, + {value: 0x0808, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xa4, offset 0x4e2 + {value: 0x0000, lo: 0x02}, + {value: 0x03dd, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xa5, offset 0x4e5 + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb9}, + {value: 0x0818, lo: 0xba, hi: 0xbf}, + // Block 0xa6, offset 0x4e9 + {value: 0x0000, lo: 0x08}, + {value: 0x0908, lo: 0x80, hi: 0x80}, + {value: 0x0a08, lo: 0x81, hi: 0xa1}, + {value: 0x0c08, lo: 0xa2, hi: 0xa2}, + {value: 0x0a08, lo: 0xa3, hi: 0xa3}, + {value: 0x3308, lo: 0xa4, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0808, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xa7, offset 0x4f2 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0818, lo: 0xa0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xa8, offset 0x4f6 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xac}, + {value: 0x0818, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0808, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xa9, offset 0x4fe + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbf}, + // Block 0xaa, offset 0x501 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0x9c}, + {value: 0x0818, lo: 0x9d, hi: 0xa6}, + {value: 0x0808, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb2}, + {value: 0x0c08, lo: 0xb3, hi: 0xb3}, + {value: 0x0a08, lo: 0xb4, hi: 0xbf}, + // Block 0xab, offset 0x509 + {value: 0x0000, lo: 0x0a}, + {value: 0x0a08, lo: 0x80, hi: 0x84}, + {value: 0x0808, lo: 0x85, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x90}, + {value: 0x0a18, lo: 0x91, hi: 0x93}, + {value: 0x0c18, lo: 0x94, hi: 0x94}, + {value: 0x0818, lo: 0x95, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb3}, + {value: 0x0c08, lo: 0xb4, hi: 0xb5}, + {value: 0x0a08, lo: 0xb6, hi: 0xbf}, + // Block 0xac, offset 0x514 + {value: 0x0000, lo: 0x0e}, + {value: 0x0a08, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x85}, + {value: 0x0818, lo: 0x86, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb0}, + {value: 0x0808, lo: 0xb1, hi: 0xb1}, + {value: 0x0a08, lo: 0xb2, hi: 0xb3}, + {value: 0x0c08, lo: 0xb4, hi: 0xb6}, + {value: 0x0808, lo: 0xb7, hi: 0xb7}, + {value: 0x0a08, lo: 0xb8, hi: 0xb8}, + {value: 0x0c08, lo: 0xb9, hi: 0xba}, + {value: 0x0a08, lo: 0xbb, hi: 0xbc}, + {value: 0x0c08, lo: 0xbd, hi: 0xbd}, + {value: 0x0a08, lo: 0xbe, hi: 0xbf}, + // Block 0xad, offset 0x523 + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x80}, + {value: 0x0a08, lo: 0x81, hi: 0x81}, + {value: 0x0c08, lo: 0x82, hi: 0x83}, + {value: 0x0a08, lo: 0x84, hi: 0x84}, + {value: 0x0818, lo: 0x85, hi: 0x88}, + {value: 0x0c18, lo: 0x89, hi: 0x89}, + {value: 0x0a18, lo: 0x8a, hi: 0x8a}, + {value: 0x0918, lo: 0x8b, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xae, offset 0x52f + {value: 0x0000, lo: 0x05}, + {value: 0x3008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbf}, + // Block 0xaf, offset 0x535 + {value: 0x0000, lo: 0x0c}, + {value: 0x3308, lo: 0x80, hi: 0x85}, + {value: 0x3b08, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x3b08, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xb0, offset 0x542 + {value: 0x0000, lo: 0x0b}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb6}, + {value: 0x3008, lo: 0xb7, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0xb1, offset 0x54e + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xb2, offset 0x556 + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xb2}, + {value: 0x3b08, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xbf}, + // Block 0xb3, offset 0x55f + {value: 0x0000, lo: 0x0a}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x3008, lo: 0x85, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xb4, offset 0x56a + {value: 0x0000, lo: 0x06}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xbe}, + {value: 0x3008, lo: 0xbf, hi: 0xbf}, + // Block 0xb5, offset 0x571 + {value: 0x0000, lo: 0x0e}, + {value: 0x3808, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x3308, lo: 0x89, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8d}, + {value: 0x3008, lo: 0x8e, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xb6, offset 0x580 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb1}, + {value: 0x3008, lo: 0xb2, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x3808, lo: 0xb5, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x58d + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0xbf}, + // Block 0xb8, offset 0x591 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xb9, offset 0x59e + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x3308, lo: 0x9f, hi: 0x9f}, + {value: 0x3008, lo: 0xa0, hi: 0xa2}, + {value: 0x3308, lo: 0xa3, hi: 0xa9}, + {value: 0x3b08, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xba, offset 0x5a7 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbf}, + // Block 0xbb, offset 0x5ab + {value: 0x0000, lo: 0x0e}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x84}, + {value: 0x3008, lo: 0x85, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9d}, + {value: 0x3308, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xbf}, + // Block 0xbc, offset 0x5ba + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb8}, + {value: 0x3008, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0xbd, offset 0x5c2 + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xbe, offset 0x5cd + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xbf, offset 0x5d6 + {value: 0x0000, lo: 0x05}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9b}, + {value: 0x3308, lo: 0x9c, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xc0, offset 0x5dc + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xc1, offset 0x5e4 + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xc2, offset 0x5ed + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb5}, + {value: 0x3808, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xc3, offset 0x5f9 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xc4, offset 0x5fc + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9f}, + {value: 0x3008, lo: 0xa0, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xaa}, + {value: 0x3b08, lo: 0xab, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xc5, offset 0x608 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0xbf}, + // Block 0xc6, offset 0x60b + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0xc7, offset 0x614 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xbf}, + // Block 0xc8, offset 0x617 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x61c + {value: 0x0000, lo: 0x08}, + {value: 0x3008, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xca, offset 0x625 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xbf}, + // Block 0xcb, offset 0x62a + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x3008, lo: 0x91, hi: 0x93}, + {value: 0x3308, lo: 0x94, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x99}, + {value: 0x3308, lo: 0x9a, hi: 0x9b}, + {value: 0x3008, lo: 0x9c, hi: 0x9f}, + {value: 0x3b08, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x0018, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xa3}, + {value: 0x3008, lo: 0xa4, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xbf}, + // Block 0xcc, offset 0x637 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x3b08, lo: 0xb4, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb8}, + {value: 0x3008, lo: 0xb9, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x3308, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x642 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x3b08, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x3308, lo: 0x91, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x98}, + {value: 0x3308, lo: 0x99, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0xbf}, + // Block 0xce, offset 0x64b + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x3308, lo: 0x8a, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x98}, + {value: 0x3b08, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xa2}, + {value: 0x0040, lo: 0xa3, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xcf, offset 0x656 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xd0, offset 0x659 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xd1, offset 0x65c + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x666 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xbf}, + // Block 0xd3, offset 0x66f + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xa9}, + {value: 0x3308, lo: 0xaa, hi: 0xb0}, + {value: 0x3008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xd4, offset 0x67b + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x688 + {value: 0x0000, lo: 0x0c}, + {value: 0x3308, lo: 0x80, hi: 0x83}, + {value: 0x3b08, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xbf}, + // Block 0xd6, offset 0x695 + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x3008, lo: 0x8a, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x3008, lo: 0x93, hi: 0x94}, + {value: 0x3308, lo: 0x95, hi: 0x95}, + {value: 0x3008, lo: 0x96, hi: 0x96}, + {value: 0x3b08, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xbf}, + // Block 0xd7, offset 0x6a3 + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xd8, offset 0x6aa + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0xd9, offset 0x6b5 + {value: 0x0000, lo: 0x06}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3808, lo: 0x81, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xda, offset 0x6bc + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0xdb, offset 0x6c0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x6c4 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xdd, offset 0x6c7 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xde, offset 0x6cc + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xdf, offset 0x6cf + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbf}, + // Block 0xe0, offset 0x6d2 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xe1, offset 0x6d6 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0340, lo: 0xb0, hi: 0xbf}, + // Block 0xe2, offset 0x6d9 + {value: 0x0000, lo: 0x04}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0xe3, offset 0x6de + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xe4, offset 0x6e5 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x6e8 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xe6, offset 0x6f0 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0xe7, offset 0x6f4 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0xe8, offset 0x6ff + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0xe9, offset 0x702 + {value: 0x0000, lo: 0x02}, + {value: 0xe105, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0xea, offset 0x705 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0xeb, offset 0x708 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x3008, lo: 0x91, hi: 0xbf}, + // Block 0xec, offset 0x70e + {value: 0x0000, lo: 0x05}, + {value: 0x3008, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xed, offset 0x714 + {value: 0x0000, lo: 0x08}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa1}, + {value: 0x0018, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xa3}, + {value: 0x3308, lo: 0xa4, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xee, offset 0x71d + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0xef, offset 0x720 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0xf0, offset 0x723 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xf1, offset 0x726 + {value: 0x0000, lo: 0x07}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xf2, offset 0x72e + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x0040, lo: 0xa3, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xf3, offset 0x733 + {value: 0x0000, lo: 0x08}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x94}, + {value: 0x0008, lo: 0x95, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xa3}, + {value: 0x0008, lo: 0xa4, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xf4, offset 0x73c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0xf5, offset 0x73f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0xf6, offset 0x744 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x03c0, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xbf}, + // Block 0xf7, offset 0x74e + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xbf}, + // Block 0xf8, offset 0x752 + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0xf9, offset 0x756 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xfa, offset 0x759 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xfb, offset 0x75c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xbf}, + // Block 0xfc, offset 0x760 + {value: 0x0000, lo: 0x0e}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0x2379, lo: 0x9e, hi: 0x9e}, + {value: 0x2381, lo: 0x9f, hi: 0x9f}, + {value: 0x2389, lo: 0xa0, hi: 0xa0}, + {value: 0x2391, lo: 0xa1, hi: 0xa1}, + {value: 0x2399, lo: 0xa2, hi: 0xa2}, + {value: 0x23a1, lo: 0xa3, hi: 0xa3}, + {value: 0x23a9, lo: 0xa4, hi: 0xa4}, + {value: 0x3018, lo: 0xa5, hi: 0xa6}, + {value: 0x3318, lo: 0xa7, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xac}, + {value: 0x3018, lo: 0xad, hi: 0xb2}, + {value: 0x0340, lo: 0xb3, hi: 0xba}, + {value: 0x3318, lo: 0xbb, hi: 0xbf}, + // Block 0xfd, offset 0x76f + {value: 0x0000, lo: 0x0b}, + {value: 0x3318, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x84}, + {value: 0x3318, lo: 0x85, hi: 0x8b}, + {value: 0x0018, lo: 0x8c, hi: 0xa9}, + {value: 0x3318, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xba}, + {value: 0x23b1, lo: 0xbb, hi: 0xbb}, + {value: 0x23b9, lo: 0xbc, hi: 0xbc}, + {value: 0x23c1, lo: 0xbd, hi: 0xbd}, + {value: 0x23c9, lo: 0xbe, hi: 0xbe}, + {value: 0x23d1, lo: 0xbf, hi: 0xbf}, + // Block 0xfe, offset 0x77b + {value: 0x0000, lo: 0x03}, + {value: 0x23d9, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0xff, offset 0x77f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x3318, lo: 0x82, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0xbf}, + // Block 0x100, offset 0x784 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x101, offset 0x789 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x102, offset 0x78e + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xba}, + {value: 0x3308, lo: 0xbb, hi: 0xbf}, + // Block 0x103, offset 0x792 + {value: 0x0000, lo: 0x04}, + {value: 0x3308, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x104, offset 0x797 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x3308, lo: 0xa1, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x105, offset 0x7a0 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0x106, offset 0x7a5 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0x107, offset 0x7a9 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x108, offset 0x7af + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0x109, offset 0x7b5 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x3308, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xbf}, + // Block 0x10a, offset 0x7ba + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x10b, offset 0x7c0 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x10c, offset 0x7c6 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x10d, offset 0x7d0 + {value: 0x0000, lo: 0x05}, + {value: 0x0808, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x86}, + {value: 0x0818, lo: 0x87, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0x10e, offset 0x7d6 + {value: 0x0000, lo: 0x08}, + {value: 0x0a08, lo: 0x80, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x8a}, + {value: 0x0b08, lo: 0x8b, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0818, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x10f, offset 0x7df + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xb0}, + {value: 0x0818, lo: 0xb1, hi: 0xbf}, + // Block 0x110, offset 0x7e2 + {value: 0x0000, lo: 0x02}, + {value: 0x0818, lo: 0x80, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x111, offset 0x7e5 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0818, lo: 0x81, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x112, offset 0x7e9 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0x113, offset 0x7ed + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x7f1 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x115, offset 0x7f7 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x116, offset 0x7fd + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0x2709, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xbf}, + // Block 0x117, offset 0x802 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xbf}, + // Block 0x118, offset 0x805 + {value: 0x0000, lo: 0x0f}, + {value: 0x2889, lo: 0x80, hi: 0x80}, + {value: 0x2891, lo: 0x81, hi: 0x81}, + {value: 0x2899, lo: 0x82, hi: 0x82}, + {value: 0x28a1, lo: 0x83, hi: 0x83}, + {value: 0x28a9, lo: 0x84, hi: 0x84}, + {value: 0x28b1, lo: 0x85, hi: 0x85}, + {value: 0x28b9, lo: 0x86, hi: 0x86}, + {value: 0x28c1, lo: 0x87, hi: 0x87}, + {value: 0x28c9, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x28d1, lo: 0x90, hi: 0x90}, + {value: 0x28d9, lo: 0x91, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xbf}, + // Block 0x119, offset 0x815 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x11a, offset 0x81c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x11b, offset 0x820 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x11c, offset 0x827 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x11d, offset 0x82b + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x831 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0x11f, offset 0x838 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x120, offset 0x83f + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x121, offset 0x845 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x122, offset 0x84e + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0xbf}, + // Block 0x123, offset 0x852 + {value: 0x0000, lo: 0x0d}, + {value: 0x0018, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0xaf}, + {value: 0x06e1, lo: 0xb0, hi: 0xb0}, + {value: 0x0049, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb2, hi: 0xb2}, + {value: 0x0031, lo: 0xb3, hi: 0xb3}, + {value: 0x06e9, lo: 0xb4, hi: 0xb4}, + {value: 0x06f1, lo: 0xb5, hi: 0xb5}, + {value: 0x06f9, lo: 0xb6, hi: 0xb6}, + {value: 0x0701, lo: 0xb7, hi: 0xb7}, + {value: 0x0709, lo: 0xb8, hi: 0xb8}, + {value: 0x0711, lo: 0xb9, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x124, offset 0x860 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x863 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x126, offset 0x866 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x127, offset 0x86a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x128, offset 0x86e + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x129, offset 0x871 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbf}, + // Block 0x12a, offset 0x875 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x12b, offset 0x878 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0340, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x9f}, + {value: 0x0340, lo: 0xa0, hi: 0xbf}, + // Block 0x12c, offset 0x87d + {value: 0x0000, lo: 0x01}, + {value: 0x0340, lo: 0x80, hi: 0xbf}, + // Block 0x12d, offset 0x87f + {value: 0x0000, lo: 0x01}, + {value: 0x33c0, lo: 0x80, hi: 0xbf}, + // Block 0x12e, offset 0x881 + {value: 0x0000, lo: 0x02}, + {value: 0x33c0, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, +} + +// Total table size 46723 bytes (45KiB); checksum: 4CF3143A diff --git a/vendor/golang.org/x/net/idna/trie.go b/vendor/golang.org/x/net/idna/trie.go index c4ef847e7..421274172 100644 --- a/vendor/golang.org/x/net/idna/trie.go +++ b/vendor/golang.org/x/net/idna/trie.go @@ -6,27 +6,6 @@ package idna -// appendMapping appends the mapping for the respective rune. isMapped must be -// true. A mapping is a categorization of a rune as defined in UTS #46. -func (c info) appendMapping(b []byte, s string) []byte { - index := int(c >> indexShift) - if c&xorBit == 0 { - s := mappings[index:] - return append(b, s[1:s[0]+1]...) - } - b = append(b, s...) - if c&inlineXOR == inlineXOR { - // TODO: support and handle two-byte inline masks - b[len(b)-1] ^= byte(index) - } else { - for p := len(b) - int(xorData[index]); p < len(b); p++ { - index++ - b[p] ^= xorData[index] - } - } - return b -} - // Sparse block handling code. type valueRange struct { diff --git a/vendor/golang.org/x/net/idna/trie12.0.0.go b/vendor/golang.org/x/net/idna/trie12.0.0.go new file mode 100644 index 000000000..bb63f904b --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie12.0.0.go @@ -0,0 +1,31 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.16 +// +build !go1.16 + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + s := mappings[index:] + return append(b, s[1:s[0]+1]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} diff --git a/vendor/golang.org/x/net/idna/trie13.0.0.go b/vendor/golang.org/x/net/idna/trie13.0.0.go new file mode 100644 index 000000000..7d68a8dc1 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie13.0.0.go @@ -0,0 +1,31 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.16 +// +build go1.16 + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + p := index + return append(b, mappings[mappingIndex[p]:mappingIndex[p+1]]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c36..e6f31d374 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index be0423e68..8f775fafa 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -519,7 +519,7 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || @@ -624,7 +624,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -741,7 +741,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -760,7 +761,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 000000000..ca0513632 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,14 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris +// +build aix darwin dragonfly freebsd openbsd solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 000000000..fa93d0aa9 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,53 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd +// +build linux netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index c406ae00f..9a6e5acac 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -535,21 +535,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c3270..4217de518 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -601,20 +601,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 206921504..135cc3cd7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index fbaeb5fff..a730878e4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1874,7 +1885,7 @@ func Getpgrp() (pid int) { //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -2113,21 +2124,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2136,6 +2133,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2420,6 +2423,54 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + /* * Unimplemented */ @@ -2461,7 +2512,6 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { // MqTimedreceive // MqTimedsend // MqUnlink -// Mremap // Msgctl // Msgget // Msgrcv diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 5b21fcfd7..70601ce36 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -40,7 +40,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index a81f5742b..f5266689a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -33,7 +33,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 69d2d7c3d..f6ab02ec1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -28,7 +28,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 76d564095..93fe59d25 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -31,7 +31,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 35851ef70..5e6ceee12 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -32,7 +32,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -177,3 +177,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index 018d7d478..ddd1ac853 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -360,6 +360,18 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} + /* * Unimplemented */ @@ -564,7 +576,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { // mq_timedreceive // mq_timedsend // mq_unlink -// mremap // msgget // msgrcv // msgsnd diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index f9c7a9663..c5f166a11 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -151,6 +151,21 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL @@ -338,8 +353,6 @@ func Uname(uname *Utsname) error { // getgid // getitimer // getlogin -// getresgid -// getresuid // getthrid // ktrace // lfs_bmapv diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index b600a289d..72d23575f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -716,20 +716,6 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 8e48c29ec..8bb30e7ce 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -147,6 +147,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index d3d49ec3e..44e72edb4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -285,25 +285,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index de936b677..3784f402e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -493,6 +493,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -826,9 +827,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1198,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1235,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1860,6 +1864,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1880,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1904,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2204,6 +2213,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2231,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2361,6 +2372,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2381,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2403,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2423,6 +2438,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2523,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2554,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -3072,7 +3091,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3238,6 +3257,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f1e..cfb143001 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3ea9..df64f2d59 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee24d..3025cd5b2 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c3e..09e1ffbef 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -443,6 +452,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +525,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164f4..a45723540 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c9b..fee7dfb81 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26ac6..a5b2373ae 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e32c..5dde82c98 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce15c..2e80ea6b3 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c83f..a65dcd7cb 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad0f..cbd34e3d8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1fd..e4afa7a31 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9e4..44f45a039 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db95..74733e260 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f61925269..f5f3934b1 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -30,22 +30,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +338,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index da63d9d78..a07321bed 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1356,7 +1356,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1868,6 +1868,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2172,3 +2183,17 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 0b2923958..0ab4f2ed7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -531,3 +531,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index cdb2af5ae..35f499b32 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 9d25f76b0..3cda65b0d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index d3f803516..1e1fea902 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 887188a52..3b77da110 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 6699a783e..9ab9abf72 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 04f0de34b..3dcacd30d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 1e775fe05..915761eab 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 27b6f4df7..2763620b0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 7f6427899..8e87fdf15 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index b797045fd..c92231404 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 756ef7b17..12a7a2160 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index a87126622..a6bc32c92 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 7bc2e24eb..b19e8aa03 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 05d4bffd7..b4e7bceab 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 739be6217..fb99594c9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 74a25f8d6..ca3f76600 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 7d95a1978..32cbbbc52 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index 990be2457..477a7d5b2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8c0..ef285c567 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -251,6 +251,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea465204..e6ed7d637 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -372,6 +372,7 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727cf..26ef52aaf 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -866,6 +866,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1543,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1977,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x21 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2564,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2580,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2625,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2636,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2671,7 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,12 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2723,9 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2733,6 +2763,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2778,7 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2803,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2838,6 +2876,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2889,19 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc ) const ( @@ -3605,7 +3660,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3700,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3804,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3842,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4499,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x145 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4728,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4869,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x99 NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5795,6 +5850,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5861,10 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc1495c..6d8acbcc5 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -337,6 +337,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff96..59293c688 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -350,6 +350,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a6031..40cfa38c2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -328,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651ab..055bc4216 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -329,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c51813..f28affbc6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -330,6 +330,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4dd0..9d71e7ccd 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8fc0..fd5ccd332 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd2c..7704de77a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba53..df00b8757 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf1f..0942840db 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -340,6 +340,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4ce..034874395 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4e8..bad067047 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f9612..83c69c119 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -357,6 +357,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +718,26 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cefac..aa268d025 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -352,6 +352,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a01380..444045b6c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -334,6 +334,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index c964b6848..c44a1b963 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -218,6 +218,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c22..373d16388 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -135,14 +135,14 @@ func Getpagesize() int { return 4096 } // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallback(fn interface{}) uintptr { return syscall.NewCallback(fn) } // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallbackCDecl(fn interface{}) uintptr { return syscall.NewCallbackCDecl(fn) } @@ -405,7 +405,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -1354,6 +1354,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index a81ea2c70..566dd3e31 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -3516,12 +3516,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/term/term_unix.go b/vendor/golang.org/x/term/term_unix.go index a4e31ab1b..62c2b3f41 100644 --- a/vendor/golang.org/x/term/term_unix.go +++ b/vendor/golang.org/x/term/term_unix.go @@ -60,7 +60,7 @@ func restore(fd int, state *State) error { func getSize(fd int) (width, height int, err error) { ws, err := unix.IoctlGetWinsize(fd, unix.TIOCGWINSZ) if err != nil { - return -1, -1, err + return 0, 0, err } return int(ws.Col), int(ws.Row), nil } diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de59..a09ed198a 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b58378..14167e74e 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f4947..1153baf29 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b69..a6573dcb2 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go index f248effae..ffadb7beb 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go new file mode 100644 index 000000000..92cce5802 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go @@ -0,0 +1,2043 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 19904 bytes (19.44 KiB). Checksum: b1f201ed2debb6c8. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 259 blocks, 16576 entries, 16576 bytes +// The third block is the zero block. +var bidiValues = [16576]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x000d, 0x5f1: 0x000d, 0x5f2: 0x000d, 0x5f3: 0x000d, 0x5f4: 0x000d, 0x5f5: 0x000d, + 0x5f6: 0x000d, 0x5f7: 0x000d, 0x5f8: 0x000d, 0x5f9: 0x000d, 0x5fa: 0x000d, 0x5fb: 0x000d, + 0x5fc: 0x000d, 0x5fd: 0x000d, 0x5fe: 0x000d, 0x5ff: 0x000d, + // Block 0x18, offset 0x600 + 0x600: 0x000d, 0x601: 0x000d, 0x602: 0x000d, 0x603: 0x000d, 0x604: 0x000d, 0x605: 0x000d, + 0x606: 0x000d, 0x607: 0x000d, 0x608: 0x000d, 0x609: 0x000d, 0x60a: 0x000d, 0x60b: 0x000d, + 0x60c: 0x000d, 0x60d: 0x000d, 0x60e: 0x000d, 0x60f: 0x0001, 0x610: 0x0005, 0x611: 0x0005, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x000c, 0x619: 0x000c, 0x61a: 0x000c, 0x61b: 0x000c, 0x61c: 0x000c, 0x61d: 0x000c, + 0x61e: 0x000c, 0x61f: 0x000c, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000c, 0x64b: 0x000c, + 0x64c: 0x000c, 0x64d: 0x000c, 0x64e: 0x000c, 0x64f: 0x000c, 0x650: 0x000c, 0x651: 0x000c, + 0x652: 0x000c, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + 0x77e: 0x000c, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x895: 0x000c, 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, 0x944: 0x000c, + 0x97c: 0x000c, 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa81: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaca: 0x000c, + 0xad2: 0x000c, 0xad3: 0x000c, 0xad4: 0x000c, 0xad6: 0x000c, + // Block 0x2c, offset 0xb00 + 0xb31: 0x000c, 0xb34: 0x000c, 0xb35: 0x000c, + 0xb36: 0x000c, 0xb37: 0x000c, 0xb38: 0x000c, 0xb39: 0x000c, 0xb3a: 0x000c, + 0xb3f: 0x0004, + // Block 0x2d, offset 0xb40 + 0xb47: 0x000c, 0xb48: 0x000c, 0xb49: 0x000c, 0xb4a: 0x000c, 0xb4b: 0x000c, + 0xb4c: 0x000c, 0xb4d: 0x000c, 0xb4e: 0x000c, + // Block 0x2e, offset 0xb80 + 0xbb1: 0x000c, 0xbb4: 0x000c, 0xbb5: 0x000c, + 0xbb6: 0x000c, 0xbb7: 0x000c, 0xbb8: 0x000c, 0xbb9: 0x000c, 0xbba: 0x000c, 0xbbb: 0x000c, + 0xbbc: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbc8: 0x000c, 0xbc9: 0x000c, 0xbca: 0x000c, 0xbcb: 0x000c, + 0xbcc: 0x000c, 0xbcd: 0x000c, 0xbce: 0x000c, + // Block 0x30, offset 0xc00 + 0xc18: 0x000c, 0xc19: 0x000c, + 0xc35: 0x000c, + 0xc37: 0x000c, 0xc39: 0x000c, 0xc3a: 0x003a, 0xc3b: 0x002a, + 0xc3c: 0x003a, 0xc3d: 0x002a, + // Block 0x31, offset 0xc40 + 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, 0xc7d: 0x000c, 0xc7e: 0x000c, + // Block 0x32, offset 0xc80 + 0xc80: 0x000c, 0xc81: 0x000c, 0xc82: 0x000c, 0xc83: 0x000c, 0xc84: 0x000c, + 0xc86: 0x000c, 0xc87: 0x000c, + 0xc8d: 0x000c, 0xc8e: 0x000c, 0xc8f: 0x000c, 0xc90: 0x000c, 0xc91: 0x000c, + 0xc92: 0x000c, 0xc93: 0x000c, 0xc94: 0x000c, 0xc95: 0x000c, 0xc96: 0x000c, 0xc97: 0x000c, + 0xc99: 0x000c, 0xc9a: 0x000c, 0xc9b: 0x000c, 0xc9c: 0x000c, 0xc9d: 0x000c, + 0xc9e: 0x000c, 0xc9f: 0x000c, 0xca0: 0x000c, 0xca1: 0x000c, 0xca2: 0x000c, 0xca3: 0x000c, + 0xca4: 0x000c, 0xca5: 0x000c, 0xca6: 0x000c, 0xca7: 0x000c, 0xca8: 0x000c, 0xca9: 0x000c, + 0xcaa: 0x000c, 0xcab: 0x000c, 0xcac: 0x000c, 0xcad: 0x000c, 0xcae: 0x000c, 0xcaf: 0x000c, + 0xcb0: 0x000c, 0xcb1: 0x000c, 0xcb2: 0x000c, 0xcb3: 0x000c, 0xcb4: 0x000c, 0xcb5: 0x000c, + 0xcb6: 0x000c, 0xcb7: 0x000c, 0xcb8: 0x000c, 0xcb9: 0x000c, 0xcba: 0x000c, 0xcbb: 0x000c, + 0xcbc: 0x000c, + // Block 0x33, offset 0xcc0 + 0xcc6: 0x000c, + // Block 0x34, offset 0xd00 + 0xd2d: 0x000c, 0xd2e: 0x000c, 0xd2f: 0x000c, + 0xd30: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, 0xd35: 0x000c, + 0xd36: 0x000c, 0xd37: 0x000c, 0xd39: 0x000c, 0xd3a: 0x000c, + 0xd3d: 0x000c, 0xd3e: 0x000c, + // Block 0x35, offset 0xd40 + 0xd58: 0x000c, 0xd59: 0x000c, + 0xd5e: 0x000c, 0xd5f: 0x000c, 0xd60: 0x000c, + 0xd71: 0x000c, 0xd72: 0x000c, 0xd73: 0x000c, 0xd74: 0x000c, + // Block 0x36, offset 0xd80 + 0xd82: 0x000c, 0xd85: 0x000c, + 0xd86: 0x000c, + 0xd8d: 0x000c, + 0xd9d: 0x000c, + // Block 0x37, offset 0xdc0 + 0xddd: 0x000c, + 0xdde: 0x000c, 0xddf: 0x000c, + // Block 0x38, offset 0xe00 + 0xe10: 0x000a, 0xe11: 0x000a, + 0xe12: 0x000a, 0xe13: 0x000a, 0xe14: 0x000a, 0xe15: 0x000a, 0xe16: 0x000a, 0xe17: 0x000a, + 0xe18: 0x000a, 0xe19: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x000a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x0009, + 0xe9b: 0x007a, 0xe9c: 0x006a, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, 0xed4: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf12: 0x000c, 0xf13: 0x000c, + 0xf32: 0x000c, 0xf33: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf74: 0x000c, 0xf75: 0x000c, + 0xf77: 0x000c, 0xf78: 0x000c, 0xf79: 0x000c, 0xf7a: 0x000c, 0xf7b: 0x000c, + 0xf7c: 0x000c, 0xf7d: 0x000c, + // Block 0x3e, offset 0xf80 + 0xf86: 0x000c, 0xf89: 0x000c, 0xf8a: 0x000c, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000c, 0xf8f: 0x000c, 0xf90: 0x000c, 0xf91: 0x000c, + 0xf92: 0x000c, 0xf93: 0x000c, + 0xf9b: 0x0004, 0xf9d: 0x000c, + 0xfb0: 0x000a, 0xfb1: 0x000a, 0xfb2: 0x000a, 0xfb3: 0x000a, 0xfb4: 0x000a, 0xfb5: 0x000a, + 0xfb6: 0x000a, 0xfb7: 0x000a, 0xfb8: 0x000a, 0xfb9: 0x000a, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x000a, 0xfc1: 0x000a, 0xfc2: 0x000a, 0xfc3: 0x000a, 0xfc4: 0x000a, 0xfc5: 0x000a, + 0xfc6: 0x000a, 0xfc7: 0x000a, 0xfc8: 0x000a, 0xfc9: 0x000a, 0xfca: 0x000a, 0xfcb: 0x000c, + 0xfcc: 0x000c, 0xfcd: 0x000c, 0xfce: 0x000b, 0xfcf: 0x000c, + // Block 0x40, offset 0x1000 + 0x1005: 0x000c, + 0x1006: 0x000c, + 0x1029: 0x000c, + // Block 0x41, offset 0x1040 + 0x1060: 0x000c, 0x1061: 0x000c, 0x1062: 0x000c, + 0x1067: 0x000c, 0x1068: 0x000c, + 0x1072: 0x000c, + 0x1079: 0x000c, 0x107a: 0x000c, 0x107b: 0x000c, + // Block 0x42, offset 0x1080 + 0x1080: 0x000a, 0x1084: 0x000a, 0x1085: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10de: 0x000a, 0x10df: 0x000a, 0x10e0: 0x000a, 0x10e1: 0x000a, 0x10e2: 0x000a, 0x10e3: 0x000a, + 0x10e4: 0x000a, 0x10e5: 0x000a, 0x10e6: 0x000a, 0x10e7: 0x000a, 0x10e8: 0x000a, 0x10e9: 0x000a, + 0x10ea: 0x000a, 0x10eb: 0x000a, 0x10ec: 0x000a, 0x10ed: 0x000a, 0x10ee: 0x000a, 0x10ef: 0x000a, + 0x10f0: 0x000a, 0x10f1: 0x000a, 0x10f2: 0x000a, 0x10f3: 0x000a, 0x10f4: 0x000a, 0x10f5: 0x000a, + 0x10f6: 0x000a, 0x10f7: 0x000a, 0x10f8: 0x000a, 0x10f9: 0x000a, 0x10fa: 0x000a, 0x10fb: 0x000a, + 0x10fc: 0x000a, 0x10fd: 0x000a, 0x10fe: 0x000a, 0x10ff: 0x000a, + // Block 0x44, offset 0x1100 + 0x1117: 0x000c, + 0x1118: 0x000c, 0x111b: 0x000c, + // Block 0x45, offset 0x1140 + 0x1156: 0x000c, + 0x1158: 0x000c, 0x1159: 0x000c, 0x115a: 0x000c, 0x115b: 0x000c, 0x115c: 0x000c, 0x115d: 0x000c, + 0x115e: 0x000c, 0x1160: 0x000c, 0x1162: 0x000c, + 0x1165: 0x000c, 0x1166: 0x000c, 0x1167: 0x000c, 0x1168: 0x000c, 0x1169: 0x000c, + 0x116a: 0x000c, 0x116b: 0x000c, 0x116c: 0x000c, + 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117f: 0x000c, + // Block 0x46, offset 0x1180 + 0x11b0: 0x000c, 0x11b1: 0x000c, 0x11b2: 0x000c, 0x11b3: 0x000c, 0x11b4: 0x000c, 0x11b5: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, 0x11bb: 0x000c, + 0x11bc: 0x000c, 0x11bd: 0x000c, 0x11be: 0x000c, 0x11bf: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x000c, 0x11c1: 0x000c, 0x11c2: 0x000c, 0x11c3: 0x000c, 0x11c4: 0x000c, 0x11c5: 0x000c, + 0x11c6: 0x000c, 0x11c7: 0x000c, 0x11c8: 0x000c, 0x11c9: 0x000c, 0x11ca: 0x000c, 0x11cb: 0x000c, + 0x11cc: 0x000c, 0x11cd: 0x000c, 0x11ce: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, 0x1202: 0x000c, 0x1203: 0x000c, + 0x1234: 0x000c, + 0x1236: 0x000c, 0x1237: 0x000c, 0x1238: 0x000c, 0x1239: 0x000c, 0x123a: 0x000c, + 0x123c: 0x000c, + // Block 0x49, offset 0x1240 + 0x1242: 0x000c, + 0x126b: 0x000c, 0x126c: 0x000c, 0x126d: 0x000c, 0x126e: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, 0x1272: 0x000c, 0x1273: 0x000c, + // Block 0x4a, offset 0x1280 + 0x1280: 0x000c, 0x1281: 0x000c, + 0x12a2: 0x000c, 0x12a3: 0x000c, + 0x12a4: 0x000c, 0x12a5: 0x000c, 0x12a8: 0x000c, 0x12a9: 0x000c, + 0x12ab: 0x000c, 0x12ac: 0x000c, 0x12ad: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12e6: 0x000c, 0x12e8: 0x000c, 0x12e9: 0x000c, + 0x12ed: 0x000c, 0x12ef: 0x000c, + 0x12f0: 0x000c, 0x12f1: 0x000c, + // Block 0x4c, offset 0x1300 + 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, + // Block 0x4d, offset 0x1340 + 0x1350: 0x000c, 0x1351: 0x000c, + 0x1352: 0x000c, 0x1354: 0x000c, 0x1355: 0x000c, 0x1356: 0x000c, 0x1357: 0x000c, + 0x1358: 0x000c, 0x1359: 0x000c, 0x135a: 0x000c, 0x135b: 0x000c, 0x135c: 0x000c, 0x135d: 0x000c, + 0x135e: 0x000c, 0x135f: 0x000c, 0x1360: 0x000c, 0x1362: 0x000c, 0x1363: 0x000c, + 0x1364: 0x000c, 0x1365: 0x000c, 0x1366: 0x000c, 0x1367: 0x000c, 0x1368: 0x000c, + 0x136d: 0x000c, + 0x1374: 0x000c, + 0x1378: 0x000c, 0x1379: 0x000c, + // Block 0x4e, offset 0x1380 + 0x13bd: 0x000a, 0x13bf: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x000a, 0x13c1: 0x000a, + 0x13cd: 0x000a, 0x13ce: 0x000a, 0x13cf: 0x000a, + 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, + 0x13ed: 0x000a, 0x13ee: 0x000a, 0x13ef: 0x000a, + 0x13fd: 0x000a, 0x13fe: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x0009, 0x1401: 0x0009, 0x1402: 0x0009, 0x1403: 0x0009, 0x1404: 0x0009, 0x1405: 0x0009, + 0x1406: 0x0009, 0x1407: 0x0009, 0x1408: 0x0009, 0x1409: 0x0009, 0x140a: 0x0009, 0x140b: 0x000b, + 0x140c: 0x000b, 0x140d: 0x000b, 0x140f: 0x0001, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x000a, 0x1420: 0x000a, 0x1421: 0x000a, 0x1422: 0x000a, 0x1423: 0x000a, + 0x1424: 0x000a, 0x1425: 0x000a, 0x1426: 0x000a, 0x1427: 0x000a, 0x1428: 0x0009, 0x1429: 0x0007, + 0x142a: 0x000e, 0x142b: 0x000e, 0x142c: 0x000e, 0x142d: 0x000e, 0x142e: 0x000e, 0x142f: 0x0006, + 0x1430: 0x0004, 0x1431: 0x0004, 0x1432: 0x0004, 0x1433: 0x0004, 0x1434: 0x0004, 0x1435: 0x000a, + 0x1436: 0x000a, 0x1437: 0x000a, 0x1438: 0x000a, 0x1439: 0x000a, 0x143a: 0x000a, 0x143b: 0x000a, + 0x143c: 0x000a, 0x143d: 0x000a, 0x143e: 0x000a, 0x143f: 0x000a, + // Block 0x51, offset 0x1440 + 0x1440: 0x000a, 0x1441: 0x000a, 0x1442: 0x000a, 0x1443: 0x000a, 0x1444: 0x0006, 0x1445: 0x009a, + 0x1446: 0x008a, 0x1447: 0x000a, 0x1448: 0x000a, 0x1449: 0x000a, 0x144a: 0x000a, 0x144b: 0x000a, + 0x144c: 0x000a, 0x144d: 0x000a, 0x144e: 0x000a, 0x144f: 0x000a, 0x1450: 0x000a, 0x1451: 0x000a, + 0x1452: 0x000a, 0x1453: 0x000a, 0x1454: 0x000a, 0x1455: 0x000a, 0x1456: 0x000a, 0x1457: 0x000a, + 0x1458: 0x000a, 0x1459: 0x000a, 0x145a: 0x000a, 0x145b: 0x000a, 0x145c: 0x000a, 0x145d: 0x000a, + 0x145e: 0x000a, 0x145f: 0x0009, 0x1460: 0x000b, 0x1461: 0x000b, 0x1462: 0x000b, 0x1463: 0x000b, + 0x1464: 0x000b, 0x1465: 0x000b, 0x1466: 0x000e, 0x1467: 0x000e, 0x1468: 0x000e, 0x1469: 0x000e, + 0x146a: 0x000b, 0x146b: 0x000b, 0x146c: 0x000b, 0x146d: 0x000b, 0x146e: 0x000b, 0x146f: 0x000b, + 0x1470: 0x0002, 0x1474: 0x0002, 0x1475: 0x0002, + 0x1476: 0x0002, 0x1477: 0x0002, 0x1478: 0x0002, 0x1479: 0x0002, 0x147a: 0x0003, 0x147b: 0x0003, + 0x147c: 0x000a, 0x147d: 0x009a, 0x147e: 0x008a, + // Block 0x52, offset 0x1480 + 0x1480: 0x0002, 0x1481: 0x0002, 0x1482: 0x0002, 0x1483: 0x0002, 0x1484: 0x0002, 0x1485: 0x0002, + 0x1486: 0x0002, 0x1487: 0x0002, 0x1488: 0x0002, 0x1489: 0x0002, 0x148a: 0x0003, 0x148b: 0x0003, + 0x148c: 0x000a, 0x148d: 0x009a, 0x148e: 0x008a, + 0x14a0: 0x0004, 0x14a1: 0x0004, 0x14a2: 0x0004, 0x14a3: 0x0004, + 0x14a4: 0x0004, 0x14a5: 0x0004, 0x14a6: 0x0004, 0x14a7: 0x0004, 0x14a8: 0x0004, 0x14a9: 0x0004, + 0x14aa: 0x0004, 0x14ab: 0x0004, 0x14ac: 0x0004, 0x14ad: 0x0004, 0x14ae: 0x0004, 0x14af: 0x0004, + 0x14b0: 0x0004, 0x14b1: 0x0004, 0x14b2: 0x0004, 0x14b3: 0x0004, 0x14b4: 0x0004, 0x14b5: 0x0004, + 0x14b6: 0x0004, 0x14b7: 0x0004, 0x14b8: 0x0004, 0x14b9: 0x0004, 0x14ba: 0x0004, 0x14bb: 0x0004, + 0x14bc: 0x0004, 0x14bd: 0x0004, 0x14be: 0x0004, 0x14bf: 0x0004, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0004, 0x14c1: 0x0004, 0x14c2: 0x0004, 0x14c3: 0x0004, 0x14c4: 0x0004, 0x14c5: 0x0004, + 0x14c6: 0x0004, 0x14c7: 0x0004, 0x14c8: 0x0004, 0x14c9: 0x0004, 0x14ca: 0x0004, 0x14cb: 0x0004, + 0x14cc: 0x0004, 0x14cd: 0x0004, 0x14ce: 0x0004, 0x14cf: 0x0004, 0x14d0: 0x000c, 0x14d1: 0x000c, + 0x14d2: 0x000c, 0x14d3: 0x000c, 0x14d4: 0x000c, 0x14d5: 0x000c, 0x14d6: 0x000c, 0x14d7: 0x000c, + 0x14d8: 0x000c, 0x14d9: 0x000c, 0x14da: 0x000c, 0x14db: 0x000c, 0x14dc: 0x000c, 0x14dd: 0x000c, + 0x14de: 0x000c, 0x14df: 0x000c, 0x14e0: 0x000c, 0x14e1: 0x000c, 0x14e2: 0x000c, 0x14e3: 0x000c, + 0x14e4: 0x000c, 0x14e5: 0x000c, 0x14e6: 0x000c, 0x14e7: 0x000c, 0x14e8: 0x000c, 0x14e9: 0x000c, + 0x14ea: 0x000c, 0x14eb: 0x000c, 0x14ec: 0x000c, 0x14ed: 0x000c, 0x14ee: 0x000c, 0x14ef: 0x000c, + 0x14f0: 0x000c, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, 0x1505: 0x000a, + 0x1506: 0x000a, 0x1508: 0x000a, 0x1509: 0x000a, + 0x1514: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, 0x1520: 0x000a, 0x1521: 0x000a, 0x1522: 0x000a, 0x1523: 0x000a, + 0x1525: 0x000a, 0x1527: 0x000a, 0x1529: 0x000a, + 0x152e: 0x0004, + 0x153a: 0x000a, 0x153b: 0x000a, + // Block 0x55, offset 0x1540 + 0x1540: 0x000a, 0x1541: 0x000a, 0x1542: 0x000a, 0x1543: 0x000a, 0x1544: 0x000a, + 0x154a: 0x000a, 0x154b: 0x000a, + 0x154c: 0x000a, 0x154d: 0x000a, 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x000a, 0x15d3: 0x000a, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x000a, 0x1609: 0x000a, 0x160a: 0x000a, 0x160b: 0x000a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x0003, 0x1613: 0x0004, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x000a, + 0x162a: 0x000a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + 0x1636: 0x000a, 0x1637: 0x000a, 0x1638: 0x000a, 0x1639: 0x000a, 0x163a: 0x000a, 0x163b: 0x000a, + 0x163c: 0x000a, 0x163d: 0x000a, 0x163e: 0x000a, 0x163f: 0x000a, + // Block 0x59, offset 0x1640 + 0x1640: 0x000a, 0x1641: 0x000a, 0x1642: 0x000a, 0x1643: 0x000a, 0x1644: 0x000a, 0x1645: 0x000a, + 0x1646: 0x000a, 0x1647: 0x000a, 0x1648: 0x003a, 0x1649: 0x002a, 0x164a: 0x003a, 0x164b: 0x002a, + 0x164c: 0x000a, 0x164d: 0x000a, 0x164e: 0x000a, 0x164f: 0x000a, 0x1650: 0x000a, 0x1651: 0x000a, + 0x1652: 0x000a, 0x1653: 0x000a, 0x1654: 0x000a, 0x1655: 0x000a, 0x1656: 0x000a, 0x1657: 0x000a, + 0x1658: 0x000a, 0x1659: 0x000a, 0x165a: 0x000a, 0x165b: 0x000a, 0x165c: 0x000a, 0x165d: 0x000a, + 0x165e: 0x000a, 0x165f: 0x000a, 0x1660: 0x000a, 0x1661: 0x000a, 0x1662: 0x000a, 0x1663: 0x000a, + 0x1664: 0x000a, 0x1665: 0x000a, 0x1666: 0x000a, 0x1667: 0x000a, 0x1668: 0x000a, 0x1669: 0x009a, + 0x166a: 0x008a, 0x166b: 0x000a, 0x166c: 0x000a, 0x166d: 0x000a, 0x166e: 0x000a, 0x166f: 0x000a, + 0x1670: 0x000a, 0x1671: 0x000a, 0x1672: 0x000a, 0x1673: 0x000a, 0x1674: 0x000a, 0x1675: 0x000a, + // Block 0x5a, offset 0x1680 + 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, 0x16ff: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1997: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a, + 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x009a, 0x1ad6: 0x008a, 0x1ad7: 0x00ba, + 0x1ad8: 0x00aa, 0x1ad9: 0x009a, 0x1ada: 0x008a, 0x1adb: 0x007a, 0x1adc: 0x006a, 0x1add: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, 0x206c: 0x000c, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + 0x20ff: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, 0x21bd: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x232a: 0x000a, 0x232b: 0x000a, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000a, 0x2441: 0x000a, 0x2442: 0x000a, 0x2443: 0x000a, 0x2444: 0x000a, 0x2445: 0x000a, + 0x2446: 0x000a, 0x2447: 0x000a, 0x2448: 0x000a, 0x2449: 0x000a, 0x244a: 0x000a, 0x244b: 0x000a, + 0x244c: 0x000a, 0x244d: 0x000a, 0x244e: 0x000a, 0x244f: 0x000a, 0x2450: 0x000d, 0x2451: 0x000d, + 0x2452: 0x000d, 0x2453: 0x000d, 0x2454: 0x000d, 0x2455: 0x000d, 0x2456: 0x000d, 0x2457: 0x000d, + 0x2458: 0x000d, 0x2459: 0x000d, 0x245a: 0x000d, 0x245b: 0x000d, 0x245c: 0x000d, 0x245d: 0x000d, + 0x245e: 0x000d, 0x245f: 0x000d, 0x2460: 0x000d, 0x2461: 0x000d, 0x2462: 0x000d, 0x2463: 0x000d, + 0x2464: 0x000d, 0x2465: 0x000d, 0x2466: 0x000d, 0x2467: 0x000d, 0x2468: 0x000d, 0x2469: 0x000d, + 0x246a: 0x000d, 0x246b: 0x000d, 0x246c: 0x000d, 0x246d: 0x000d, 0x246e: 0x000d, 0x246f: 0x000d, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000d, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000d, 0x2481: 0x000d, 0x2482: 0x000d, 0x2483: 0x000d, 0x2484: 0x000d, 0x2485: 0x000d, + 0x2486: 0x000d, 0x2487: 0x000d, 0x2488: 0x000d, 0x2489: 0x000d, 0x248a: 0x000d, 0x248b: 0x000d, + 0x248c: 0x000d, 0x248d: 0x000d, 0x248e: 0x000d, 0x248f: 0x000a, 0x2490: 0x000b, 0x2491: 0x000b, + 0x2492: 0x000b, 0x2493: 0x000b, 0x2494: 0x000b, 0x2495: 0x000b, 0x2496: 0x000b, 0x2497: 0x000b, + 0x2498: 0x000b, 0x2499: 0x000b, 0x249a: 0x000b, 0x249b: 0x000b, 0x249c: 0x000b, 0x249d: 0x000b, + 0x249e: 0x000b, 0x249f: 0x000b, 0x24a0: 0x000b, 0x24a1: 0x000b, 0x24a2: 0x000b, 0x24a3: 0x000b, + 0x24a4: 0x000b, 0x24a5: 0x000b, 0x24a6: 0x000b, 0x24a7: 0x000b, 0x24a8: 0x000b, 0x24a9: 0x000b, + 0x24aa: 0x000b, 0x24ab: 0x000b, 0x24ac: 0x000b, 0x24ad: 0x000b, 0x24ae: 0x000b, 0x24af: 0x000b, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000c, 0x24c1: 0x000c, 0x24c2: 0x000c, 0x24c3: 0x000c, 0x24c4: 0x000c, 0x24c5: 0x000c, + 0x24c6: 0x000c, 0x24c7: 0x000c, 0x24c8: 0x000c, 0x24c9: 0x000c, 0x24ca: 0x000c, 0x24cb: 0x000c, + 0x24cc: 0x000c, 0x24cd: 0x000c, 0x24ce: 0x000c, 0x24cf: 0x000c, 0x24d0: 0x000a, 0x24d1: 0x000a, + 0x24d2: 0x000a, 0x24d3: 0x000a, 0x24d4: 0x000a, 0x24d5: 0x000a, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x000a, + 0x24e0: 0x000c, 0x24e1: 0x000c, 0x24e2: 0x000c, 0x24e3: 0x000c, + 0x24e4: 0x000c, 0x24e5: 0x000c, 0x24e6: 0x000c, 0x24e7: 0x000c, 0x24e8: 0x000c, 0x24e9: 0x000c, + 0x24ea: 0x000c, 0x24eb: 0x000c, 0x24ec: 0x000c, 0x24ed: 0x000c, 0x24ee: 0x000c, 0x24ef: 0x000c, + 0x24f0: 0x000a, 0x24f1: 0x000a, 0x24f2: 0x000a, 0x24f3: 0x000a, 0x24f4: 0x000a, 0x24f5: 0x000a, + 0x24f6: 0x000a, 0x24f7: 0x000a, 0x24f8: 0x000a, 0x24f9: 0x000a, 0x24fa: 0x000a, 0x24fb: 0x000a, + 0x24fc: 0x000a, 0x24fd: 0x000a, 0x24fe: 0x000a, 0x24ff: 0x000a, + // Block 0x94, offset 0x2500 + 0x2500: 0x000a, 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x000a, 0x2504: 0x000a, 0x2505: 0x000a, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x000a, 0x2509: 0x000a, 0x250a: 0x000a, 0x250b: 0x000a, + 0x250c: 0x000a, 0x250d: 0x000a, 0x250e: 0x000a, 0x250f: 0x000a, 0x2510: 0x0006, 0x2511: 0x000a, + 0x2512: 0x0006, 0x2514: 0x000a, 0x2515: 0x0006, 0x2516: 0x000a, 0x2517: 0x000a, + 0x2518: 0x000a, 0x2519: 0x009a, 0x251a: 0x008a, 0x251b: 0x007a, 0x251c: 0x006a, 0x251d: 0x009a, + 0x251e: 0x008a, 0x251f: 0x0004, 0x2520: 0x000a, 0x2521: 0x000a, 0x2522: 0x0003, 0x2523: 0x0003, + 0x2524: 0x000a, 0x2525: 0x000a, 0x2526: 0x000a, 0x2528: 0x000a, 0x2529: 0x0004, + 0x252a: 0x0004, 0x252b: 0x000a, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000d, + // Block 0x95, offset 0x2540 + 0x2540: 0x000d, 0x2541: 0x000d, 0x2542: 0x000d, 0x2543: 0x000d, 0x2544: 0x000d, 0x2545: 0x000d, + 0x2546: 0x000d, 0x2547: 0x000d, 0x2548: 0x000d, 0x2549: 0x000d, 0x254a: 0x000d, 0x254b: 0x000d, + 0x254c: 0x000d, 0x254d: 0x000d, 0x254e: 0x000d, 0x254f: 0x000d, 0x2550: 0x000d, 0x2551: 0x000d, + 0x2552: 0x000d, 0x2553: 0x000d, 0x2554: 0x000d, 0x2555: 0x000d, 0x2556: 0x000d, 0x2557: 0x000d, + 0x2558: 0x000d, 0x2559: 0x000d, 0x255a: 0x000d, 0x255b: 0x000d, 0x255c: 0x000d, 0x255d: 0x000d, + 0x255e: 0x000d, 0x255f: 0x000d, 0x2560: 0x000d, 0x2561: 0x000d, 0x2562: 0x000d, 0x2563: 0x000d, + 0x2564: 0x000d, 0x2565: 0x000d, 0x2566: 0x000d, 0x2567: 0x000d, 0x2568: 0x000d, 0x2569: 0x000d, + 0x256a: 0x000d, 0x256b: 0x000d, 0x256c: 0x000d, 0x256d: 0x000d, 0x256e: 0x000d, 0x256f: 0x000d, + 0x2570: 0x000d, 0x2571: 0x000d, 0x2572: 0x000d, 0x2573: 0x000d, 0x2574: 0x000d, 0x2575: 0x000d, + 0x2576: 0x000d, 0x2577: 0x000d, 0x2578: 0x000d, 0x2579: 0x000d, 0x257a: 0x000d, 0x257b: 0x000d, + 0x257c: 0x000d, 0x257d: 0x000d, 0x257e: 0x000d, 0x257f: 0x000b, + // Block 0x96, offset 0x2580 + 0x2581: 0x000a, 0x2582: 0x000a, 0x2583: 0x0004, 0x2584: 0x0004, 0x2585: 0x0004, + 0x2586: 0x000a, 0x2587: 0x000a, 0x2588: 0x003a, 0x2589: 0x002a, 0x258a: 0x000a, 0x258b: 0x0003, + 0x258c: 0x0006, 0x258d: 0x0003, 0x258e: 0x0006, 0x258f: 0x0006, 0x2590: 0x0002, 0x2591: 0x0002, + 0x2592: 0x0002, 0x2593: 0x0002, 0x2594: 0x0002, 0x2595: 0x0002, 0x2596: 0x0002, 0x2597: 0x0002, + 0x2598: 0x0002, 0x2599: 0x0002, 0x259a: 0x0006, 0x259b: 0x000a, 0x259c: 0x000a, 0x259d: 0x000a, + 0x259e: 0x000a, 0x259f: 0x000a, 0x25a0: 0x000a, + 0x25bb: 0x005a, + 0x25bc: 0x000a, 0x25bd: 0x004a, 0x25be: 0x000a, 0x25bf: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x000a, + 0x25db: 0x005a, 0x25dc: 0x000a, 0x25dd: 0x004a, + 0x25de: 0x000a, 0x25df: 0x00fa, 0x25e0: 0x00ea, 0x25e1: 0x000a, 0x25e2: 0x003a, 0x25e3: 0x002a, + 0x25e4: 0x000a, 0x25e5: 0x000a, + // Block 0x98, offset 0x2600 + 0x2620: 0x0004, 0x2621: 0x0004, 0x2622: 0x000a, 0x2623: 0x000a, + 0x2624: 0x000a, 0x2625: 0x0004, 0x2626: 0x0004, 0x2628: 0x000a, 0x2629: 0x000a, + 0x262a: 0x000a, 0x262b: 0x000a, 0x262c: 0x000a, 0x262d: 0x000a, 0x262e: 0x000a, + 0x2630: 0x000b, 0x2631: 0x000b, 0x2632: 0x000b, 0x2633: 0x000b, 0x2634: 0x000b, 0x2635: 0x000b, + 0x2636: 0x000b, 0x2637: 0x000b, 0x2638: 0x000b, 0x2639: 0x000a, 0x263a: 0x000a, 0x263b: 0x000a, + 0x263c: 0x000a, 0x263d: 0x000a, 0x263e: 0x000b, 0x263f: 0x000b, + // Block 0x99, offset 0x2640 + 0x2641: 0x000a, + // Block 0x9a, offset 0x2680 + 0x2680: 0x000a, 0x2681: 0x000a, 0x2682: 0x000a, 0x2683: 0x000a, 0x2684: 0x000a, 0x2685: 0x000a, + 0x2686: 0x000a, 0x2687: 0x000a, 0x2688: 0x000a, 0x2689: 0x000a, 0x268a: 0x000a, 0x268b: 0x000a, + 0x268c: 0x000a, 0x2690: 0x000a, 0x2691: 0x000a, + 0x2692: 0x000a, 0x2693: 0x000a, 0x2694: 0x000a, 0x2695: 0x000a, 0x2696: 0x000a, 0x2697: 0x000a, + 0x2698: 0x000a, 0x2699: 0x000a, 0x269a: 0x000a, 0x269b: 0x000a, 0x269c: 0x000a, + 0x26a0: 0x000a, + // Block 0x9b, offset 0x26c0 + 0x26fd: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2720: 0x000c, 0x2721: 0x0002, 0x2722: 0x0002, 0x2723: 0x0002, + 0x2724: 0x0002, 0x2725: 0x0002, 0x2726: 0x0002, 0x2727: 0x0002, 0x2728: 0x0002, 0x2729: 0x0002, + 0x272a: 0x0002, 0x272b: 0x0002, 0x272c: 0x0002, 0x272d: 0x0002, 0x272e: 0x0002, 0x272f: 0x0002, + 0x2730: 0x0002, 0x2731: 0x0002, 0x2732: 0x0002, 0x2733: 0x0002, 0x2734: 0x0002, 0x2735: 0x0002, + 0x2736: 0x0002, 0x2737: 0x0002, 0x2738: 0x0002, 0x2739: 0x0002, 0x273a: 0x0002, 0x273b: 0x0002, + // Block 0x9d, offset 0x2740 + 0x2776: 0x000c, 0x2777: 0x000c, 0x2778: 0x000c, 0x2779: 0x000c, 0x277a: 0x000c, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x000a, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x000c, 0x2802: 0x000c, 0x2803: 0x000c, 0x2804: 0x0001, 0x2805: 0x000c, + 0x2806: 0x000c, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x000c, 0x280d: 0x000c, 0x280e: 0x000c, 0x280f: 0x000c, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x000c, 0x2839: 0x000c, 0x283a: 0x000c, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x000c, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x0001, 0x287a: 0x0001, 0x287b: 0x0001, + 0x287c: 0x0001, 0x287d: 0x0001, 0x287e: 0x0001, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0001, 0x28a1: 0x0001, 0x28a2: 0x0001, 0x28a3: 0x0001, + 0x28a4: 0x0001, 0x28a5: 0x0001, 0x28a6: 0x0001, 0x28a7: 0x0001, 0x28a8: 0x0001, 0x28a9: 0x0001, + 0x28aa: 0x0001, 0x28ab: 0x0001, 0x28ac: 0x0001, 0x28ad: 0x0001, 0x28ae: 0x0001, 0x28af: 0x0001, + 0x28b0: 0x0001, 0x28b1: 0x0001, 0x28b2: 0x0001, 0x28b3: 0x0001, 0x28b4: 0x0001, 0x28b5: 0x0001, + 0x28b6: 0x0001, 0x28b7: 0x0001, 0x28b8: 0x0001, 0x28b9: 0x000a, 0x28ba: 0x000a, 0x28bb: 0x000a, + 0x28bc: 0x000a, 0x28bd: 0x000a, 0x28be: 0x000a, 0x28bf: 0x000a, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000d, 0x28c1: 0x000d, 0x28c2: 0x000d, 0x28c3: 0x000d, 0x28c4: 0x000d, 0x28c5: 0x000d, + 0x28c6: 0x000d, 0x28c7: 0x000d, 0x28c8: 0x000d, 0x28c9: 0x000d, 0x28ca: 0x000d, 0x28cb: 0x000d, + 0x28cc: 0x000d, 0x28cd: 0x000d, 0x28ce: 0x000d, 0x28cf: 0x000d, 0x28d0: 0x000d, 0x28d1: 0x000d, + 0x28d2: 0x000d, 0x28d3: 0x000d, 0x28d4: 0x000d, 0x28d5: 0x000d, 0x28d6: 0x000d, 0x28d7: 0x000d, + 0x28d8: 0x000d, 0x28d9: 0x000d, 0x28da: 0x000d, 0x28db: 0x000d, 0x28dc: 0x000d, 0x28dd: 0x000d, + 0x28de: 0x000d, 0x28df: 0x000d, 0x28e0: 0x000d, 0x28e1: 0x000d, 0x28e2: 0x000d, 0x28e3: 0x000d, + 0x28e4: 0x000c, 0x28e5: 0x000c, 0x28e6: 0x000c, 0x28e7: 0x000c, 0x28e8: 0x0001, 0x28e9: 0x0001, + 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001, + 0x28f0: 0x0005, 0x28f1: 0x0005, 0x28f2: 0x0005, 0x28f3: 0x0005, 0x28f4: 0x0005, 0x28f5: 0x0005, + 0x28f6: 0x0005, 0x28f7: 0x0005, 0x28f8: 0x0005, 0x28f9: 0x0005, 0x28fa: 0x0001, 0x28fb: 0x0001, + 0x28fc: 0x0001, 0x28fd: 0x0001, 0x28fe: 0x0001, 0x28ff: 0x0001, + // Block 0xa4, offset 0x2900 + 0x2900: 0x0001, 0x2901: 0x0001, 0x2902: 0x0001, 0x2903: 0x0001, 0x2904: 0x0001, 0x2905: 0x0001, + 0x2906: 0x0001, 0x2907: 0x0001, 0x2908: 0x0001, 0x2909: 0x0001, 0x290a: 0x0001, 0x290b: 0x0001, + 0x290c: 0x0001, 0x290d: 0x0001, 0x290e: 0x0001, 0x290f: 0x0001, 0x2910: 0x0001, 0x2911: 0x0001, + 0x2912: 0x0001, 0x2913: 0x0001, 0x2914: 0x0001, 0x2915: 0x0001, 0x2916: 0x0001, 0x2917: 0x0001, + 0x2918: 0x0001, 0x2919: 0x0001, 0x291a: 0x0001, 0x291b: 0x0001, 0x291c: 0x0001, 0x291d: 0x0001, + 0x291e: 0x0001, 0x291f: 0x0001, 0x2920: 0x0005, 0x2921: 0x0005, 0x2922: 0x0005, 0x2923: 0x0005, + 0x2924: 0x0005, 0x2925: 0x0005, 0x2926: 0x0005, 0x2927: 0x0005, 0x2928: 0x0005, 0x2929: 0x0005, + 0x292a: 0x0005, 0x292b: 0x0005, 0x292c: 0x0005, 0x292d: 0x0005, 0x292e: 0x0005, 0x292f: 0x0005, + 0x2930: 0x0005, 0x2931: 0x0005, 0x2932: 0x0005, 0x2933: 0x0005, 0x2934: 0x0005, 0x2935: 0x0005, + 0x2936: 0x0005, 0x2937: 0x0005, 0x2938: 0x0005, 0x2939: 0x0005, 0x293a: 0x0005, 0x293b: 0x0005, + 0x293c: 0x0005, 0x293d: 0x0005, 0x293e: 0x0005, 0x293f: 0x0001, + // Block 0xa5, offset 0x2940 + 0x2940: 0x0001, 0x2941: 0x0001, 0x2942: 0x0001, 0x2943: 0x0001, 0x2944: 0x0001, 0x2945: 0x0001, + 0x2946: 0x0001, 0x2947: 0x0001, 0x2948: 0x0001, 0x2949: 0x0001, 0x294a: 0x0001, 0x294b: 0x0001, + 0x294c: 0x0001, 0x294d: 0x0001, 0x294e: 0x0001, 0x294f: 0x0001, 0x2950: 0x0001, 0x2951: 0x0001, + 0x2952: 0x0001, 0x2953: 0x0001, 0x2954: 0x0001, 0x2955: 0x0001, 0x2956: 0x0001, 0x2957: 0x0001, + 0x2958: 0x0001, 0x2959: 0x0001, 0x295a: 0x0001, 0x295b: 0x0001, 0x295c: 0x0001, 0x295d: 0x0001, + 0x295e: 0x0001, 0x295f: 0x0001, 0x2960: 0x0001, 0x2961: 0x0001, 0x2962: 0x0001, 0x2963: 0x0001, + 0x2964: 0x0001, 0x2965: 0x0001, 0x2966: 0x0001, 0x2967: 0x0001, 0x2968: 0x0001, 0x2969: 0x0001, + 0x296a: 0x0001, 0x296b: 0x000c, 0x296c: 0x000c, 0x296d: 0x0001, 0x296e: 0x0001, 0x296f: 0x0001, + 0x2970: 0x0001, 0x2971: 0x0001, 0x2972: 0x0001, 0x2973: 0x0001, 0x2974: 0x0001, 0x2975: 0x0001, + 0x2976: 0x0001, 0x2977: 0x0001, 0x2978: 0x0001, 0x2979: 0x0001, 0x297a: 0x0001, 0x297b: 0x0001, + 0x297c: 0x0001, 0x297d: 0x0001, 0x297e: 0x0001, 0x297f: 0x0001, + // Block 0xa6, offset 0x2980 + 0x2980: 0x0001, 0x2981: 0x0001, 0x2982: 0x0001, 0x2983: 0x0001, 0x2984: 0x0001, 0x2985: 0x0001, + 0x2986: 0x0001, 0x2987: 0x0001, 0x2988: 0x0001, 0x2989: 0x0001, 0x298a: 0x0001, 0x298b: 0x0001, + 0x298c: 0x0001, 0x298d: 0x0001, 0x298e: 0x0001, 0x298f: 0x0001, 0x2990: 0x0001, 0x2991: 0x0001, + 0x2992: 0x0001, 0x2993: 0x0001, 0x2994: 0x0001, 0x2995: 0x0001, 0x2996: 0x0001, 0x2997: 0x0001, + 0x2998: 0x0001, 0x2999: 0x0001, 0x299a: 0x0001, 0x299b: 0x0001, 0x299c: 0x0001, 0x299d: 0x0001, + 0x299e: 0x0001, 0x299f: 0x0001, 0x29a0: 0x0001, 0x29a1: 0x0001, 0x29a2: 0x0001, 0x29a3: 0x0001, + 0x29a4: 0x0001, 0x29a5: 0x0001, 0x29a6: 0x0001, 0x29a7: 0x0001, 0x29a8: 0x0001, 0x29a9: 0x0001, + 0x29aa: 0x0001, 0x29ab: 0x0001, 0x29ac: 0x0001, 0x29ad: 0x0001, 0x29ae: 0x0001, 0x29af: 0x0001, + 0x29b0: 0x0001, 0x29b1: 0x0001, 0x29b2: 0x0001, 0x29b3: 0x0001, 0x29b4: 0x0001, 0x29b5: 0x0001, + 0x29b6: 0x0001, 0x29b7: 0x0001, 0x29b8: 0x0001, 0x29b9: 0x0001, 0x29ba: 0x0001, 0x29bb: 0x0001, + 0x29bc: 0x0001, 0x29bd: 0x000c, 0x29be: 0x000c, 0x29bf: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x0001, 0x29c1: 0x0001, 0x29c2: 0x0001, 0x29c3: 0x0001, 0x29c4: 0x0001, 0x29c5: 0x0001, + 0x29c6: 0x0001, 0x29c7: 0x0001, 0x29c8: 0x0001, 0x29c9: 0x0001, 0x29ca: 0x0001, 0x29cb: 0x0001, + 0x29cc: 0x0001, 0x29cd: 0x0001, 0x29ce: 0x0001, 0x29cf: 0x0001, 0x29d0: 0x0001, 0x29d1: 0x0001, + 0x29d2: 0x0001, 0x29d3: 0x0001, 0x29d4: 0x0001, 0x29d5: 0x0001, 0x29d6: 0x0001, 0x29d7: 0x0001, + 0x29d8: 0x0001, 0x29d9: 0x0001, 0x29da: 0x0001, 0x29db: 0x0001, 0x29dc: 0x0001, 0x29dd: 0x0001, + 0x29de: 0x0001, 0x29df: 0x0001, 0x29e0: 0x0001, 0x29e1: 0x0001, 0x29e2: 0x0001, 0x29e3: 0x0001, + 0x29e4: 0x0001, 0x29e5: 0x0001, 0x29e6: 0x0001, 0x29e7: 0x0001, 0x29e8: 0x0001, 0x29e9: 0x0001, + 0x29ea: 0x0001, 0x29eb: 0x0001, 0x29ec: 0x0001, 0x29ed: 0x0001, 0x29ee: 0x0001, 0x29ef: 0x0001, + 0x29f0: 0x000d, 0x29f1: 0x000d, 0x29f2: 0x000d, 0x29f3: 0x000d, 0x29f4: 0x000d, 0x29f5: 0x000d, + 0x29f6: 0x000d, 0x29f7: 0x000d, 0x29f8: 0x000d, 0x29f9: 0x000d, 0x29fa: 0x000d, 0x29fb: 0x000d, + 0x29fc: 0x000d, 0x29fd: 0x000d, 0x29fe: 0x000d, 0x29ff: 0x000d, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000d, 0x2a01: 0x000d, 0x2a02: 0x000d, 0x2a03: 0x000d, 0x2a04: 0x000d, 0x2a05: 0x000d, + 0x2a06: 0x000c, 0x2a07: 0x000c, 0x2a08: 0x000c, 0x2a09: 0x000c, 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, 0x2a0d: 0x000c, 0x2a0e: 0x000c, 0x2a0f: 0x000c, 0x2a10: 0x000c, 0x2a11: 0x000d, + 0x2a12: 0x000d, 0x2a13: 0x000d, 0x2a14: 0x000d, 0x2a15: 0x000d, 0x2a16: 0x000d, 0x2a17: 0x000d, + 0x2a18: 0x000d, 0x2a19: 0x000d, 0x2a1a: 0x0001, 0x2a1b: 0x0001, 0x2a1c: 0x0001, 0x2a1d: 0x0001, + 0x2a1e: 0x0001, 0x2a1f: 0x0001, 0x2a20: 0x0001, 0x2a21: 0x0001, 0x2a22: 0x0001, 0x2a23: 0x0001, + 0x2a24: 0x0001, 0x2a25: 0x0001, 0x2a26: 0x0001, 0x2a27: 0x0001, 0x2a28: 0x0001, 0x2a29: 0x0001, + 0x2a2a: 0x0001, 0x2a2b: 0x0001, 0x2a2c: 0x0001, 0x2a2d: 0x0001, 0x2a2e: 0x0001, 0x2a2f: 0x0001, + 0x2a30: 0x0001, 0x2a31: 0x0001, 0x2a32: 0x0001, 0x2a33: 0x0001, 0x2a34: 0x0001, 0x2a35: 0x0001, + 0x2a36: 0x0001, 0x2a37: 0x0001, 0x2a38: 0x0001, 0x2a39: 0x0001, 0x2a3a: 0x0001, 0x2a3b: 0x0001, + 0x2a3c: 0x0001, 0x2a3d: 0x0001, 0x2a3e: 0x0001, 0x2a3f: 0x0001, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x0001, 0x2a41: 0x0001, 0x2a42: 0x000c, 0x2a43: 0x000c, 0x2a44: 0x000c, 0x2a45: 0x000c, + 0x2a46: 0x0001, 0x2a47: 0x0001, 0x2a48: 0x0001, 0x2a49: 0x0001, 0x2a4a: 0x0001, 0x2a4b: 0x0001, + 0x2a4c: 0x0001, 0x2a4d: 0x0001, 0x2a4e: 0x0001, 0x2a4f: 0x0001, 0x2a50: 0x0001, 0x2a51: 0x0001, + 0x2a52: 0x0001, 0x2a53: 0x0001, 0x2a54: 0x0001, 0x2a55: 0x0001, 0x2a56: 0x0001, 0x2a57: 0x0001, + 0x2a58: 0x0001, 0x2a59: 0x0001, 0x2a5a: 0x0001, 0x2a5b: 0x0001, 0x2a5c: 0x0001, 0x2a5d: 0x0001, + 0x2a5e: 0x0001, 0x2a5f: 0x0001, 0x2a60: 0x0001, 0x2a61: 0x0001, 0x2a62: 0x0001, 0x2a63: 0x0001, + 0x2a64: 0x0001, 0x2a65: 0x0001, 0x2a66: 0x0001, 0x2a67: 0x0001, 0x2a68: 0x0001, 0x2a69: 0x0001, + 0x2a6a: 0x0001, 0x2a6b: 0x0001, 0x2a6c: 0x0001, 0x2a6d: 0x0001, 0x2a6e: 0x0001, 0x2a6f: 0x0001, + 0x2a70: 0x0001, 0x2a71: 0x0001, 0x2a72: 0x0001, 0x2a73: 0x0001, 0x2a74: 0x0001, 0x2a75: 0x0001, + 0x2a76: 0x0001, 0x2a77: 0x0001, 0x2a78: 0x0001, 0x2a79: 0x0001, 0x2a7a: 0x0001, 0x2a7b: 0x0001, + 0x2a7c: 0x0001, 0x2a7d: 0x0001, 0x2a7e: 0x0001, 0x2a7f: 0x0001, + // Block 0xaa, offset 0x2a80 + 0x2a81: 0x000c, + 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c, + 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, 0x2abf: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, 0x2ac2: 0x000c, 0x2ac3: 0x000c, 0x2ac4: 0x000c, 0x2ac5: 0x000c, + 0x2ac6: 0x000c, + 0x2ad2: 0x000a, 0x2ad3: 0x000a, 0x2ad4: 0x000a, 0x2ad5: 0x000a, 0x2ad6: 0x000a, 0x2ad7: 0x000a, + 0x2ad8: 0x000a, 0x2ad9: 0x000a, 0x2ada: 0x000a, 0x2adb: 0x000a, 0x2adc: 0x000a, 0x2add: 0x000a, + 0x2ade: 0x000a, 0x2adf: 0x000a, 0x2ae0: 0x000a, 0x2ae1: 0x000a, 0x2ae2: 0x000a, 0x2ae3: 0x000a, + 0x2ae4: 0x000a, 0x2ae5: 0x000a, + 0x2af0: 0x000c, 0x2af3: 0x000c, 0x2af4: 0x000c, + 0x2aff: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b33: 0x000c, 0x2b34: 0x000c, 0x2b35: 0x000c, + 0x2b36: 0x000c, 0x2b39: 0x000c, 0x2b3a: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, 0x2b41: 0x000c, 0x2b42: 0x000c, + 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6d: 0x000c, 0x2b6e: 0x000c, 0x2b6f: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb3: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x000c, 0x2bc1: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c, + 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c09: 0x000c, 0x2c0a: 0x000c, 0x2c0b: 0x000c, + 0x2c0c: 0x000c, 0x2c0f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c6f: 0x000c, + 0x2c70: 0x000c, 0x2c71: 0x000c, 0x2c74: 0x000c, + 0x2c76: 0x000c, 0x2c77: 0x000c, + 0x2c7e: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c9f: 0x000c, 0x2ca3: 0x000c, + 0x2ca4: 0x000c, 0x2ca5: 0x000c, 0x2ca6: 0x000c, 0x2ca7: 0x000c, 0x2ca8: 0x000c, 0x2ca9: 0x000c, + 0x2caa: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2ce6: 0x000c, 0x2ce7: 0x000c, 0x2ce8: 0x000c, 0x2ce9: 0x000c, + 0x2cea: 0x000c, 0x2ceb: 0x000c, 0x2cec: 0x000c, + 0x2cf0: 0x000c, 0x2cf1: 0x000c, 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, 0x2d3b: 0x000c, + 0x2d3c: 0x000c, 0x2d3d: 0x000c, 0x2d3e: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d42: 0x000c, 0x2d43: 0x000c, 0x2d44: 0x000c, + 0x2d46: 0x000c, + 0x2d5e: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db6: 0x000c, 0x2db7: 0x000c, 0x2db8: 0x000c, 0x2dba: 0x000c, + 0x2dbf: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, 0x2e3f: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x000c, + 0x2e5c: 0x000c, 0x2e5d: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, + 0x2ebd: 0x000c, 0x2ebf: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ec0: 0x000c, + 0x2ee0: 0x000a, 0x2ee1: 0x000a, 0x2ee2: 0x000a, 0x2ee3: 0x000a, + 0x2ee4: 0x000a, 0x2ee5: 0x000a, 0x2ee6: 0x000a, 0x2ee7: 0x000a, 0x2ee8: 0x000a, 0x2ee9: 0x000a, + 0x2eea: 0x000a, 0x2eeb: 0x000a, 0x2eec: 0x000a, + // Block 0xbc, offset 0x2f00 + 0x2f2b: 0x000c, 0x2f2d: 0x000c, + 0x2f30: 0x000c, 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f37: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f5f: 0x000c, 0x2f62: 0x000c, 0x2f63: 0x000c, + 0x2f64: 0x000c, 0x2f65: 0x000c, 0x2f67: 0x000c, 0x2f68: 0x000c, 0x2f69: 0x000c, + 0x2f6a: 0x000c, 0x2f6b: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2faf: 0x000c, + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, 0x2fb5: 0x000c, + 0x2fb6: 0x000c, 0x2fb7: 0x000c, 0x2fb9: 0x000c, 0x2fba: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ffb: 0x000c, + 0x2ffc: 0x000c, 0x2ffe: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3003: 0x000c, + // Block 0xc1, offset 0x3040 + 0x3054: 0x000c, 0x3055: 0x000c, 0x3056: 0x000c, 0x3057: 0x000c, + 0x305a: 0x000c, 0x305b: 0x000c, + 0x3060: 0x000c, + // Block 0xc2, offset 0x3080 + 0x3081: 0x000c, 0x3082: 0x000c, 0x3083: 0x000c, 0x3084: 0x000c, 0x3085: 0x000c, + 0x3086: 0x000c, 0x3089: 0x000c, 0x308a: 0x000c, + 0x30b3: 0x000c, 0x30b4: 0x000c, 0x30b5: 0x000c, + 0x30b6: 0x000c, 0x30b7: 0x000c, 0x30b8: 0x000c, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c7: 0x000c, + 0x30d1: 0x000c, + 0x30d2: 0x000c, 0x30d3: 0x000c, 0x30d4: 0x000c, 0x30d5: 0x000c, 0x30d6: 0x000c, + 0x30d9: 0x000c, 0x30da: 0x000c, 0x30db: 0x000c, + // Block 0xc4, offset 0x3100 + 0x310a: 0x000c, 0x310b: 0x000c, + 0x310c: 0x000c, 0x310d: 0x000c, 0x310e: 0x000c, 0x310f: 0x000c, 0x3110: 0x000c, 0x3111: 0x000c, + 0x3112: 0x000c, 0x3113: 0x000c, 0x3114: 0x000c, 0x3115: 0x000c, 0x3116: 0x000c, + 0x3118: 0x000c, 0x3119: 0x000c, + // Block 0xc5, offset 0x3140 + 0x3170: 0x000c, 0x3171: 0x000c, 0x3172: 0x000c, 0x3173: 0x000c, 0x3174: 0x000c, 0x3175: 0x000c, + 0x3176: 0x000c, 0x3178: 0x000c, 0x3179: 0x000c, 0x317a: 0x000c, 0x317b: 0x000c, + 0x317c: 0x000c, 0x317d: 0x000c, + // Block 0xc6, offset 0x3180 + 0x3192: 0x000c, 0x3193: 0x000c, 0x3194: 0x000c, 0x3195: 0x000c, 0x3196: 0x000c, 0x3197: 0x000c, + 0x3198: 0x000c, 0x3199: 0x000c, 0x319a: 0x000c, 0x319b: 0x000c, 0x319c: 0x000c, 0x319d: 0x000c, + 0x319e: 0x000c, 0x319f: 0x000c, 0x31a0: 0x000c, 0x31a1: 0x000c, 0x31a2: 0x000c, 0x31a3: 0x000c, + 0x31a4: 0x000c, 0x31a5: 0x000c, 0x31a6: 0x000c, 0x31a7: 0x000c, + 0x31aa: 0x000c, 0x31ab: 0x000c, 0x31ac: 0x000c, 0x31ad: 0x000c, 0x31ae: 0x000c, 0x31af: 0x000c, + 0x31b0: 0x000c, 0x31b2: 0x000c, 0x31b3: 0x000c, 0x31b5: 0x000c, + 0x31b6: 0x000c, + // Block 0xc7, offset 0x31c0 + 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fa: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3207: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3250: 0x000c, 0x3251: 0x000c, + 0x3255: 0x000c, 0x3257: 0x000c, + // Block 0xca, offset 0x3280 + 0x32b3: 0x000c, 0x32b4: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, + 0x32f6: 0x000c, 0x32f7: 0x000c, 0x32f8: 0x000c, 0x32f9: 0x000c, 0x32fa: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3302: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3355: 0x000a, 0x3356: 0x000a, 0x3357: 0x000a, + 0x3358: 0x000a, 0x3359: 0x000a, 0x335a: 0x000a, 0x335b: 0x000a, 0x335c: 0x000a, 0x335d: 0x0004, + 0x335e: 0x0004, 0x335f: 0x0004, 0x3360: 0x0004, 0x3361: 0x000a, 0x3362: 0x000a, 0x3363: 0x000a, + 0x3364: 0x000a, 0x3365: 0x000a, 0x3366: 0x000a, 0x3367: 0x000a, 0x3368: 0x000a, 0x3369: 0x000a, + 0x336a: 0x000a, 0x336b: 0x000a, 0x336c: 0x000a, 0x336d: 0x000a, 0x336e: 0x000a, 0x336f: 0x000a, + 0x3370: 0x000a, 0x3371: 0x000a, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, + 0x3387: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33f0: 0x000c, 0x33f1: 0x000c, 0x33f2: 0x000c, 0x33f3: 0x000c, 0x33f4: 0x000c, + // Block 0xd0, offset 0x3400 + 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c, + 0x3436: 0x000c, + // Block 0xd1, offset 0x3440 + 0x344f: 0x000c, + // Block 0xd2, offset 0x3480 + 0x348f: 0x000c, 0x3490: 0x000c, 0x3491: 0x000c, + 0x3492: 0x000c, + // Block 0xd3, offset 0x34c0 + 0x34e2: 0x000a, + 0x34e4: 0x000c, + // Block 0xd4, offset 0x3500 + 0x351d: 0x000c, + 0x351e: 0x000c, 0x3520: 0x000b, 0x3521: 0x000b, 0x3522: 0x000b, 0x3523: 0x000b, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000c, 0x3541: 0x000c, 0x3542: 0x000c, 0x3543: 0x000c, 0x3544: 0x000c, 0x3545: 0x000c, + 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x000c, + 0x354c: 0x000c, 0x354d: 0x000c, 0x354e: 0x000c, 0x354f: 0x000c, 0x3550: 0x000c, 0x3551: 0x000c, + 0x3552: 0x000c, 0x3553: 0x000c, 0x3554: 0x000c, 0x3555: 0x000c, 0x3556: 0x000c, 0x3557: 0x000c, + 0x3558: 0x000c, 0x3559: 0x000c, 0x355a: 0x000c, 0x355b: 0x000c, 0x355c: 0x000c, 0x355d: 0x000c, + 0x355e: 0x000c, 0x355f: 0x000c, 0x3560: 0x000c, 0x3561: 0x000c, 0x3562: 0x000c, 0x3563: 0x000c, + 0x3564: 0x000c, 0x3565: 0x000c, 0x3566: 0x000c, 0x3567: 0x000c, 0x3568: 0x000c, 0x3569: 0x000c, + 0x356a: 0x000c, 0x356b: 0x000c, 0x356c: 0x000c, 0x356d: 0x000c, + 0x3570: 0x000c, 0x3571: 0x000c, 0x3572: 0x000c, 0x3573: 0x000c, 0x3574: 0x000c, 0x3575: 0x000c, + 0x3576: 0x000c, 0x3577: 0x000c, 0x3578: 0x000c, 0x3579: 0x000c, 0x357a: 0x000c, 0x357b: 0x000c, + 0x357c: 0x000c, 0x357d: 0x000c, 0x357e: 0x000c, 0x357f: 0x000c, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000c, 0x3581: 0x000c, 0x3582: 0x000c, 0x3583: 0x000c, 0x3584: 0x000c, 0x3585: 0x000c, + 0x3586: 0x000c, + // Block 0xd7, offset 0x35c0 + 0x35e7: 0x000c, 0x35e8: 0x000c, 0x35e9: 0x000c, + 0x35f3: 0x000b, 0x35f4: 0x000b, 0x35f5: 0x000b, + 0x35f6: 0x000b, 0x35f7: 0x000b, 0x35f8: 0x000b, 0x35f9: 0x000b, 0x35fa: 0x000b, 0x35fb: 0x000c, + 0x35fc: 0x000c, 0x35fd: 0x000c, 0x35fe: 0x000c, 0x35ff: 0x000c, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000c, 0x3601: 0x000c, 0x3602: 0x000c, 0x3605: 0x000c, + 0x3606: 0x000c, 0x3607: 0x000c, 0x3608: 0x000c, 0x3609: 0x000c, 0x360a: 0x000c, 0x360b: 0x000c, + 0x362a: 0x000c, 0x362b: 0x000c, 0x362c: 0x000c, 0x362d: 0x000c, + // Block 0xd9, offset 0x3640 + 0x3669: 0x000a, + 0x366a: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000c, 0x3683: 0x000c, 0x3684: 0x000c, 0x3685: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, 0x36c8: 0x000a, 0x36c9: 0x000a, 0x36ca: 0x000a, 0x36cb: 0x000a, + 0x36cc: 0x000a, 0x36cd: 0x000a, 0x36ce: 0x000a, 0x36cf: 0x000a, 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, + // Block 0xdc, offset 0x3700 + 0x371b: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3755: 0x000a, + // Block 0xde, offset 0x3780 + 0x378f: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c9: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3803: 0x000a, + 0x380e: 0x0002, 0x380f: 0x0002, 0x3810: 0x0002, 0x3811: 0x0002, + 0x3812: 0x0002, 0x3813: 0x0002, 0x3814: 0x0002, 0x3815: 0x0002, 0x3816: 0x0002, 0x3817: 0x0002, + 0x3818: 0x0002, 0x3819: 0x0002, 0x381a: 0x0002, 0x381b: 0x0002, 0x381c: 0x0002, 0x381d: 0x0002, + 0x381e: 0x0002, 0x381f: 0x0002, 0x3820: 0x0002, 0x3821: 0x0002, 0x3822: 0x0002, 0x3823: 0x0002, + 0x3824: 0x0002, 0x3825: 0x0002, 0x3826: 0x0002, 0x3827: 0x0002, 0x3828: 0x0002, 0x3829: 0x0002, + 0x382a: 0x0002, 0x382b: 0x0002, 0x382c: 0x0002, 0x382d: 0x0002, 0x382e: 0x0002, 0x382f: 0x0002, + 0x3830: 0x0002, 0x3831: 0x0002, 0x3832: 0x0002, 0x3833: 0x0002, 0x3834: 0x0002, 0x3835: 0x0002, + 0x3836: 0x0002, 0x3837: 0x0002, 0x3838: 0x0002, 0x3839: 0x0002, 0x383a: 0x0002, 0x383b: 0x0002, + 0x383c: 0x0002, 0x383d: 0x0002, 0x383e: 0x0002, 0x383f: 0x0002, + // Block 0xe1, offset 0x3840 + 0x3840: 0x000c, 0x3841: 0x000c, 0x3842: 0x000c, 0x3843: 0x000c, 0x3844: 0x000c, 0x3845: 0x000c, + 0x3846: 0x000c, 0x3847: 0x000c, 0x3848: 0x000c, 0x3849: 0x000c, 0x384a: 0x000c, 0x384b: 0x000c, + 0x384c: 0x000c, 0x384d: 0x000c, 0x384e: 0x000c, 0x384f: 0x000c, 0x3850: 0x000c, 0x3851: 0x000c, + 0x3852: 0x000c, 0x3853: 0x000c, 0x3854: 0x000c, 0x3855: 0x000c, 0x3856: 0x000c, 0x3857: 0x000c, + 0x3858: 0x000c, 0x3859: 0x000c, 0x385a: 0x000c, 0x385b: 0x000c, 0x385c: 0x000c, 0x385d: 0x000c, + 0x385e: 0x000c, 0x385f: 0x000c, 0x3860: 0x000c, 0x3861: 0x000c, 0x3862: 0x000c, 0x3863: 0x000c, + 0x3864: 0x000c, 0x3865: 0x000c, 0x3866: 0x000c, 0x3867: 0x000c, 0x3868: 0x000c, 0x3869: 0x000c, + 0x386a: 0x000c, 0x386b: 0x000c, 0x386c: 0x000c, 0x386d: 0x000c, 0x386e: 0x000c, 0x386f: 0x000c, + 0x3870: 0x000c, 0x3871: 0x000c, 0x3872: 0x000c, 0x3873: 0x000c, 0x3874: 0x000c, 0x3875: 0x000c, + 0x3876: 0x000c, 0x387b: 0x000c, + 0x387c: 0x000c, 0x387d: 0x000c, 0x387e: 0x000c, 0x387f: 0x000c, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000c, 0x3881: 0x000c, 0x3882: 0x000c, 0x3883: 0x000c, 0x3884: 0x000c, 0x3885: 0x000c, + 0x3886: 0x000c, 0x3887: 0x000c, 0x3888: 0x000c, 0x3889: 0x000c, 0x388a: 0x000c, 0x388b: 0x000c, + 0x388c: 0x000c, 0x388d: 0x000c, 0x388e: 0x000c, 0x388f: 0x000c, 0x3890: 0x000c, 0x3891: 0x000c, + 0x3892: 0x000c, 0x3893: 0x000c, 0x3894: 0x000c, 0x3895: 0x000c, 0x3896: 0x000c, 0x3897: 0x000c, + 0x3898: 0x000c, 0x3899: 0x000c, 0x389a: 0x000c, 0x389b: 0x000c, 0x389c: 0x000c, 0x389d: 0x000c, + 0x389e: 0x000c, 0x389f: 0x000c, 0x38a0: 0x000c, 0x38a1: 0x000c, 0x38a2: 0x000c, 0x38a3: 0x000c, + 0x38a4: 0x000c, 0x38a5: 0x000c, 0x38a6: 0x000c, 0x38a7: 0x000c, 0x38a8: 0x000c, 0x38a9: 0x000c, + 0x38aa: 0x000c, 0x38ab: 0x000c, 0x38ac: 0x000c, + 0x38b5: 0x000c, + // Block 0xe3, offset 0x38c0 + 0x38c4: 0x000c, + 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + // Block 0xe4, offset 0x3900 + 0x3900: 0x000c, 0x3901: 0x000c, 0x3902: 0x000c, 0x3903: 0x000c, 0x3904: 0x000c, 0x3905: 0x000c, + 0x3906: 0x000c, 0x3908: 0x000c, 0x3909: 0x000c, 0x390a: 0x000c, 0x390b: 0x000c, + 0x390c: 0x000c, 0x390d: 0x000c, 0x390e: 0x000c, 0x390f: 0x000c, 0x3910: 0x000c, 0x3911: 0x000c, + 0x3912: 0x000c, 0x3913: 0x000c, 0x3914: 0x000c, 0x3915: 0x000c, 0x3916: 0x000c, 0x3917: 0x000c, + 0x3918: 0x000c, 0x391b: 0x000c, 0x391c: 0x000c, 0x391d: 0x000c, + 0x391e: 0x000c, 0x391f: 0x000c, 0x3920: 0x000c, 0x3921: 0x000c, 0x3923: 0x000c, + 0x3924: 0x000c, 0x3926: 0x000c, 0x3927: 0x000c, 0x3928: 0x000c, 0x3929: 0x000c, + 0x392a: 0x000c, + // Block 0xe5, offset 0x3940 + 0x396e: 0x000c, + // Block 0xe6, offset 0x3980 + 0x39ac: 0x000c, 0x39ad: 0x000c, 0x39ae: 0x000c, 0x39af: 0x000c, + 0x39bf: 0x0004, + // Block 0xe7, offset 0x39c0 + 0x39ec: 0x000c, 0x39ed: 0x000c, 0x39ee: 0x000c, 0x39ef: 0x000c, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x0001, 0x3a01: 0x0001, 0x3a02: 0x0001, 0x3a03: 0x0001, 0x3a04: 0x0001, 0x3a05: 0x0001, + 0x3a06: 0x0001, 0x3a07: 0x0001, 0x3a08: 0x0001, 0x3a09: 0x0001, 0x3a0a: 0x0001, 0x3a0b: 0x0001, + 0x3a0c: 0x0001, 0x3a0d: 0x0001, 0x3a0e: 0x0001, 0x3a0f: 0x0001, 0x3a10: 0x000c, 0x3a11: 0x000c, + 0x3a12: 0x000c, 0x3a13: 0x000c, 0x3a14: 0x000c, 0x3a15: 0x000c, 0x3a16: 0x000c, 0x3a17: 0x0001, + 0x3a18: 0x0001, 0x3a19: 0x0001, 0x3a1a: 0x0001, 0x3a1b: 0x0001, 0x3a1c: 0x0001, 0x3a1d: 0x0001, + 0x3a1e: 0x0001, 0x3a1f: 0x0001, 0x3a20: 0x0001, 0x3a21: 0x0001, 0x3a22: 0x0001, 0x3a23: 0x0001, + 0x3a24: 0x0001, 0x3a25: 0x0001, 0x3a26: 0x0001, 0x3a27: 0x0001, 0x3a28: 0x0001, 0x3a29: 0x0001, + 0x3a2a: 0x0001, 0x3a2b: 0x0001, 0x3a2c: 0x0001, 0x3a2d: 0x0001, 0x3a2e: 0x0001, 0x3a2f: 0x0001, + 0x3a30: 0x0001, 0x3a31: 0x0001, 0x3a32: 0x0001, 0x3a33: 0x0001, 0x3a34: 0x0001, 0x3a35: 0x0001, + 0x3a36: 0x0001, 0x3a37: 0x0001, 0x3a38: 0x0001, 0x3a39: 0x0001, 0x3a3a: 0x0001, 0x3a3b: 0x0001, + 0x3a3c: 0x0001, 0x3a3d: 0x0001, 0x3a3e: 0x0001, 0x3a3f: 0x0001, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x0001, 0x3a41: 0x0001, 0x3a42: 0x0001, 0x3a43: 0x0001, 0x3a44: 0x000c, 0x3a45: 0x000c, + 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x0001, + 0x3a4c: 0x0001, 0x3a4d: 0x0001, 0x3a4e: 0x0001, 0x3a4f: 0x0001, 0x3a50: 0x0001, 0x3a51: 0x0001, + 0x3a52: 0x0001, 0x3a53: 0x0001, 0x3a54: 0x0001, 0x3a55: 0x0001, 0x3a56: 0x0001, 0x3a57: 0x0001, + 0x3a58: 0x0001, 0x3a59: 0x0001, 0x3a5a: 0x0001, 0x3a5b: 0x0001, 0x3a5c: 0x0001, 0x3a5d: 0x0001, + 0x3a5e: 0x0001, 0x3a5f: 0x0001, 0x3a60: 0x0001, 0x3a61: 0x0001, 0x3a62: 0x0001, 0x3a63: 0x0001, + 0x3a64: 0x0001, 0x3a65: 0x0001, 0x3a66: 0x0001, 0x3a67: 0x0001, 0x3a68: 0x0001, 0x3a69: 0x0001, + 0x3a6a: 0x0001, 0x3a6b: 0x0001, 0x3a6c: 0x0001, 0x3a6d: 0x0001, 0x3a6e: 0x0001, 0x3a6f: 0x0001, + 0x3a70: 0x0001, 0x3a71: 0x0001, 0x3a72: 0x0001, 0x3a73: 0x0001, 0x3a74: 0x0001, 0x3a75: 0x0001, + 0x3a76: 0x0001, 0x3a77: 0x0001, 0x3a78: 0x0001, 0x3a79: 0x0001, 0x3a7a: 0x0001, 0x3a7b: 0x0001, + 0x3a7c: 0x0001, 0x3a7d: 0x0001, 0x3a7e: 0x0001, 0x3a7f: 0x0001, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x0001, 0x3a81: 0x0001, 0x3a82: 0x0001, 0x3a83: 0x0001, 0x3a84: 0x0001, 0x3a85: 0x0001, + 0x3a86: 0x0001, 0x3a87: 0x0001, 0x3a88: 0x0001, 0x3a89: 0x0001, 0x3a8a: 0x0001, 0x3a8b: 0x0001, + 0x3a8c: 0x0001, 0x3a8d: 0x0001, 0x3a8e: 0x0001, 0x3a8f: 0x0001, 0x3a90: 0x0001, 0x3a91: 0x0001, + 0x3a92: 0x0001, 0x3a93: 0x0001, 0x3a94: 0x0001, 0x3a95: 0x0001, 0x3a96: 0x0001, 0x3a97: 0x0001, + 0x3a98: 0x0001, 0x3a99: 0x0001, 0x3a9a: 0x0001, 0x3a9b: 0x0001, 0x3a9c: 0x0001, 0x3a9d: 0x0001, + 0x3a9e: 0x0001, 0x3a9f: 0x0001, 0x3aa0: 0x0001, 0x3aa1: 0x0001, 0x3aa2: 0x0001, 0x3aa3: 0x0001, + 0x3aa4: 0x0001, 0x3aa5: 0x0001, 0x3aa6: 0x0001, 0x3aa7: 0x0001, 0x3aa8: 0x0001, 0x3aa9: 0x0001, + 0x3aaa: 0x0001, 0x3aab: 0x0001, 0x3aac: 0x0001, 0x3aad: 0x0001, 0x3aae: 0x0001, 0x3aaf: 0x0001, + 0x3ab0: 0x0001, 0x3ab1: 0x000d, 0x3ab2: 0x000d, 0x3ab3: 0x000d, 0x3ab4: 0x000d, 0x3ab5: 0x000d, + 0x3ab6: 0x000d, 0x3ab7: 0x000d, 0x3ab8: 0x000d, 0x3ab9: 0x000d, 0x3aba: 0x000d, 0x3abb: 0x000d, + 0x3abc: 0x000d, 0x3abd: 0x000d, 0x3abe: 0x000d, 0x3abf: 0x000d, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x000d, 0x3ac1: 0x000d, 0x3ac2: 0x000d, 0x3ac3: 0x000d, 0x3ac4: 0x000d, 0x3ac5: 0x000d, + 0x3ac6: 0x000d, 0x3ac7: 0x000d, 0x3ac8: 0x000d, 0x3ac9: 0x000d, 0x3aca: 0x000d, 0x3acb: 0x000d, + 0x3acc: 0x000d, 0x3acd: 0x000d, 0x3ace: 0x000d, 0x3acf: 0x000d, 0x3ad0: 0x000d, 0x3ad1: 0x000d, + 0x3ad2: 0x000d, 0x3ad3: 0x000d, 0x3ad4: 0x000d, 0x3ad5: 0x000d, 0x3ad6: 0x000d, 0x3ad7: 0x000d, + 0x3ad8: 0x000d, 0x3ad9: 0x000d, 0x3ada: 0x000d, 0x3adb: 0x000d, 0x3adc: 0x000d, 0x3add: 0x000d, + 0x3ade: 0x000d, 0x3adf: 0x000d, 0x3ae0: 0x000d, 0x3ae1: 0x000d, 0x3ae2: 0x000d, 0x3ae3: 0x000d, + 0x3ae4: 0x000d, 0x3ae5: 0x000d, 0x3ae6: 0x000d, 0x3ae7: 0x000d, 0x3ae8: 0x000d, 0x3ae9: 0x000d, + 0x3aea: 0x000d, 0x3aeb: 0x000d, 0x3aec: 0x000d, 0x3aed: 0x000d, 0x3aee: 0x000d, 0x3aef: 0x000d, + 0x3af0: 0x000d, 0x3af1: 0x000d, 0x3af2: 0x000d, 0x3af3: 0x000d, 0x3af4: 0x000d, 0x3af5: 0x0001, + 0x3af6: 0x0001, 0x3af7: 0x0001, 0x3af8: 0x0001, 0x3af9: 0x0001, 0x3afa: 0x0001, 0x3afb: 0x0001, + 0x3afc: 0x0001, 0x3afd: 0x0001, 0x3afe: 0x0001, 0x3aff: 0x0001, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x0001, 0x3b01: 0x000d, 0x3b02: 0x000d, 0x3b03: 0x000d, 0x3b04: 0x000d, 0x3b05: 0x000d, + 0x3b06: 0x000d, 0x3b07: 0x000d, 0x3b08: 0x000d, 0x3b09: 0x000d, 0x3b0a: 0x000d, 0x3b0b: 0x000d, + 0x3b0c: 0x000d, 0x3b0d: 0x000d, 0x3b0e: 0x000d, 0x3b0f: 0x000d, 0x3b10: 0x000d, 0x3b11: 0x000d, + 0x3b12: 0x000d, 0x3b13: 0x000d, 0x3b14: 0x000d, 0x3b15: 0x000d, 0x3b16: 0x000d, 0x3b17: 0x000d, + 0x3b18: 0x000d, 0x3b19: 0x000d, 0x3b1a: 0x000d, 0x3b1b: 0x000d, 0x3b1c: 0x000d, 0x3b1d: 0x000d, + 0x3b1e: 0x000d, 0x3b1f: 0x000d, 0x3b20: 0x000d, 0x3b21: 0x000d, 0x3b22: 0x000d, 0x3b23: 0x000d, + 0x3b24: 0x000d, 0x3b25: 0x000d, 0x3b26: 0x000d, 0x3b27: 0x000d, 0x3b28: 0x000d, 0x3b29: 0x000d, + 0x3b2a: 0x000d, 0x3b2b: 0x000d, 0x3b2c: 0x000d, 0x3b2d: 0x000d, 0x3b2e: 0x000d, 0x3b2f: 0x000d, + 0x3b30: 0x000d, 0x3b31: 0x000d, 0x3b32: 0x000d, 0x3b33: 0x000d, 0x3b34: 0x000d, 0x3b35: 0x000d, + 0x3b36: 0x000d, 0x3b37: 0x000d, 0x3b38: 0x000d, 0x3b39: 0x000d, 0x3b3a: 0x000d, 0x3b3b: 0x000d, + 0x3b3c: 0x000d, 0x3b3d: 0x000d, 0x3b3e: 0x0001, 0x3b3f: 0x0001, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x000d, 0x3b41: 0x000d, 0x3b42: 0x000d, 0x3b43: 0x000d, 0x3b44: 0x000d, 0x3b45: 0x000d, + 0x3b46: 0x000d, 0x3b47: 0x000d, 0x3b48: 0x000d, 0x3b49: 0x000d, 0x3b4a: 0x000d, 0x3b4b: 0x000d, + 0x3b4c: 0x000d, 0x3b4d: 0x000d, 0x3b4e: 0x000d, 0x3b4f: 0x000d, 0x3b50: 0x000d, 0x3b51: 0x000d, + 0x3b52: 0x000d, 0x3b53: 0x000d, 0x3b54: 0x000d, 0x3b55: 0x000d, 0x3b56: 0x000d, 0x3b57: 0x000d, + 0x3b58: 0x000d, 0x3b59: 0x000d, 0x3b5a: 0x000d, 0x3b5b: 0x000d, 0x3b5c: 0x000d, 0x3b5d: 0x000d, + 0x3b5e: 0x000d, 0x3b5f: 0x000d, 0x3b60: 0x000d, 0x3b61: 0x000d, 0x3b62: 0x000d, 0x3b63: 0x000d, + 0x3b64: 0x000d, 0x3b65: 0x000d, 0x3b66: 0x000d, 0x3b67: 0x000d, 0x3b68: 0x000d, 0x3b69: 0x000d, + 0x3b6a: 0x000d, 0x3b6b: 0x000d, 0x3b6c: 0x000d, 0x3b6d: 0x000d, 0x3b6e: 0x000d, 0x3b6f: 0x000d, + 0x3b70: 0x000a, 0x3b71: 0x000a, 0x3b72: 0x000d, 0x3b73: 0x000d, 0x3b74: 0x000d, 0x3b75: 0x000d, + 0x3b76: 0x000d, 0x3b77: 0x000d, 0x3b78: 0x000d, 0x3b79: 0x000d, 0x3b7a: 0x000d, 0x3b7b: 0x000d, + 0x3b7c: 0x000d, 0x3b7d: 0x000d, 0x3b7e: 0x000d, 0x3b7f: 0x000d, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x000a, 0x3b81: 0x000a, 0x3b82: 0x000a, 0x3b83: 0x000a, 0x3b84: 0x000a, 0x3b85: 0x000a, + 0x3b86: 0x000a, 0x3b87: 0x000a, 0x3b88: 0x000a, 0x3b89: 0x000a, 0x3b8a: 0x000a, 0x3b8b: 0x000a, + 0x3b8c: 0x000a, 0x3b8d: 0x000a, 0x3b8e: 0x000a, 0x3b8f: 0x000a, 0x3b90: 0x000a, 0x3b91: 0x000a, + 0x3b92: 0x000a, 0x3b93: 0x000a, 0x3b94: 0x000a, 0x3b95: 0x000a, 0x3b96: 0x000a, 0x3b97: 0x000a, + 0x3b98: 0x000a, 0x3b99: 0x000a, 0x3b9a: 0x000a, 0x3b9b: 0x000a, 0x3b9c: 0x000a, 0x3b9d: 0x000a, + 0x3b9e: 0x000a, 0x3b9f: 0x000a, 0x3ba0: 0x000a, 0x3ba1: 0x000a, 0x3ba2: 0x000a, 0x3ba3: 0x000a, + 0x3ba4: 0x000a, 0x3ba5: 0x000a, 0x3ba6: 0x000a, 0x3ba7: 0x000a, 0x3ba8: 0x000a, 0x3ba9: 0x000a, + 0x3baa: 0x000a, 0x3bab: 0x000a, + 0x3bb0: 0x000a, 0x3bb1: 0x000a, 0x3bb2: 0x000a, 0x3bb3: 0x000a, 0x3bb4: 0x000a, 0x3bb5: 0x000a, + 0x3bb6: 0x000a, 0x3bb7: 0x000a, 0x3bb8: 0x000a, 0x3bb9: 0x000a, 0x3bba: 0x000a, 0x3bbb: 0x000a, + 0x3bbc: 0x000a, 0x3bbd: 0x000a, 0x3bbe: 0x000a, 0x3bbf: 0x000a, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x000a, 0x3bc1: 0x000a, 0x3bc2: 0x000a, 0x3bc3: 0x000a, 0x3bc4: 0x000a, 0x3bc5: 0x000a, + 0x3bc6: 0x000a, 0x3bc7: 0x000a, 0x3bc8: 0x000a, 0x3bc9: 0x000a, 0x3bca: 0x000a, 0x3bcb: 0x000a, + 0x3bcc: 0x000a, 0x3bcd: 0x000a, 0x3bce: 0x000a, 0x3bcf: 0x000a, 0x3bd0: 0x000a, 0x3bd1: 0x000a, + 0x3bd2: 0x000a, 0x3bd3: 0x000a, + 0x3be0: 0x000a, 0x3be1: 0x000a, 0x3be2: 0x000a, 0x3be3: 0x000a, + 0x3be4: 0x000a, 0x3be5: 0x000a, 0x3be6: 0x000a, 0x3be7: 0x000a, 0x3be8: 0x000a, 0x3be9: 0x000a, + 0x3bea: 0x000a, 0x3beb: 0x000a, 0x3bec: 0x000a, 0x3bed: 0x000a, 0x3bee: 0x000a, + 0x3bf1: 0x000a, 0x3bf2: 0x000a, 0x3bf3: 0x000a, 0x3bf4: 0x000a, 0x3bf5: 0x000a, + 0x3bf6: 0x000a, 0x3bf7: 0x000a, 0x3bf8: 0x000a, 0x3bf9: 0x000a, 0x3bfa: 0x000a, 0x3bfb: 0x000a, + 0x3bfc: 0x000a, 0x3bfd: 0x000a, 0x3bfe: 0x000a, 0x3bff: 0x000a, + // Block 0xf0, offset 0x3c00 + 0x3c01: 0x000a, 0x3c02: 0x000a, 0x3c03: 0x000a, 0x3c04: 0x000a, 0x3c05: 0x000a, + 0x3c06: 0x000a, 0x3c07: 0x000a, 0x3c08: 0x000a, 0x3c09: 0x000a, 0x3c0a: 0x000a, 0x3c0b: 0x000a, + 0x3c0c: 0x000a, 0x3c0d: 0x000a, 0x3c0e: 0x000a, 0x3c0f: 0x000a, 0x3c11: 0x000a, + 0x3c12: 0x000a, 0x3c13: 0x000a, 0x3c14: 0x000a, 0x3c15: 0x000a, 0x3c16: 0x000a, 0x3c17: 0x000a, + 0x3c18: 0x000a, 0x3c19: 0x000a, 0x3c1a: 0x000a, 0x3c1b: 0x000a, 0x3c1c: 0x000a, 0x3c1d: 0x000a, + 0x3c1e: 0x000a, 0x3c1f: 0x000a, 0x3c20: 0x000a, 0x3c21: 0x000a, 0x3c22: 0x000a, 0x3c23: 0x000a, + 0x3c24: 0x000a, 0x3c25: 0x000a, 0x3c26: 0x000a, 0x3c27: 0x000a, 0x3c28: 0x000a, 0x3c29: 0x000a, + 0x3c2a: 0x000a, 0x3c2b: 0x000a, 0x3c2c: 0x000a, 0x3c2d: 0x000a, 0x3c2e: 0x000a, 0x3c2f: 0x000a, + 0x3c30: 0x000a, 0x3c31: 0x000a, 0x3c32: 0x000a, 0x3c33: 0x000a, 0x3c34: 0x000a, 0x3c35: 0x000a, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x0002, 0x3c41: 0x0002, 0x3c42: 0x0002, 0x3c43: 0x0002, 0x3c44: 0x0002, 0x3c45: 0x0002, + 0x3c46: 0x0002, 0x3c47: 0x0002, 0x3c48: 0x0002, 0x3c49: 0x0002, 0x3c4a: 0x0002, 0x3c4b: 0x000a, + 0x3c4c: 0x000a, 0x3c4d: 0x000a, 0x3c4e: 0x000a, 0x3c4f: 0x000a, + 0x3c6f: 0x000a, + // Block 0xf2, offset 0x3c80 + 0x3caa: 0x000a, 0x3cab: 0x000a, 0x3cac: 0x000a, 0x3cad: 0x000a, 0x3cae: 0x000a, 0x3caf: 0x000a, + // Block 0xf3, offset 0x3cc0 + 0x3ced: 0x000a, + // Block 0xf4, offset 0x3d00 + 0x3d20: 0x000a, 0x3d21: 0x000a, 0x3d22: 0x000a, 0x3d23: 0x000a, + 0x3d24: 0x000a, 0x3d25: 0x000a, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x000a, 0x3d41: 0x000a, 0x3d42: 0x000a, 0x3d43: 0x000a, 0x3d44: 0x000a, 0x3d45: 0x000a, + 0x3d46: 0x000a, 0x3d47: 0x000a, 0x3d48: 0x000a, 0x3d49: 0x000a, 0x3d4a: 0x000a, 0x3d4b: 0x000a, + 0x3d4c: 0x000a, 0x3d4d: 0x000a, 0x3d4e: 0x000a, 0x3d4f: 0x000a, 0x3d50: 0x000a, 0x3d51: 0x000a, + 0x3d52: 0x000a, 0x3d53: 0x000a, 0x3d54: 0x000a, 0x3d55: 0x000a, 0x3d56: 0x000a, 0x3d57: 0x000a, + 0x3d5c: 0x000a, 0x3d5d: 0x000a, + 0x3d5e: 0x000a, 0x3d5f: 0x000a, 0x3d60: 0x000a, 0x3d61: 0x000a, 0x3d62: 0x000a, 0x3d63: 0x000a, + 0x3d64: 0x000a, 0x3d65: 0x000a, 0x3d66: 0x000a, 0x3d67: 0x000a, 0x3d68: 0x000a, 0x3d69: 0x000a, + 0x3d6a: 0x000a, 0x3d6b: 0x000a, 0x3d6c: 0x000a, + 0x3d70: 0x000a, 0x3d71: 0x000a, 0x3d72: 0x000a, 0x3d73: 0x000a, 0x3d74: 0x000a, 0x3d75: 0x000a, + 0x3d76: 0x000a, 0x3d77: 0x000a, 0x3d78: 0x000a, 0x3d79: 0x000a, 0x3d7a: 0x000a, 0x3d7b: 0x000a, + 0x3d7c: 0x000a, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x000a, 0x3d81: 0x000a, 0x3d82: 0x000a, 0x3d83: 0x000a, 0x3d84: 0x000a, 0x3d85: 0x000a, + 0x3d86: 0x000a, 0x3d87: 0x000a, 0x3d88: 0x000a, 0x3d89: 0x000a, 0x3d8a: 0x000a, 0x3d8b: 0x000a, + 0x3d8c: 0x000a, 0x3d8d: 0x000a, 0x3d8e: 0x000a, 0x3d8f: 0x000a, 0x3d90: 0x000a, 0x3d91: 0x000a, + 0x3d92: 0x000a, 0x3d93: 0x000a, 0x3d94: 0x000a, 0x3d95: 0x000a, 0x3d96: 0x000a, 0x3d97: 0x000a, + 0x3d98: 0x000a, 0x3d99: 0x000a, 0x3d9a: 0x000a, 0x3d9b: 0x000a, 0x3d9c: 0x000a, 0x3d9d: 0x000a, + 0x3d9e: 0x000a, 0x3d9f: 0x000a, 0x3da0: 0x000a, 0x3da1: 0x000a, 0x3da2: 0x000a, 0x3da3: 0x000a, + 0x3da4: 0x000a, 0x3da5: 0x000a, 0x3da6: 0x000a, 0x3da7: 0x000a, 0x3da8: 0x000a, 0x3da9: 0x000a, + 0x3daa: 0x000a, 0x3dab: 0x000a, 0x3dac: 0x000a, 0x3dad: 0x000a, 0x3dae: 0x000a, 0x3daf: 0x000a, + 0x3db0: 0x000a, 0x3db1: 0x000a, 0x3db2: 0x000a, 0x3db3: 0x000a, 0x3db4: 0x000a, 0x3db5: 0x000a, + 0x3db6: 0x000a, 0x3dbb: 0x000a, + 0x3dbc: 0x000a, 0x3dbd: 0x000a, 0x3dbe: 0x000a, 0x3dbf: 0x000a, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x000a, 0x3dc1: 0x000a, 0x3dc2: 0x000a, 0x3dc3: 0x000a, 0x3dc4: 0x000a, 0x3dc5: 0x000a, + 0x3dc6: 0x000a, 0x3dc7: 0x000a, 0x3dc8: 0x000a, 0x3dc9: 0x000a, 0x3dca: 0x000a, 0x3dcb: 0x000a, + 0x3dcc: 0x000a, 0x3dcd: 0x000a, 0x3dce: 0x000a, 0x3dcf: 0x000a, 0x3dd0: 0x000a, 0x3dd1: 0x000a, + 0x3dd2: 0x000a, 0x3dd3: 0x000a, 0x3dd4: 0x000a, 0x3dd5: 0x000a, 0x3dd6: 0x000a, 0x3dd7: 0x000a, + 0x3dd8: 0x000a, 0x3dd9: 0x000a, + 0x3de0: 0x000a, 0x3de1: 0x000a, 0x3de2: 0x000a, 0x3de3: 0x000a, + 0x3de4: 0x000a, 0x3de5: 0x000a, 0x3de6: 0x000a, 0x3de7: 0x000a, 0x3de8: 0x000a, 0x3de9: 0x000a, + 0x3dea: 0x000a, 0x3deb: 0x000a, + 0x3df0: 0x000a, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x000a, 0x3e01: 0x000a, 0x3e02: 0x000a, 0x3e03: 0x000a, 0x3e04: 0x000a, 0x3e05: 0x000a, + 0x3e06: 0x000a, 0x3e07: 0x000a, 0x3e08: 0x000a, 0x3e09: 0x000a, 0x3e0a: 0x000a, 0x3e0b: 0x000a, + 0x3e10: 0x000a, 0x3e11: 0x000a, + 0x3e12: 0x000a, 0x3e13: 0x000a, 0x3e14: 0x000a, 0x3e15: 0x000a, 0x3e16: 0x000a, 0x3e17: 0x000a, + 0x3e18: 0x000a, 0x3e19: 0x000a, 0x3e1a: 0x000a, 0x3e1b: 0x000a, 0x3e1c: 0x000a, 0x3e1d: 0x000a, + 0x3e1e: 0x000a, 0x3e1f: 0x000a, 0x3e20: 0x000a, 0x3e21: 0x000a, 0x3e22: 0x000a, 0x3e23: 0x000a, + 0x3e24: 0x000a, 0x3e25: 0x000a, 0x3e26: 0x000a, 0x3e27: 0x000a, 0x3e28: 0x000a, 0x3e29: 0x000a, + 0x3e2a: 0x000a, 0x3e2b: 0x000a, 0x3e2c: 0x000a, 0x3e2d: 0x000a, 0x3e2e: 0x000a, 0x3e2f: 0x000a, + 0x3e30: 0x000a, 0x3e31: 0x000a, 0x3e32: 0x000a, 0x3e33: 0x000a, 0x3e34: 0x000a, 0x3e35: 0x000a, + 0x3e36: 0x000a, 0x3e37: 0x000a, 0x3e38: 0x000a, 0x3e39: 0x000a, 0x3e3a: 0x000a, 0x3e3b: 0x000a, + 0x3e3c: 0x000a, 0x3e3d: 0x000a, 0x3e3e: 0x000a, 0x3e3f: 0x000a, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x000a, 0x3e41: 0x000a, 0x3e42: 0x000a, 0x3e43: 0x000a, 0x3e44: 0x000a, 0x3e45: 0x000a, + 0x3e46: 0x000a, 0x3e47: 0x000a, + 0x3e50: 0x000a, 0x3e51: 0x000a, + 0x3e52: 0x000a, 0x3e53: 0x000a, 0x3e54: 0x000a, 0x3e55: 0x000a, 0x3e56: 0x000a, 0x3e57: 0x000a, + 0x3e58: 0x000a, 0x3e59: 0x000a, + 0x3e60: 0x000a, 0x3e61: 0x000a, 0x3e62: 0x000a, 0x3e63: 0x000a, + 0x3e64: 0x000a, 0x3e65: 0x000a, 0x3e66: 0x000a, 0x3e67: 0x000a, 0x3e68: 0x000a, 0x3e69: 0x000a, + 0x3e6a: 0x000a, 0x3e6b: 0x000a, 0x3e6c: 0x000a, 0x3e6d: 0x000a, 0x3e6e: 0x000a, 0x3e6f: 0x000a, + 0x3e70: 0x000a, 0x3e71: 0x000a, 0x3e72: 0x000a, 0x3e73: 0x000a, 0x3e74: 0x000a, 0x3e75: 0x000a, + 0x3e76: 0x000a, 0x3e77: 0x000a, 0x3e78: 0x000a, 0x3e79: 0x000a, 0x3e7a: 0x000a, 0x3e7b: 0x000a, + 0x3e7c: 0x000a, 0x3e7d: 0x000a, 0x3e7e: 0x000a, 0x3e7f: 0x000a, + // Block 0xfa, offset 0x3e80 + 0x3e80: 0x000a, 0x3e81: 0x000a, 0x3e82: 0x000a, 0x3e83: 0x000a, 0x3e84: 0x000a, 0x3e85: 0x000a, + 0x3e86: 0x000a, 0x3e87: 0x000a, + 0x3e90: 0x000a, 0x3e91: 0x000a, + 0x3e92: 0x000a, 0x3e93: 0x000a, 0x3e94: 0x000a, 0x3e95: 0x000a, 0x3e96: 0x000a, 0x3e97: 0x000a, + 0x3e98: 0x000a, 0x3e99: 0x000a, 0x3e9a: 0x000a, 0x3e9b: 0x000a, 0x3e9c: 0x000a, 0x3e9d: 0x000a, + 0x3e9e: 0x000a, 0x3e9f: 0x000a, 0x3ea0: 0x000a, 0x3ea1: 0x000a, 0x3ea2: 0x000a, 0x3ea3: 0x000a, + 0x3ea4: 0x000a, 0x3ea5: 0x000a, 0x3ea6: 0x000a, 0x3ea7: 0x000a, 0x3ea8: 0x000a, 0x3ea9: 0x000a, + 0x3eaa: 0x000a, 0x3eab: 0x000a, 0x3eac: 0x000a, 0x3ead: 0x000a, + 0x3eb0: 0x000a, 0x3eb1: 0x000a, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x000a, 0x3ec1: 0x000a, 0x3ec2: 0x000a, 0x3ec3: 0x000a, 0x3ec4: 0x000a, 0x3ec5: 0x000a, + 0x3ec6: 0x000a, 0x3ec7: 0x000a, 0x3ec8: 0x000a, 0x3ec9: 0x000a, 0x3eca: 0x000a, 0x3ecb: 0x000a, + 0x3ecc: 0x000a, 0x3ecd: 0x000a, 0x3ece: 0x000a, 0x3ecf: 0x000a, 0x3ed0: 0x000a, 0x3ed1: 0x000a, + 0x3ed2: 0x000a, 0x3ed3: 0x000a, + 0x3ee0: 0x000a, 0x3ee1: 0x000a, 0x3ee2: 0x000a, 0x3ee3: 0x000a, + 0x3ee4: 0x000a, 0x3ee5: 0x000a, 0x3ee6: 0x000a, 0x3ee7: 0x000a, 0x3ee8: 0x000a, 0x3ee9: 0x000a, + 0x3eea: 0x000a, 0x3eeb: 0x000a, 0x3eec: 0x000a, 0x3eed: 0x000a, + 0x3ef0: 0x000a, 0x3ef1: 0x000a, 0x3ef2: 0x000a, 0x3ef3: 0x000a, 0x3ef4: 0x000a, 0x3ef5: 0x000a, + 0x3ef6: 0x000a, 0x3ef7: 0x000a, 0x3ef8: 0x000a, 0x3ef9: 0x000a, 0x3efa: 0x000a, 0x3efb: 0x000a, + 0x3efc: 0x000a, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x000a, 0x3f01: 0x000a, 0x3f02: 0x000a, 0x3f03: 0x000a, 0x3f04: 0x000a, 0x3f05: 0x000a, + 0x3f06: 0x000a, 0x3f07: 0x000a, 0x3f08: 0x000a, + 0x3f10: 0x000a, 0x3f11: 0x000a, + 0x3f12: 0x000a, 0x3f13: 0x000a, 0x3f14: 0x000a, 0x3f15: 0x000a, 0x3f16: 0x000a, 0x3f17: 0x000a, + 0x3f18: 0x000a, 0x3f19: 0x000a, 0x3f1a: 0x000a, 0x3f1b: 0x000a, 0x3f1c: 0x000a, 0x3f1d: 0x000a, + 0x3f1e: 0x000a, 0x3f1f: 0x000a, 0x3f20: 0x000a, 0x3f21: 0x000a, 0x3f22: 0x000a, 0x3f23: 0x000a, + 0x3f24: 0x000a, 0x3f25: 0x000a, 0x3f26: 0x000a, 0x3f27: 0x000a, 0x3f28: 0x000a, 0x3f29: 0x000a, + 0x3f2a: 0x000a, 0x3f2b: 0x000a, 0x3f2c: 0x000a, 0x3f2d: 0x000a, 0x3f2e: 0x000a, 0x3f2f: 0x000a, + 0x3f30: 0x000a, 0x3f31: 0x000a, 0x3f32: 0x000a, 0x3f33: 0x000a, 0x3f34: 0x000a, 0x3f35: 0x000a, + 0x3f36: 0x000a, 0x3f37: 0x000a, 0x3f38: 0x000a, 0x3f39: 0x000a, 0x3f3a: 0x000a, 0x3f3b: 0x000a, + 0x3f3c: 0x000a, 0x3f3d: 0x000a, 0x3f3f: 0x000a, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x000a, 0x3f41: 0x000a, 0x3f42: 0x000a, 0x3f43: 0x000a, 0x3f44: 0x000a, 0x3f45: 0x000a, + 0x3f4e: 0x000a, 0x3f4f: 0x000a, 0x3f50: 0x000a, 0x3f51: 0x000a, + 0x3f52: 0x000a, 0x3f53: 0x000a, 0x3f54: 0x000a, 0x3f55: 0x000a, 0x3f56: 0x000a, 0x3f57: 0x000a, + 0x3f58: 0x000a, 0x3f59: 0x000a, 0x3f5a: 0x000a, 0x3f5b: 0x000a, + 0x3f60: 0x000a, 0x3f61: 0x000a, 0x3f62: 0x000a, 0x3f63: 0x000a, + 0x3f64: 0x000a, 0x3f65: 0x000a, 0x3f66: 0x000a, 0x3f67: 0x000a, 0x3f68: 0x000a, + 0x3f70: 0x000a, 0x3f71: 0x000a, 0x3f72: 0x000a, 0x3f73: 0x000a, 0x3f74: 0x000a, 0x3f75: 0x000a, + 0x3f76: 0x000a, 0x3f77: 0x000a, 0x3f78: 0x000a, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x000a, 0x3f81: 0x000a, 0x3f82: 0x000a, 0x3f83: 0x000a, 0x3f84: 0x000a, 0x3f85: 0x000a, + 0x3f86: 0x000a, 0x3f87: 0x000a, 0x3f88: 0x000a, 0x3f89: 0x000a, 0x3f8a: 0x000a, 0x3f8b: 0x000a, + 0x3f8c: 0x000a, 0x3f8d: 0x000a, 0x3f8e: 0x000a, 0x3f8f: 0x000a, 0x3f90: 0x000a, 0x3f91: 0x000a, + 0x3f92: 0x000a, 0x3f94: 0x000a, 0x3f95: 0x000a, 0x3f96: 0x000a, 0x3f97: 0x000a, + 0x3f98: 0x000a, 0x3f99: 0x000a, 0x3f9a: 0x000a, 0x3f9b: 0x000a, 0x3f9c: 0x000a, 0x3f9d: 0x000a, + 0x3f9e: 0x000a, 0x3f9f: 0x000a, 0x3fa0: 0x000a, 0x3fa1: 0x000a, 0x3fa2: 0x000a, 0x3fa3: 0x000a, + 0x3fa4: 0x000a, 0x3fa5: 0x000a, 0x3fa6: 0x000a, 0x3fa7: 0x000a, 0x3fa8: 0x000a, 0x3fa9: 0x000a, + 0x3faa: 0x000a, 0x3fab: 0x000a, 0x3fac: 0x000a, 0x3fad: 0x000a, 0x3fae: 0x000a, 0x3faf: 0x000a, + 0x3fb0: 0x000a, 0x3fb1: 0x000a, 0x3fb2: 0x000a, 0x3fb3: 0x000a, 0x3fb4: 0x000a, 0x3fb5: 0x000a, + 0x3fb6: 0x000a, 0x3fb7: 0x000a, 0x3fb8: 0x000a, 0x3fb9: 0x000a, 0x3fba: 0x000a, 0x3fbb: 0x000a, + 0x3fbc: 0x000a, 0x3fbd: 0x000a, 0x3fbe: 0x000a, 0x3fbf: 0x000a, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x000a, 0x3fc1: 0x000a, 0x3fc2: 0x000a, 0x3fc3: 0x000a, 0x3fc4: 0x000a, 0x3fc5: 0x000a, + 0x3fc6: 0x000a, 0x3fc7: 0x000a, 0x3fc8: 0x000a, 0x3fc9: 0x000a, 0x3fca: 0x000a, + 0x3ff0: 0x0002, 0x3ff1: 0x0002, 0x3ff2: 0x0002, 0x3ff3: 0x0002, 0x3ff4: 0x0002, 0x3ff5: 0x0002, + 0x3ff6: 0x0002, 0x3ff7: 0x0002, 0x3ff8: 0x0002, 0x3ff9: 0x0002, + // Block 0x100, offset 0x4000 + 0x403e: 0x000b, 0x403f: 0x000b, + // Block 0x101, offset 0x4040 + 0x4040: 0x000b, 0x4041: 0x000b, 0x4042: 0x000b, 0x4043: 0x000b, 0x4044: 0x000b, 0x4045: 0x000b, + 0x4046: 0x000b, 0x4047: 0x000b, 0x4048: 0x000b, 0x4049: 0x000b, 0x404a: 0x000b, 0x404b: 0x000b, + 0x404c: 0x000b, 0x404d: 0x000b, 0x404e: 0x000b, 0x404f: 0x000b, 0x4050: 0x000b, 0x4051: 0x000b, + 0x4052: 0x000b, 0x4053: 0x000b, 0x4054: 0x000b, 0x4055: 0x000b, 0x4056: 0x000b, 0x4057: 0x000b, + 0x4058: 0x000b, 0x4059: 0x000b, 0x405a: 0x000b, 0x405b: 0x000b, 0x405c: 0x000b, 0x405d: 0x000b, + 0x405e: 0x000b, 0x405f: 0x000b, 0x4060: 0x000b, 0x4061: 0x000b, 0x4062: 0x000b, 0x4063: 0x000b, + 0x4064: 0x000b, 0x4065: 0x000b, 0x4066: 0x000b, 0x4067: 0x000b, 0x4068: 0x000b, 0x4069: 0x000b, + 0x406a: 0x000b, 0x406b: 0x000b, 0x406c: 0x000b, 0x406d: 0x000b, 0x406e: 0x000b, 0x406f: 0x000b, + 0x4070: 0x000b, 0x4071: 0x000b, 0x4072: 0x000b, 0x4073: 0x000b, 0x4074: 0x000b, 0x4075: 0x000b, + 0x4076: 0x000b, 0x4077: 0x000b, 0x4078: 0x000b, 0x4079: 0x000b, 0x407a: 0x000b, 0x407b: 0x000b, + 0x407c: 0x000b, 0x407d: 0x000b, 0x407e: 0x000b, 0x407f: 0x000b, + // Block 0x102, offset 0x4080 + 0x4080: 0x000c, 0x4081: 0x000c, 0x4082: 0x000c, 0x4083: 0x000c, 0x4084: 0x000c, 0x4085: 0x000c, + 0x4086: 0x000c, 0x4087: 0x000c, 0x4088: 0x000c, 0x4089: 0x000c, 0x408a: 0x000c, 0x408b: 0x000c, + 0x408c: 0x000c, 0x408d: 0x000c, 0x408e: 0x000c, 0x408f: 0x000c, 0x4090: 0x000c, 0x4091: 0x000c, + 0x4092: 0x000c, 0x4093: 0x000c, 0x4094: 0x000c, 0x4095: 0x000c, 0x4096: 0x000c, 0x4097: 0x000c, + 0x4098: 0x000c, 0x4099: 0x000c, 0x409a: 0x000c, 0x409b: 0x000c, 0x409c: 0x000c, 0x409d: 0x000c, + 0x409e: 0x000c, 0x409f: 0x000c, 0x40a0: 0x000c, 0x40a1: 0x000c, 0x40a2: 0x000c, 0x40a3: 0x000c, + 0x40a4: 0x000c, 0x40a5: 0x000c, 0x40a6: 0x000c, 0x40a7: 0x000c, 0x40a8: 0x000c, 0x40a9: 0x000c, + 0x40aa: 0x000c, 0x40ab: 0x000c, 0x40ac: 0x000c, 0x40ad: 0x000c, 0x40ae: 0x000c, 0x40af: 0x000c, + 0x40b0: 0x000b, 0x40b1: 0x000b, 0x40b2: 0x000b, 0x40b3: 0x000b, 0x40b4: 0x000b, 0x40b5: 0x000b, + 0x40b6: 0x000b, 0x40b7: 0x000b, 0x40b8: 0x000b, 0x40b9: 0x000b, 0x40ba: 0x000b, 0x40bb: 0x000b, + 0x40bc: 0x000b, 0x40bd: 0x000b, 0x40be: 0x000b, 0x40bf: 0x000b, +} + +// bidiIndex: 26 blocks, 1664 entries, 3328 bytes +// Block 0 is the zero block. +var bidiIndex = [1664]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x13, 0xf1: 0x14, 0xf2: 0x14, 0xf3: 0x16, 0xf4: 0x17, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x136: 0x28, 0x137: 0x29, + 0x138: 0x2a, 0x139: 0x2b, 0x13a: 0x2c, 0x13b: 0x2d, 0x13c: 0x2e, 0x13d: 0x2f, 0x13e: 0x30, 0x13f: 0x31, + // Block 0x5, offset 0x140 + 0x140: 0x32, 0x141: 0x33, 0x142: 0x34, + 0x14d: 0x35, 0x14e: 0x36, + 0x150: 0x37, + 0x15a: 0x38, 0x15c: 0x39, 0x15d: 0x3a, 0x15e: 0x3b, 0x15f: 0x3c, + 0x160: 0x3d, 0x162: 0x3e, 0x164: 0x3f, 0x165: 0x40, 0x167: 0x41, + 0x168: 0x42, 0x169: 0x43, 0x16a: 0x44, 0x16b: 0x45, 0x16c: 0x46, 0x16d: 0x47, 0x16e: 0x48, 0x16f: 0x49, + 0x170: 0x4a, 0x173: 0x4b, 0x177: 0x05, + 0x17e: 0x4c, 0x17f: 0x4d, + // Block 0x6, offset 0x180 + 0x180: 0x4e, 0x181: 0x4f, 0x182: 0x50, 0x183: 0x51, 0x184: 0x52, 0x185: 0x53, 0x186: 0x54, 0x187: 0x55, + 0x188: 0x56, 0x189: 0x55, 0x18a: 0x55, 0x18b: 0x55, 0x18c: 0x57, 0x18d: 0x58, 0x18e: 0x59, 0x18f: 0x55, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x55, 0x195: 0x55, 0x196: 0x55, 0x197: 0x55, + 0x198: 0x55, 0x199: 0x55, 0x19a: 0x5e, 0x19b: 0x55, 0x19c: 0x55, 0x19d: 0x5f, 0x19e: 0x55, 0x19f: 0x60, + 0x1a4: 0x55, 0x1a5: 0x55, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x55, 0x1a9: 0x55, 0x1aa: 0x55, 0x1ab: 0x55, 0x1ac: 0x55, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x55, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x55, 0x1bd: 0x55, 0x1be: 0x55, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x55, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26d: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x8f, 0x2b6: 0x0e, 0x2b7: 0x90, + 0x2b8: 0x91, 0x2b9: 0x92, 0x2ba: 0x0e, 0x2bb: 0x93, 0x2bc: 0x94, 0x2bd: 0x95, 0x2bf: 0x96, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x97, 0x2c5: 0x55, 0x2c6: 0x98, 0x2c7: 0x99, + 0x2cb: 0x9a, 0x2cd: 0x9b, + 0x2e0: 0x9c, 0x2e1: 0x9c, 0x2e2: 0x9c, 0x2e3: 0x9c, 0x2e4: 0x9d, 0x2e5: 0x9c, 0x2e6: 0x9c, 0x2e7: 0x9c, + 0x2e8: 0x9e, 0x2e9: 0x9c, 0x2ea: 0x9c, 0x2eb: 0x9f, 0x2ec: 0xa0, 0x2ed: 0x9c, 0x2ee: 0x9c, 0x2ef: 0x9c, + 0x2f0: 0x9c, 0x2f1: 0x9c, 0x2f2: 0x9c, 0x2f3: 0x9c, 0x2f4: 0xa1, 0x2f5: 0x9c, 0x2f6: 0x9c, 0x2f7: 0x9c, + 0x2f8: 0x9c, 0x2f9: 0xa2, 0x2fa: 0xa3, 0x2fb: 0xa4, 0x2fc: 0xa5, 0x2fd: 0xa6, 0x2fe: 0xa7, 0x2ff: 0x9c, + // Block 0xc, offset 0x300 + 0x300: 0xa8, 0x301: 0xa9, 0x302: 0xaa, 0x303: 0x21, 0x304: 0xab, 0x305: 0xac, 0x306: 0xad, 0x307: 0xae, + 0x308: 0xaf, 0x309: 0x28, 0x30b: 0xb0, 0x30c: 0x26, 0x30d: 0xb1, + 0x310: 0xb2, 0x311: 0xb3, 0x312: 0xb4, 0x313: 0xb5, 0x316: 0xb6, 0x317: 0xb7, + 0x318: 0xb8, 0x319: 0xb9, 0x31a: 0xba, 0x31c: 0xbb, + 0x320: 0xbc, 0x324: 0xbd, 0x325: 0xbe, 0x327: 0xbf, + 0x328: 0xc0, 0x329: 0xc1, 0x32a: 0xc2, + 0x330: 0xc3, 0x332: 0xc4, 0x334: 0xc5, 0x335: 0xc6, 0x336: 0xc7, + 0x33b: 0xc8, 0x33c: 0xc9, 0x33d: 0xca, 0x33f: 0xcb, + // Block 0xd, offset 0x340 + 0x351: 0xcc, + // Block 0xe, offset 0x380 + 0x3ab: 0xcd, 0x3ac: 0xce, + 0x3bd: 0xcf, 0x3be: 0xd0, 0x3bf: 0xd1, + // Block 0xf, offset 0x3c0 + 0x3f2: 0xd2, + // Block 0x10, offset 0x400 + 0x43c: 0xd3, 0x43d: 0xd4, + // Block 0x11, offset 0x440 + 0x445: 0xd5, 0x446: 0xd6, 0x447: 0xd7, + 0x448: 0x55, 0x449: 0xd8, 0x44c: 0x55, 0x44d: 0xd9, + 0x45b: 0xda, 0x45c: 0xdb, 0x45d: 0xdc, 0x45e: 0xdd, 0x45f: 0xde, + 0x468: 0xdf, 0x469: 0xe0, 0x46a: 0xe1, + // Block 0x12, offset 0x480 + 0x480: 0xe2, 0x482: 0xcf, 0x484: 0xce, + 0x48a: 0xe3, 0x48b: 0xe4, + 0x493: 0xe5, + 0x4a0: 0x9c, 0x4a1: 0x9c, 0x4a2: 0x9c, 0x4a3: 0xe6, 0x4a4: 0x9c, 0x4a5: 0xe7, 0x4a6: 0x9c, 0x4a7: 0x9c, + 0x4a8: 0x9c, 0x4a9: 0x9c, 0x4aa: 0x9c, 0x4ab: 0x9c, 0x4ac: 0x9c, 0x4ad: 0x9c, 0x4ae: 0x9c, 0x4af: 0x9c, + 0x4b0: 0x9c, 0x4b1: 0xe8, 0x4b2: 0xe9, 0x4b3: 0x9c, 0x4b4: 0xea, 0x4b5: 0x9c, 0x4b6: 0x9c, 0x4b7: 0x9c, + 0x4b8: 0x0e, 0x4b9: 0x0e, 0x4ba: 0x0e, 0x4bb: 0xeb, 0x4bc: 0x9c, 0x4bd: 0x9c, 0x4be: 0x9c, 0x4bf: 0x9c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xec, 0x4c1: 0x55, 0x4c2: 0xed, 0x4c3: 0xee, 0x4c4: 0xef, 0x4c5: 0xf0, 0x4c6: 0xf1, + 0x4c9: 0xf2, 0x4cc: 0x55, 0x4cd: 0x55, 0x4ce: 0x55, 0x4cf: 0x55, + 0x4d0: 0x55, 0x4d1: 0x55, 0x4d2: 0x55, 0x4d3: 0x55, 0x4d4: 0x55, 0x4d5: 0x55, 0x4d6: 0x55, 0x4d7: 0x55, + 0x4d8: 0x55, 0x4d9: 0x55, 0x4da: 0x55, 0x4db: 0xf3, 0x4dc: 0x55, 0x4dd: 0xf4, 0x4de: 0x55, 0x4df: 0xf5, + 0x4e0: 0xf6, 0x4e1: 0xf7, 0x4e2: 0xf8, 0x4e4: 0x55, 0x4e5: 0x55, 0x4e6: 0x55, 0x4e7: 0x55, + 0x4e8: 0x55, 0x4e9: 0xf9, 0x4ea: 0xfa, 0x4eb: 0xfb, 0x4ec: 0x55, 0x4ed: 0x55, 0x4ee: 0xfc, 0x4ef: 0xfd, + 0x4ff: 0xfe, + // Block 0x14, offset 0x500 + 0x53f: 0xfe, + // Block 0x15, offset 0x540 + 0x550: 0x09, 0x551: 0x0a, 0x553: 0x0b, 0x556: 0x0c, + 0x55b: 0x0d, 0x55c: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, + 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x58f: 0x12, + 0x59f: 0x12, + 0x5af: 0x12, + 0x5bf: 0x12, + // Block 0x17, offset 0x5c0 + 0x5c0: 0xff, 0x5c1: 0xff, 0x5c2: 0xff, 0x5c3: 0xff, 0x5c4: 0x05, 0x5c5: 0x05, 0x5c6: 0x05, 0x5c7: 0x100, + 0x5c8: 0xff, 0x5c9: 0xff, 0x5ca: 0xff, 0x5cb: 0xff, 0x5cc: 0xff, 0x5cd: 0xff, 0x5ce: 0xff, 0x5cf: 0xff, + 0x5d0: 0xff, 0x5d1: 0xff, 0x5d2: 0xff, 0x5d3: 0xff, 0x5d4: 0xff, 0x5d5: 0xff, 0x5d6: 0xff, 0x5d7: 0xff, + 0x5d8: 0xff, 0x5d9: 0xff, 0x5da: 0xff, 0x5db: 0xff, 0x5dc: 0xff, 0x5dd: 0xff, 0x5de: 0xff, 0x5df: 0xff, + 0x5e0: 0xff, 0x5e1: 0xff, 0x5e2: 0xff, 0x5e3: 0xff, 0x5e4: 0xff, 0x5e5: 0xff, 0x5e6: 0xff, 0x5e7: 0xff, + 0x5e8: 0xff, 0x5e9: 0xff, 0x5ea: 0xff, 0x5eb: 0xff, 0x5ec: 0xff, 0x5ed: 0xff, 0x5ee: 0xff, 0x5ef: 0xff, + 0x5f0: 0xff, 0x5f1: 0xff, 0x5f2: 0xff, 0x5f3: 0xff, 0x5f4: 0xff, 0x5f5: 0xff, 0x5f6: 0xff, 0x5f7: 0xff, + 0x5f8: 0xff, 0x5f9: 0xff, 0x5fa: 0xff, 0x5fb: 0xff, 0x5fc: 0xff, 0x5fd: 0xff, 0x5fe: 0xff, 0x5ff: 0xff, + // Block 0x18, offset 0x600 + 0x60f: 0x12, + 0x61f: 0x12, + 0x620: 0x15, + 0x62f: 0x12, + 0x63f: 0x12, + // Block 0x19, offset 0x640 + 0x64f: 0x12, +} + +// Total table size 19960 bytes (19KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 9115ef257..f65785e8a 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 000000000..e1858b879 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7908 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/converter.go b/vendor/k8s.io/apimachinery/pkg/runtime/converter.go index 90bf487e3..62eb27afc 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/converter.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/converter.go @@ -231,7 +231,7 @@ func (c *fromUnstructuredContext) pushKey(key string) { } -// FromUnstructuredWIthValidation converts an object from map[string]interface{} representation into a concrete type. +// FromUnstructuredWithValidation converts an object from map[string]interface{} representation into a concrete type. // It uses encoding/json/Unmarshaler if object implements it or reflection if not. // It takes a validationDirective that indicates how to behave when it encounters unknown fields. func (c *unstructuredConverter) FromUnstructuredWithValidation(u map[string]interface{}, obj interface{}, returnUnknownFields bool) error { @@ -465,7 +465,7 @@ func sliceFromUnstructured(sv, dv reflect.Value, ctx *fromUnstructuredContext) e } dv.SetBytes(data) } else { - dv.Set(reflect.Zero(dt)) + dv.Set(reflect.MakeSlice(dt, 0, 0)) } return nil } diff --git a/vendor/k8s.io/apimachinery/pkg/util/wait/loop.go b/vendor/k8s.io/apimachinery/pkg/util/wait/loop.go index 51864d70f..0dd13c626 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/wait/loop.go +++ b/vendor/k8s.io/apimachinery/pkg/util/wait/loop.go @@ -27,9 +27,11 @@ import ( // the provided timer until the provided context is cancelled, the condition returns // true, or the condition returns an error. If sliding is true, the period is computed // after condition runs. If it is false then period includes the runtime for condition. -// If immediate is false the first delay happens before any call to condition. The -// returned error is the error returned by the last condition or the context error if -// the context was terminated. +// If immediate is false the first delay happens before any call to condition, if +// immediate is true the condition will be invoked before waiting and guarantees that +// the condition is invoked at least once, regardless of whether the context has been +// cancelled. The returned error is the error returned by the last condition or the +// context error if the context was terminated. // // This is the common loop construct for all polling in the wait package. func loopConditionUntilContext(ctx context.Context, t Timer, immediate, sliding bool, condition ConditionWithContextFunc) error { @@ -38,8 +40,17 @@ func loopConditionUntilContext(ctx context.Context, t Timer, immediate, sliding var timeCh <-chan time.Time doneCh := ctx.Done() + // if immediate is true the condition is + // guaranteed to be executed at least once, // if we haven't requested immediate execution, delay once - if !immediate { + if immediate { + if ok, err := func() (bool, error) { + defer runtime.HandleCrash() + return condition(ctx) + }(); err != nil || ok { + return err + } + } else { timeCh = t.C() select { case <-doneCh: diff --git a/vendor/k8s.io/utils/pointer/pointer.go b/vendor/k8s.io/utils/pointer/pointer.go index b8103223a..b673a6425 100644 --- a/vendor/k8s.io/utils/pointer/pointer.go +++ b/vendor/k8s.io/utils/pointer/pointer.go @@ -14,12 +14,15 @@ See the License for the specific language governing permissions and limitations under the License. */ +// Deprecated: Use functions in k8s.io/utils/ptr instead: ptr.To to obtain +// a pointer, ptr.Deref to dereference a pointer, ptr.Equal to compare +// dereferenced pointers. package pointer import ( - "fmt" - "reflect" "time" + + "k8s.io/utils/ptr" ) // AllPtrFieldsNil tests whether all pointer fields in a struct are nil. This is useful when, @@ -28,383 +31,219 @@ import ( // // This function is only valid for structs and pointers to structs. Any other // type will cause a panic. Passing a typed nil pointer will return true. -func AllPtrFieldsNil(obj interface{}) bool { - v := reflect.ValueOf(obj) - if !v.IsValid() { - panic(fmt.Sprintf("reflect.ValueOf() produced a non-valid Value for %#v", obj)) - } - if v.Kind() == reflect.Ptr { - if v.IsNil() { - return true - } - v = v.Elem() - } - for i := 0; i < v.NumField(); i++ { - if v.Field(i).Kind() == reflect.Ptr && !v.Field(i).IsNil() { - return false - } - } - return true -} - -// Int returns a pointer to an int -func Int(i int) *int { - return &i -} +// +// Deprecated: Use ptr.AllPtrFieldsNil instead. +var AllPtrFieldsNil = ptr.AllPtrFieldsNil + +// Int returns a pointer to an int. +var Int = ptr.To[int] // IntPtr is a function variable referring to Int. // -// Deprecated: Use Int instead. +// Deprecated: Use ptr.To instead. var IntPtr = Int // for back-compat // IntDeref dereferences the int ptr and returns it if not nil, or else // returns def. -func IntDeref(ptr *int, def int) int { - if ptr != nil { - return *ptr - } - return def -} +var IntDeref = ptr.Deref[int] // IntPtrDerefOr is a function variable referring to IntDeref. // -// Deprecated: Use IntDeref instead. +// Deprecated: Use ptr.Deref instead. var IntPtrDerefOr = IntDeref // for back-compat // Int32 returns a pointer to an int32. -func Int32(i int32) *int32 { - return &i -} +var Int32 = ptr.To[int32] // Int32Ptr is a function variable referring to Int32. // -// Deprecated: Use Int32 instead. +// Deprecated: Use ptr.To instead. var Int32Ptr = Int32 // for back-compat // Int32Deref dereferences the int32 ptr and returns it if not nil, or else // returns def. -func Int32Deref(ptr *int32, def int32) int32 { - if ptr != nil { - return *ptr - } - return def -} +var Int32Deref = ptr.Deref[int32] // Int32PtrDerefOr is a function variable referring to Int32Deref. // -// Deprecated: Use Int32Deref instead. +// Deprecated: Use ptr.Deref instead. var Int32PtrDerefOr = Int32Deref // for back-compat // Int32Equal returns true if both arguments are nil or both arguments // dereference to the same value. -func Int32Equal(a, b *int32) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var Int32Equal = ptr.Equal[int32] // Uint returns a pointer to an uint -func Uint(i uint) *uint { - return &i -} +var Uint = ptr.To[uint] // UintPtr is a function variable referring to Uint. // -// Deprecated: Use Uint instead. +// Deprecated: Use ptr.To instead. var UintPtr = Uint // for back-compat // UintDeref dereferences the uint ptr and returns it if not nil, or else // returns def. -func UintDeref(ptr *uint, def uint) uint { - if ptr != nil { - return *ptr - } - return def -} +var UintDeref = ptr.Deref[uint] // UintPtrDerefOr is a function variable referring to UintDeref. // -// Deprecated: Use UintDeref instead. +// Deprecated: Use ptr.Deref instead. var UintPtrDerefOr = UintDeref // for back-compat // Uint32 returns a pointer to an uint32. -func Uint32(i uint32) *uint32 { - return &i -} +var Uint32 = ptr.To[uint32] // Uint32Ptr is a function variable referring to Uint32. // -// Deprecated: Use Uint32 instead. +// Deprecated: Use ptr.To instead. var Uint32Ptr = Uint32 // for back-compat // Uint32Deref dereferences the uint32 ptr and returns it if not nil, or else // returns def. -func Uint32Deref(ptr *uint32, def uint32) uint32 { - if ptr != nil { - return *ptr - } - return def -} +var Uint32Deref = ptr.Deref[uint32] // Uint32PtrDerefOr is a function variable referring to Uint32Deref. // -// Deprecated: Use Uint32Deref instead. +// Deprecated: Use ptr.Deref instead. var Uint32PtrDerefOr = Uint32Deref // for back-compat // Uint32Equal returns true if both arguments are nil or both arguments // dereference to the same value. -func Uint32Equal(a, b *uint32) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var Uint32Equal = ptr.Equal[uint32] // Int64 returns a pointer to an int64. -func Int64(i int64) *int64 { - return &i -} +var Int64 = ptr.To[int64] // Int64Ptr is a function variable referring to Int64. // -// Deprecated: Use Int64 instead. +// Deprecated: Use ptr.To instead. var Int64Ptr = Int64 // for back-compat // Int64Deref dereferences the int64 ptr and returns it if not nil, or else // returns def. -func Int64Deref(ptr *int64, def int64) int64 { - if ptr != nil { - return *ptr - } - return def -} +var Int64Deref = ptr.Deref[int64] // Int64PtrDerefOr is a function variable referring to Int64Deref. // -// Deprecated: Use Int64Deref instead. +// Deprecated: Use ptr.Deref instead. var Int64PtrDerefOr = Int64Deref // for back-compat // Int64Equal returns true if both arguments are nil or both arguments // dereference to the same value. -func Int64Equal(a, b *int64) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var Int64Equal = ptr.Equal[int64] // Uint64 returns a pointer to an uint64. -func Uint64(i uint64) *uint64 { - return &i -} +var Uint64 = ptr.To[uint64] // Uint64Ptr is a function variable referring to Uint64. // -// Deprecated: Use Uint64 instead. +// Deprecated: Use ptr.To instead. var Uint64Ptr = Uint64 // for back-compat // Uint64Deref dereferences the uint64 ptr and returns it if not nil, or else // returns def. -func Uint64Deref(ptr *uint64, def uint64) uint64 { - if ptr != nil { - return *ptr - } - return def -} +var Uint64Deref = ptr.Deref[uint64] // Uint64PtrDerefOr is a function variable referring to Uint64Deref. // -// Deprecated: Use Uint64Deref instead. +// Deprecated: Use ptr.Deref instead. var Uint64PtrDerefOr = Uint64Deref // for back-compat // Uint64Equal returns true if both arguments are nil or both arguments // dereference to the same value. -func Uint64Equal(a, b *uint64) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var Uint64Equal = ptr.Equal[uint64] // Bool returns a pointer to a bool. -func Bool(b bool) *bool { - return &b -} +var Bool = ptr.To[bool] // BoolPtr is a function variable referring to Bool. // -// Deprecated: Use Bool instead. +// Deprecated: Use ptr.To instead. var BoolPtr = Bool // for back-compat // BoolDeref dereferences the bool ptr and returns it if not nil, or else // returns def. -func BoolDeref(ptr *bool, def bool) bool { - if ptr != nil { - return *ptr - } - return def -} +var BoolDeref = ptr.Deref[bool] // BoolPtrDerefOr is a function variable referring to BoolDeref. // -// Deprecated: Use BoolDeref instead. +// Deprecated: Use ptr.Deref instead. var BoolPtrDerefOr = BoolDeref // for back-compat // BoolEqual returns true if both arguments are nil or both arguments // dereference to the same value. -func BoolEqual(a, b *bool) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var BoolEqual = ptr.Equal[bool] // String returns a pointer to a string. -func String(s string) *string { - return &s -} +var String = ptr.To[string] // StringPtr is a function variable referring to String. // -// Deprecated: Use String instead. +// Deprecated: Use ptr.To instead. var StringPtr = String // for back-compat // StringDeref dereferences the string ptr and returns it if not nil, or else // returns def. -func StringDeref(ptr *string, def string) string { - if ptr != nil { - return *ptr - } - return def -} +var StringDeref = ptr.Deref[string] // StringPtrDerefOr is a function variable referring to StringDeref. // -// Deprecated: Use StringDeref instead. +// Deprecated: Use ptr.Deref instead. var StringPtrDerefOr = StringDeref // for back-compat // StringEqual returns true if both arguments are nil or both arguments // dereference to the same value. -func StringEqual(a, b *string) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var StringEqual = ptr.Equal[string] // Float32 returns a pointer to a float32. -func Float32(i float32) *float32 { - return &i -} +var Float32 = ptr.To[float32] // Float32Ptr is a function variable referring to Float32. // -// Deprecated: Use Float32 instead. +// Deprecated: Use ptr.To instead. var Float32Ptr = Float32 // Float32Deref dereferences the float32 ptr and returns it if not nil, or else // returns def. -func Float32Deref(ptr *float32, def float32) float32 { - if ptr != nil { - return *ptr - } - return def -} +var Float32Deref = ptr.Deref[float32] // Float32PtrDerefOr is a function variable referring to Float32Deref. // -// Deprecated: Use Float32Deref instead. +// Deprecated: Use ptr.Deref instead. var Float32PtrDerefOr = Float32Deref // for back-compat // Float32Equal returns true if both arguments are nil or both arguments // dereference to the same value. -func Float32Equal(a, b *float32) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var Float32Equal = ptr.Equal[float32] // Float64 returns a pointer to a float64. -func Float64(i float64) *float64 { - return &i -} +var Float64 = ptr.To[float64] // Float64Ptr is a function variable referring to Float64. // -// Deprecated: Use Float64 instead. +// Deprecated: Use ptr.To instead. var Float64Ptr = Float64 // Float64Deref dereferences the float64 ptr and returns it if not nil, or else // returns def. -func Float64Deref(ptr *float64, def float64) float64 { - if ptr != nil { - return *ptr - } - return def -} +var Float64Deref = ptr.Deref[float64] // Float64PtrDerefOr is a function variable referring to Float64Deref. // -// Deprecated: Use Float64Deref instead. +// Deprecated: Use ptr.Deref instead. var Float64PtrDerefOr = Float64Deref // for back-compat // Float64Equal returns true if both arguments are nil or both arguments // dereference to the same value. -func Float64Equal(a, b *float64) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var Float64Equal = ptr.Equal[float64] // Duration returns a pointer to a time.Duration. -func Duration(d time.Duration) *time.Duration { - return &d -} +var Duration = ptr.To[time.Duration] // DurationDeref dereferences the time.Duration ptr and returns it if not nil, or else // returns def. -func DurationDeref(ptr *time.Duration, def time.Duration) time.Duration { - if ptr != nil { - return *ptr - } - return def -} +var DurationDeref = ptr.Deref[time.Duration] // DurationEqual returns true if both arguments are nil or both arguments // dereference to the same value. -func DurationEqual(a, b *time.Duration) bool { - if (a == nil) != (b == nil) { - return false - } - if a == nil { - return true - } - return *a == *b -} +var DurationEqual = ptr.Equal[time.Duration] diff --git a/vendor/k8s.io/utils/ptr/OWNERS b/vendor/k8s.io/utils/ptr/OWNERS new file mode 100644 index 000000000..0d6392752 --- /dev/null +++ b/vendor/k8s.io/utils/ptr/OWNERS @@ -0,0 +1,10 @@ +# See the OWNERS docs at https://go.k8s.io/owners + +approvers: +- apelisse +- stewart-yu +- thockin +reviewers: +- apelisse +- stewart-yu +- thockin diff --git a/vendor/k8s.io/utils/ptr/README.md b/vendor/k8s.io/utils/ptr/README.md new file mode 100644 index 000000000..2ca8073dc --- /dev/null +++ b/vendor/k8s.io/utils/ptr/README.md @@ -0,0 +1,3 @@ +# Pointer + +This package provides some functions for pointer-based operations. diff --git a/vendor/k8s.io/utils/ptr/ptr.go b/vendor/k8s.io/utils/ptr/ptr.go new file mode 100644 index 000000000..659ed3b9e --- /dev/null +++ b/vendor/k8s.io/utils/ptr/ptr.go @@ -0,0 +1,73 @@ +/* +Copyright 2023 The Kubernetes Authors. + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package ptr + +import ( + "fmt" + "reflect" +) + +// AllPtrFieldsNil tests whether all pointer fields in a struct are nil. This is useful when, +// for example, an API struct is handled by plugins which need to distinguish +// "no plugin accepted this spec" from "this spec is empty". +// +// This function is only valid for structs and pointers to structs. Any other +// type will cause a panic. Passing a typed nil pointer will return true. +func AllPtrFieldsNil(obj interface{}) bool { + v := reflect.ValueOf(obj) + if !v.IsValid() { + panic(fmt.Sprintf("reflect.ValueOf() produced a non-valid Value for %#v", obj)) + } + if v.Kind() == reflect.Ptr { + if v.IsNil() { + return true + } + v = v.Elem() + } + for i := 0; i < v.NumField(); i++ { + if v.Field(i).Kind() == reflect.Ptr && !v.Field(i).IsNil() { + return false + } + } + return true +} + +// To returns a pointer to the given value. +func To[T any](v T) *T { + return &v +} + +// Deref dereferences ptr and returns the value it points to if no nil, or else +// returns def. +func Deref[T any](ptr *T, def T) T { + if ptr != nil { + return *ptr + } + return def +} + +// Equal returns true if both arguments are nil or both arguments +// dereference to the same value. +func Equal[T comparable](a, b *T) bool { + if (a == nil) != (b == nil) { + return false + } + if a == nil { + return true + } + return *a == *b +} diff --git a/vendor/modules.txt b/vendor/modules.txt index 05d45c168..f6666262b 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -218,7 +218,7 @@ github.com/onsi/gomega/matchers/support/goraph/edge github.com/onsi/gomega/matchers/support/goraph/node github.com/onsi/gomega/matchers/support/goraph/util github.com/onsi/gomega/types -# github.com/openshift/api v0.0.0-20230524230522-75b5a44dbeeb +# github.com/openshift/api v0.0.0-20230804173756-26b8597c4de2 ## explicit; go 1.20 github.com/openshift/api/config/v1 github.com/openshift/api/config/v1alpha1 @@ -337,7 +337,7 @@ go.uber.org/zap/zapcore # golang.org/x/mod v0.10.0 ## explicit; go 1.17 golang.org/x/mod/semver -# golang.org/x/net v0.10.0 +# golang.org/x/net v0.14.0 ## explicit; go 1.17 golang.org/x/net/context golang.org/x/net/html @@ -360,17 +360,17 @@ golang.org/x/oauth2/google/internal/externalaccount golang.org/x/oauth2/internal golang.org/x/oauth2/jws golang.org/x/oauth2/jwt -# golang.org/x/sys v0.8.0 +# golang.org/x/sys v0.11.0 ## explicit; go 1.17 golang.org/x/sys/execabs golang.org/x/sys/internal/unsafeheader golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/term v0.8.0 +# golang.org/x/term v0.11.0 ## explicit; go 1.17 golang.org/x/term -# golang.org/x/text v0.9.0 +# golang.org/x/text v0.12.0 ## explicit; go 1.17 golang.org/x/text/encoding golang.org/x/text/encoding/charmap @@ -541,7 +541,7 @@ gopkg.in/yaml.v2 # gopkg.in/yaml.v3 v3.0.1 ## explicit gopkg.in/yaml.v3 -# k8s.io/api v0.27.2 +# k8s.io/api v0.27.4 ## explicit; go 1.20 k8s.io/api/admission/v1 k8s.io/api/admission/v1beta1 @@ -607,7 +607,7 @@ k8s.io/apiextensions-apiserver/pkg/client/clientset/clientset k8s.io/apiextensions-apiserver/pkg/client/clientset/clientset/scheme k8s.io/apiextensions-apiserver/pkg/client/clientset/clientset/typed/apiextensions/v1 k8s.io/apiextensions-apiserver/pkg/client/clientset/clientset/typed/apiextensions/v1beta1 -# k8s.io/apimachinery v0.27.2 +# k8s.io/apimachinery v0.27.4 ## explicit; go 1.20 k8s.io/apimachinery/pkg/api/equality k8s.io/apimachinery/pkg/api/errors @@ -865,7 +865,7 @@ k8s.io/kubectl/pkg/util/openapi k8s.io/kubectl/pkg/util/templates k8s.io/kubectl/pkg/util/term k8s.io/kubectl/pkg/validation -# k8s.io/utils v0.0.0-20230505201702-9f6742963106 +# k8s.io/utils v0.0.0-20230726121419-3b25d923346b ## explicit; go 1.18 k8s.io/utils/buffer k8s.io/utils/clock @@ -875,6 +875,7 @@ k8s.io/utils/integer k8s.io/utils/internal/third_party/forked/golang/net k8s.io/utils/net k8s.io/utils/pointer +k8s.io/utils/ptr k8s.io/utils/strings/slices k8s.io/utils/trace # sigs.k8s.io/controller-runtime v0.15.0 @@ -1039,7 +1040,7 @@ sigs.k8s.io/kustomize/kyaml/yaml/merge2 sigs.k8s.io/kustomize/kyaml/yaml/merge3 sigs.k8s.io/kustomize/kyaml/yaml/schema sigs.k8s.io/kustomize/kyaml/yaml/walk -# sigs.k8s.io/structured-merge-diff/v4 v4.2.3 +# sigs.k8s.io/structured-merge-diff/v4 v4.3.0 ## explicit; go 1.13 sigs.k8s.io/structured-merge-diff/v4/fieldpath sigs.k8s.io/structured-merge-diff/v4/merge diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/conflict.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/conflict.go index 75a492d8e..f1aa25860 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/conflict.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/conflict.go @@ -112,7 +112,7 @@ func ConflictsFromManagers(sets fieldpath.ManagedFields) Conflicts { set.Set().Iterate(func(p fieldpath.Path) { conflicts = append(conflicts, Conflict{ Manager: manager, - Path: p, + Path: p.Copy(), }) }) } diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/update.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/update.go index 1b23dcbd5..e1540841d 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/update.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/merge/update.go @@ -18,6 +18,7 @@ import ( "sigs.k8s.io/structured-merge-diff/v4/fieldpath" "sigs.k8s.io/structured-merge-diff/v4/typed" + "sigs.k8s.io/structured-merge-diff/v4/value" ) // Converter is an interface to the conversion logic. The converter @@ -27,17 +28,50 @@ type Converter interface { IsMissingVersionError(error) bool } +// UpdateBuilder allows you to create a new Updater by exposing all of +// the options and setting them once. +type UpdaterBuilder struct { + Converter Converter + IgnoredFields map[fieldpath.APIVersion]*fieldpath.Set + + EnableUnions bool + + // Stop comparing the new object with old object after applying. + // This was initially used to avoid spurious etcd update, but + // since that's vastly inefficient, we've come-up with a better + // way of doing that. Create this flag to stop it. + // Comparing has become more expensive too now that we're not using + // `Compare` but `value.Equals` so this gives an option to avoid it. + ReturnInputOnNoop bool +} + +func (u *UpdaterBuilder) BuildUpdater() *Updater { + return &Updater{ + Converter: u.Converter, + IgnoredFields: u.IgnoredFields, + enableUnions: u.EnableUnions, + returnInputOnNoop: u.ReturnInputOnNoop, + } +} + // Updater is the object used to compute updated FieldSets and also // merge the object on Apply. type Updater struct { - Converter Converter + // Deprecated: This will eventually become private. + Converter Converter + + // Deprecated: This will eventually become private. IgnoredFields map[fieldpath.APIVersion]*fieldpath.Set enableUnions bool + + returnInputOnNoop bool } // EnableUnionFeature turns on union handling. It is disabled by default until the // feature is complete. +// +// Deprecated: Use the builder instead. func (s *Updater) EnableUnionFeature() { s.enableUnions = true } @@ -157,8 +191,7 @@ func (s *Updater) Update(liveObject, newObject *typed.TypedValue, version fieldp // Apply should be called when Apply is run, given the current object as // well as the configuration that is applied. This will merge the object -// and return it. If the object hasn't changed, nil is returned (the -// managers can still have changed though). +// and return it. func (s *Updater) Apply(liveObject, configObject *typed.TypedValue, version fieldpath.APIVersion, managers fieldpath.ManagedFields, manager string, force bool) (*typed.TypedValue, fieldpath.ManagedFields, error) { var err error managers, err = s.reconcileManagedFieldsWithSchemaChanges(liveObject, managers) @@ -200,11 +233,11 @@ func (s *Updater) Apply(liveObject, configObject *typed.TypedValue, version fiel if err != nil { return nil, fieldpath.ManagedFields{}, fmt.Errorf("failed to prune fields: %v", err) } - managers, compare, err := s.update(liveObject, newObject, version, managers, manager, force) + managers, _, err = s.update(liveObject, newObject, version, managers, manager, force) if err != nil { return nil, fieldpath.ManagedFields{}, err } - if compare.IsSame() { + if !s.returnInputOnNoop && value.EqualsUsing(value.NewFreelistAllocator(), liveObject.AsValue(), newObject.AsValue()) { newObject = nil } return newObject, managers, nil @@ -218,7 +251,8 @@ func (s *Updater) prune(merged *typed.TypedValue, managers fieldpath.ManagedFiel if lastSet == nil || lastSet.Set().Empty() { return merged, nil } - convertedMerged, err := s.Converter.Convert(merged, lastSet.APIVersion()) + version := lastSet.APIVersion() + convertedMerged, err := s.Converter.Convert(merged, version) if err != nil { if s.Converter.IsMissingVersionError(err) { return merged, nil @@ -228,7 +262,7 @@ func (s *Updater) prune(merged *typed.TypedValue, managers fieldpath.ManagedFiel sc, tr := convertedMerged.Schema(), convertedMerged.TypeRef() pruned := convertedMerged.RemoveItems(lastSet.Set().EnsureNamedFieldsAreMembers(sc, tr)) - pruned, err = s.addBackOwnedItems(convertedMerged, pruned, managers, applyingManager) + pruned, err = s.addBackOwnedItems(convertedMerged, pruned, version, managers, applyingManager) if err != nil { return nil, fmt.Errorf("failed add back owned items: %v", err) } @@ -241,7 +275,7 @@ func (s *Updater) prune(merged *typed.TypedValue, managers fieldpath.ManagedFiel // addBackOwnedItems adds back any fields, list and map items that were removed by prune, // but other appliers or updaters (or the current applier's new config) claim to own. -func (s *Updater) addBackOwnedItems(merged, pruned *typed.TypedValue, managedFields fieldpath.ManagedFields, applyingManager string) (*typed.TypedValue, error) { +func (s *Updater) addBackOwnedItems(merged, pruned *typed.TypedValue, prunedVersion fieldpath.APIVersion, managedFields fieldpath.ManagedFields, applyingManager string) (*typed.TypedValue, error) { var err error managedAtVersion := map[fieldpath.APIVersion]*fieldpath.Set{} for _, managerSet := range managedFields { @@ -252,7 +286,6 @@ func (s *Updater) addBackOwnedItems(merged, pruned *typed.TypedValue, managedFie } // Add back owned items at pruned version first to avoid conversion failure // caused by pruned fields which are required for conversion. - prunedVersion := fieldpath.APIVersion(*pruned.TypeRef().NamedType) if managed, ok := managedAtVersion[prunedVersion]; ok { merged, pruned, err = s.addBackOwnedItemsForVersion(merged, pruned, prunedVersion, managed) if err != nil { diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/elements.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/elements.go index 7e5dc7582..5d3707a5b 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/elements.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/elements.go @@ -73,7 +73,7 @@ type Atom struct { } // Scalar (AKA "primitive") represents a type which has a single value which is -// either numeric, string, or boolean. +// either numeric, string, or boolean, or untyped for any of them. // // TODO: split numeric into float/int? Something even more fine-grained? type Scalar string @@ -82,6 +82,7 @@ const ( Numeric = Scalar("numeric") String = Scalar("string") Boolean = Scalar("boolean") + Untyped = Scalar("untyped") ) // ElementRelationship is an enum of the different possible relationships diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/schemaschema.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/schemaschema.go index 7d64d1308..e4c5caa2a 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/schemaschema.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/schema/schemaschema.go @@ -110,7 +110,7 @@ var SchemaSchemaYAML = `types: scalar: string - name: deduceInvalidDiscriminator type: - scalar: bool + scalar: boolean - name: fields type: list: diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/merge.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/merge.go index 913644083..09209ec82 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/merge.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/merge.go @@ -113,11 +113,12 @@ func (w *mergingWalker) doLeaf() { w.rule(w) } -func (w *mergingWalker) doScalar(t *schema.Scalar) (errs ValidationErrors) { - errs = append(errs, validateScalar(t, w.lhs, "lhs: ")...) - errs = append(errs, validateScalar(t, w.rhs, "rhs: ")...) - if len(errs) > 0 { - return errs +func (w *mergingWalker) doScalar(t *schema.Scalar) ValidationErrors { + // Make sure at least one side is a valid scalar. + lerrs := validateScalar(t, w.lhs, "lhs: ") + rerrs := validateScalar(t, w.rhs, "rhs: ") + if len(lerrs) > 0 && len(rerrs) > 0 { + return append(lerrs, rerrs...) } // All scalars are leaf fields. diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/typed.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/typed.go index d63a97fe2..6411bd51a 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/typed.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/typed.go @@ -45,6 +45,10 @@ func AsTyped(v value.Value, s *schema.Schema, typeRef schema.TypeRef) (*TypedVal // conforms to the schema, for cases where that has already been checked or // where you're going to call a method that validates as a side-effect (like // ToFieldSet). +// +// Deprecated: This function was initially created because validation +// was expensive. Now that this has been solved, objects should always +// be created as validated, using `AsTyped`. func AsTypedUnvalidated(v value.Value, s *schema.Schema, typeRef schema.TypeRef) *TypedValue { tv := &TypedValue{ value: v, @@ -125,12 +129,13 @@ func (tv TypedValue) Compare(rhs *TypedValue) (c *Comparison, err error) { Modified: fieldpath.NewSet(), Added: fieldpath.NewSet(), } + a := value.NewFreelistAllocator() _, err = merge(&tv, rhs, func(w *mergingWalker) { if w.lhs == nil { c.Added.Insert(w.path) } else if w.rhs == nil { c.Removed.Insert(w.path) - } else if !value.Equals(w.rhs, w.lhs) { + } else if !value.EqualsUsing(a, w.rhs, w.lhs) { // TODO: Equality is not sufficient for this. // Need to implement equality check on the value type. c.Modified.Insert(w.path) diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/validate.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/validate.go index 378d30219..edddbafa4 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/validate.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/typed/validate.go @@ -102,6 +102,12 @@ func validateScalar(t *schema.Scalar, v value.Value, prefix string) (errs Valida if !v.IsBool() { return errorf("%vexpected boolean, got %v", prefix, v) } + case schema.Untyped: + if !v.IsFloat() && !v.IsInt() && !v.IsString() && !v.IsBool() { + return errorf("%vexpected any scalar, got %v", prefix, v) + } + default: + return errorf("%vunexpected scalar type in schema: %v", prefix, *t) } return nil } diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapreflect.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapreflect.go index dc8b8c720..c38402b99 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapreflect.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapreflect.go @@ -136,7 +136,7 @@ func (r mapReflect) EqualsUsing(a Allocator, m Map) bool { if !ok { return false } - return Equals(vr.mustReuse(lhsVal, entry, nil, nil), value) + return EqualsUsing(a, vr.mustReuse(lhsVal, entry, nil, nil), value) }) } diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapunstructured.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapunstructured.go index d8e208628..c3ae00b18 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapunstructured.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/value/mapunstructured.go @@ -88,12 +88,12 @@ func (m mapUnstructuredInterface) EqualsUsing(a Allocator, other Map) bool { } vv := a.allocValueUnstructured() defer a.Free(vv) - return other.Iterate(func(key string, value Value) bool { + return other.IterateUsing(a, func(key string, value Value) bool { lhsVal, ok := m[key] if !ok { return false } - return Equals(vv.reuse(lhsVal), value) + return EqualsUsing(a, vv.reuse(lhsVal), value) }) } @@ -168,12 +168,12 @@ func (m mapUnstructuredString) EqualsUsing(a Allocator, other Map) bool { } vv := a.allocValueUnstructured() defer a.Free(vv) - return other.Iterate(func(key string, value Value) bool { + return other.IterateUsing(a, func(key string, value Value) bool { lhsVal, ok := m[key] if !ok { return false } - return Equals(vv.reuse(lhsVal), value) + return EqualsUsing(a, vv.reuse(lhsVal), value) }) } diff --git a/vendor/sigs.k8s.io/structured-merge-diff/v4/value/reflectcache.go b/vendor/sigs.k8s.io/structured-merge-diff/v4/value/reflectcache.go index a5a467c0f..f0d58d42c 100644 --- a/vendor/sigs.k8s.io/structured-merge-diff/v4/value/reflectcache.go +++ b/vendor/sigs.k8s.io/structured-merge-diff/v4/value/reflectcache.go @@ -154,7 +154,9 @@ func buildStructCacheEntry(t reflect.Type, infos map[string]*FieldCacheEntry, fi if field.Type.Kind() == reflect.Ptr { e = field.Type.Elem() } - buildStructCacheEntry(e, infos, append(fieldPath, field.Index)) + if e.Kind() == reflect.Struct { + buildStructCacheEntry(e, infos, append(fieldPath, field.Index)) + } continue } info := &FieldCacheEntry{JsonName: jsonName, isOmitEmpty: isOmitempty, fieldPath: append(fieldPath, field.Index), fieldType: field.Type}