From 289fb3c4c01fd3087421835fee535e89ae6284cb Mon Sep 17 00:00:00 2001 From: Nahshon Unna-Tsameret Date: Thu, 9 Nov 2023 11:47:22 +0200 Subject: [PATCH] New rule(s): Wrong Usage of the `MatchError` gomega Matcher The `MatchError` gomega matcher asserts an error value (and if it's not nil). There are four valid formats for using this Matcher: * error value; e.g. `Expect(err).To(MatchError(anotherErr))` * string, to be equal to the output of the `Error()` method; e.g. `Expect(err).To(MatchError("Not Found"))` * A gomega matcher that asserts strings; e.g. `Expect(err).To(MatchError(ContainSubstring("Found")))` * [from v0.29.0] a function that receive a single error parameter and returns a single boolean value. In this format, an additional single string parameter, with the function description, is also required; e.g. `Expect(err).To(MatchError(isNotFound, "is the error is a not found error"))` These four format are checked on runtime, but sometimes it's too late. ginkgolinter performs a static analysis and so it will find these issues on build time. ginkgolinter checks the following: * Is the first parameter is one of the four options above. * That there are no additional parameters passed to the matcher; e.g. `MatchError(isNotFoundFunc, "a valid description" , "not used string")`. In this case, the matcher won't fail on run time, but the additional parameters are not in use and ignored. * If the first parameter is a function with the format of `func(error)bool`, ginkgolinter makes sure that the second parameter exists and its type is string. --- Makefile | 5 +- README.md | 32 +- ginkgo_linter.go | 151 +- ginkgo_linter_test.go | 4 + go.mod | 2 +- go.sum | 1 + gomegahandler/handler.go | 6 +- interfaces/interfaces.go | 76 + testdata/src/a/go.mod | 16 +- testdata/src/a/go.sum | 33 +- testdata/src/a/matcherror/matcherror.go | 161 + .../src/a/matcherror/matcherror.gomega.go | 116 + .../github.com/google/go-cmp/cmp/compare.go | 38 +- .../cmp/{export_unsafe.go => export.go} | 5 - .../google/go-cmp/cmp/export_panic.go | 16 - .../value/{pointer_unsafe.go => pointer.go} | 3 - .../cmp/internal/value/pointer_purego.go | 34 - .../github.com/google/go-cmp/cmp/options.go | 84 +- .../github.com/google/go-cmp/cmp/path.go | 46 +- .../google/go-cmp/cmp/report_reflect.go | 2 +- .../github.com/onsi/ginkgo/v2/CHANGELOG.md | 59 + .../github.com/onsi/ginkgo/v2/README.md | 6 +- .../github.com/onsi/ginkgo/v2/core_dsl.go | 94 +- .../v2/ginkgo/generators/generate_command.go | 5 + .../ginkgo/generators/generate_templates.go | 6 +- .../v2/ginkgo/generators/generators_common.go | 12 + .../onsi/ginkgo/v2/ginkgo/outline/ginkgo.go | 4 +- .../onsi/ginkgo/v2/internal/focus.go | 71 +- .../onsi/ginkgo/v2/internal/global/init.go | 11 + .../onsi/ginkgo/v2/internal/group.go | 5 +- .../onsi/ginkgo/v2/internal/node.go | 10 +- .../onsi/ginkgo/v2/internal/suite.go | 24 + .../onsi/ginkgo/v2/internal/writer.go | 6 +- .../github.com/onsi/ginkgo/v2/types/config.go | 1 + .../github.com/onsi/ginkgo/v2/types/errors.go | 4 +- .../github.com/onsi/ginkgo/v2/types/types.go | 4 +- .../onsi/ginkgo/v2/types/version.go | 2 +- .../github.com/onsi/gomega/CHANGELOG.md | 56 + .../github.com/onsi/gomega/format/format.go | 4 +- .../github.com/onsi/gomega/gomega_dsl.go | 10 +- .../vendor/github.com/onsi/gomega/matchers.go | 39 +- .../onsi/gomega/matchers/be_a_directory.go | 2 +- .../onsi/gomega/matchers/be_a_regular_file.go | 2 +- .../gomega/matchers/be_an_existing_file.go | 4 +- .../gomega/matchers/have_exact_elements.go | 7 +- .../gomega/matchers/have_http_body_matcher.go | 9 +- .../gomega/matchers/match_error_matcher.go | 25 +- .../a/vendor/golang.org/x/net/html/render.go | 28 +- .../a/vendor/golang.org/x/net/html/token.go | 9 +- .../a/vendor/golang.org/x/sys/unix/mkall.sh | 2 +- .../vendor/golang.org/x/sys/unix/mkerrors.sh | 11 +- .../golang.org/x/sys/unix/mmap_nomremap.go | 14 + .../a/vendor/golang.org/x/sys/unix/mremap.go | 53 + .../golang.org/x/sys/unix/ptrace_darwin.go | 6 - .../golang.org/x/sys/unix/ptrace_ios.go | 6 - .../golang.org/x/sys/unix/syscall_aix.go | 17 - .../golang.org/x/sys/unix/syscall_bsd.go | 14 - .../golang.org/x/sys/unix/syscall_darwin.go | 236 +- .../x/sys/unix/syscall_darwin_amd64.go | 1 - .../x/sys/unix/syscall_darwin_arm64.go | 1 - .../x/sys/unix/syscall_dragonfly.go | 198 - .../golang.org/x/sys/unix/syscall_freebsd.go | 192 - .../golang.org/x/sys/unix/syscall_linux.go | 224 +- .../x/sys/unix/syscall_linux_amd64.go | 2 +- .../x/sys/unix/syscall_linux_arm64.go | 2 +- .../x/sys/unix/syscall_linux_loong64.go | 2 +- .../x/sys/unix/syscall_linux_mips64x.go | 2 +- .../x/sys/unix/syscall_linux_riscv64.go | 13 +- .../golang.org/x/sys/unix/syscall_netbsd.go | 272 +- .../golang.org/x/sys/unix/syscall_openbsd.go | 91 +- .../golang.org/x/sys/unix/syscall_solaris.go | 32 - .../golang.org/x/sys/unix/syscall_unix.go | 11 + .../x/sys/unix/syscall_zos_s390x.go | 15 - .../golang.org/x/sys/unix/zerrors_linux.go | 52 +- .../x/sys/unix/zerrors_linux_386.go | 11 + .../x/sys/unix/zerrors_linux_amd64.go | 11 + .../x/sys/unix/zerrors_linux_arm.go | 11 + .../x/sys/unix/zerrors_linux_arm64.go | 13 + .../x/sys/unix/zerrors_linux_loong64.go | 13 + .../x/sys/unix/zerrors_linux_mips.go | 11 + .../x/sys/unix/zerrors_linux_mips64.go | 11 + .../x/sys/unix/zerrors_linux_mips64le.go | 11 + .../x/sys/unix/zerrors_linux_mipsle.go | 11 + .../x/sys/unix/zerrors_linux_ppc.go | 11 + .../x/sys/unix/zerrors_linux_ppc64.go | 11 + .../x/sys/unix/zerrors_linux_ppc64le.go | 11 + .../x/sys/unix/zerrors_linux_riscv64.go | 11 + .../x/sys/unix/zerrors_linux_s390x.go | 11 + .../x/sys/unix/zerrors_linux_sparc64.go | 59 + .../golang.org/x/sys/unix/zsyscall_aix_ppc.go | 22 - .../x/sys/unix/zsyscall_aix_ppc64.go | 22 - .../x/sys/unix/zsyscall_darwin_amd64.go | 40 +- .../x/sys/unix/zsyscall_darwin_amd64.s | 149 - .../x/sys/unix/zsyscall_darwin_arm64.go | 40 +- .../x/sys/unix/zsyscall_darwin_arm64.s | 149 - .../x/sys/unix/zsyscall_dragonfly_amd64.go | 22 - .../x/sys/unix/zsyscall_freebsd_386.go | 22 - .../x/sys/unix/zsyscall_freebsd_amd64.go | 22 - .../x/sys/unix/zsyscall_freebsd_arm.go | 22 - .../x/sys/unix/zsyscall_freebsd_arm64.go | 22 - .../x/sys/unix/zsyscall_freebsd_riscv64.go | 22 - .../x/sys/unix/zsyscall_illumos_amd64.go | 10 +- .../golang.org/x/sys/unix/zsyscall_linux.go | 69 +- .../x/sys/unix/zsyscall_linux_riscv64.go | 16 + .../x/sys/unix/zsyscall_netbsd_386.go | 29 +- .../x/sys/unix/zsyscall_netbsd_amd64.go | 29 +- .../x/sys/unix/zsyscall_netbsd_arm.go | 29 +- .../x/sys/unix/zsyscall_netbsd_arm64.go | 29 +- .../x/sys/unix/zsyscall_openbsd_386.go | 54 +- .../x/sys/unix/zsyscall_openbsd_386.s | 10 + .../x/sys/unix/zsyscall_openbsd_amd64.go | 54 +- .../x/sys/unix/zsyscall_openbsd_amd64.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm.go | 54 +- .../x/sys/unix/zsyscall_openbsd_arm.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm64.go | 54 +- .../x/sys/unix/zsyscall_openbsd_arm64.s | 10 + .../x/sys/unix/zsyscall_openbsd_mips64.go | 54 +- .../x/sys/unix/zsyscall_openbsd_mips64.s | 10 + .../x/sys/unix/zsyscall_openbsd_ppc64.go | 54 +- .../x/sys/unix/zsyscall_openbsd_ppc64.s | 12 + .../x/sys/unix/zsyscall_openbsd_riscv64.go | 54 +- .../x/sys/unix/zsyscall_openbsd_riscv64.s | 10 + .../x/sys/unix/zsyscall_solaris_amd64.go | 256 +- .../x/sys/unix/zsyscall_zos_s390x.go | 11 - .../x/sys/unix/zsysnum_linux_386.go | 1 + .../x/sys/unix/zsysnum_linux_amd64.go | 1 + .../x/sys/unix/zsysnum_linux_arm.go | 1 + .../x/sys/unix/zsysnum_linux_arm64.go | 1 + .../x/sys/unix/zsysnum_linux_loong64.go | 1 + .../x/sys/unix/zsysnum_linux_mips.go | 1 + .../x/sys/unix/zsysnum_linux_mips64.go | 1 + .../x/sys/unix/zsysnum_linux_mips64le.go | 1 + .../x/sys/unix/zsysnum_linux_mipsle.go | 1 + .../x/sys/unix/zsysnum_linux_ppc.go | 1 + .../x/sys/unix/zsysnum_linux_ppc64.go | 1 + .../x/sys/unix/zsysnum_linux_ppc64le.go | 1 + .../x/sys/unix/zsysnum_linux_riscv64.go | 3 + .../x/sys/unix/zsysnum_linux_s390x.go | 2 + .../x/sys/unix/zsysnum_linux_sparc64.go | 1 + .../golang.org/x/sys/unix/ztypes_linux.go | 103 +- .../golang.org/x/sys/unix/ztypes_linux_386.go | 2 + .../x/sys/unix/ztypes_linux_amd64.go | 2 + .../golang.org/x/sys/unix/ztypes_linux_arm.go | 2 + .../x/sys/unix/ztypes_linux_arm64.go | 2 + .../x/sys/unix/ztypes_linux_loong64.go | 2 + .../x/sys/unix/ztypes_linux_mips.go | 2 + .../x/sys/unix/ztypes_linux_mips64.go | 2 + .../x/sys/unix/ztypes_linux_mips64le.go | 2 + .../x/sys/unix/ztypes_linux_mipsle.go | 2 + .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 2 + .../x/sys/unix/ztypes_linux_ppc64.go | 2 + .../x/sys/unix/ztypes_linux_ppc64le.go | 2 + .../x/sys/unix/ztypes_linux_riscv64.go | 29 + .../x/sys/unix/ztypes_linux_s390x.go | 2 + .../x/sys/unix/ztypes_linux_sparc64.go | 2 + .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/tables.go | 4686 +++++++++-------- .../golang.org/x/text/language/match.go | 2 +- .../golang.org/x/text/language/tables.go | 138 +- .../x/tools/go/ast/inspector/inspector.go | 4 +- .../x/tools/internal/typeparams/common.go | 26 + .../internal/typeparams/typeparams_go117.go | 2 +- .../internal/typeparams/typeparams_go118.go | 2 +- testdata/src/a/vendor/modules.txt | 14 +- tests/e2e.sh | 20 +- 165 files changed, 4901 insertions(+), 5045 deletions(-) create mode 100644 interfaces/interfaces.go create mode 100644 testdata/src/a/matcherror/matcherror.go create mode 100644 testdata/src/a/matcherror/matcherror.gomega.go rename testdata/src/a/vendor/github.com/google/go-cmp/cmp/{export_unsafe.go => export.go} (94%) delete mode 100644 testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_panic.go rename testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/{pointer_unsafe.go => pointer.go} (95%) delete mode 100644 testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go create mode 100644 testdata/src/a/vendor/golang.org/x/sys/unix/mmap_nomremap.go create mode 100644 testdata/src/a/vendor/golang.org/x/sys/unix/mremap.go diff --git a/Makefile b/Makefile index e8efae5..5866330 100644 --- a/Makefile +++ b/Makefile @@ -5,9 +5,12 @@ HASH_FLAG := -X github.com/nunnatsa/ginkgolinter/version.gitHash=$(COMMIT_HASH) BUILD_ARGS := -ldflags "$(VERSION_FLAG) $(HASH_FLAG)" -build: +build: unit-test go build $(BUILD_ARGS) -o ginkgolinter ./cmd/ginkgolinter +unit-test: + go test ./... + build-for-windows: GOOS=windows GOARCH=amd64 go build $(BUILD_ARGS) -o bin/ginkgolinter-amd64.exe ./cmd/ginkgolinter diff --git a/README.md b/README.md index 6c95917..3832f61 100644 --- a/README.md +++ b/README.md @@ -44,7 +44,7 @@ It is not enabled by default, though. There are two ways to run ginkgolinter wit enable: - ginkgolinter ``` -## Linter Checks +## Linter Rules The linter checks the ginkgo and gomega assertions in golang test code. Gomega may be used together with ginkgo tests, For example: ```go @@ -177,7 +177,8 @@ var _ = Describe("checking something", Focus, func() { }) ``` -These container, or the `Focus` spec, must not be part of the final source code, and should only be used locally by the developer. +These container, or the `Focus` spec, must not be part of the final source code, and should only be used locally by the +developer. ***This rule is disabled by default***. Use the `--forbid-focus-container=true` command line flag to enable it. @@ -205,8 +206,30 @@ To suppress this warning entirely, use the `--suppress-type-compare-assertion=tr To suppress a specific file or line, use the `// ginkgo-linter:ignore-type-compare-warning` comment (see [below](#suppress-warning-from-the-code)) +### Wrong Usage of the `MatchError` gomega Matcher [BUG] +The `MatchError` gomega matcher asserts an error value (and if it's not nil). +There are four valid formats for using this Matcher: +* error value; e.g. `Expect(err).To(MatchError(anotherErr))` +* string, to be equal to the output of the `Error()` method; e.g. `Expect(err).To(MatchError("Not Found"))` +* A gomega matcher that asserts strings; e.g. `Expect(err).To(MatchError(ContainSubstring("Found")))` +* [from v0.29.0] a function that receive a single error parameter and returns a single boolean value. + In this format, an additional single string parameter, with the function description, is also required; e.g. + `Expect(err).To(MatchError(isNotFound, "is the error is a not found error"))` + +These four format are checked on runtime, but sometimes it's too late. ginkgolinter performs a static analysis and so it +will find these issues on build time. + +ginkgolinter checks the following: +* Is the first parameter is one of the four options above. +* That there are no additional parameters passed to the matcher; e.g. + `MatchError(isNotFoundFunc, "a valid description" , "not used string")`. In this case, the matcher won't fail on run + time, but the additional parameters are not in use and ignored. +* If the first parameter is a function with the format of `func(error)bool`, ginkgolinter makes sure that the second + parameter exists and its type is string. + ### Wrong Length Assertion [STYLE] -The linter finds assertion of the golang built-in `len` function, with all kind of matchers, while there are already gomega matchers for these usecases; We want to assert the item, rather than its length. +The linter finds assertion of the golang built-in `len` function, with all kind of matchers, while there are already +gomega matchers for these usecases; We want to assert the item, rather than its length. There are several wrong patterns: ```go @@ -240,7 +263,8 @@ The output of the linter,when finding issues, looks like this: The linter will also warn about the `HaveLen(0)` matcher, and will suggest to replace it with `BeEmpty()` ### Wrong `nil` Assertion [STYLE] -The linter finds assertion of the comparison to nil, with all kind of matchers, instead of using the existing `BeNil()` matcher; We want to assert the item, rather than a comparison result. +The linter finds assertion of the comparison to nil, with all kind of matchers, instead of using the existing `BeNil()` +matcher; We want to assert the item, rather than a comparison result. There are several wrong patterns: diff --git a/ginkgo_linter.go b/ginkgo_linter.go index d1e5164..5469e97 100644 --- a/ginkgo_linter.go +++ b/ginkgo_linter.go @@ -16,6 +16,7 @@ import ( "github.com/nunnatsa/ginkgolinter/ginkgohandler" "github.com/nunnatsa/ginkgolinter/gomegahandler" + "github.com/nunnatsa/ginkgolinter/interfaces" "github.com/nunnatsa/ginkgolinter/reverseassertion" "github.com/nunnatsa/ginkgolinter/types" "github.com/nunnatsa/ginkgolinter/version" @@ -40,8 +41,13 @@ const ( focusContainerFound = linterName + ": Focus container found. This is used only for local debug and should not be part of the actual source code, consider to replace with %q" focusSpecFound = linterName + ": Focus spec found. This is used only for local debug and should not be part of the actual source code, consider to remove it" compareDifferentTypes = linterName + ": use %[1]s with different types: Comparing %[2]s with %[3]s; either change the expected value type if possible, or use the BeEquivalentTo() matcher, instead of %[1]s()" - compareInterfaces = linterName + ": be careful comparing interfaces. This can fail in runtime, if the actual implementing types are different" + matchErrorArgWrongType = linterName + ": the MatchError matcher used to assert a non error type (%s)" + matchErrorWrongTypeAssertion = linterName + ": MatchError first parameter (%s) must be error, string, GomegaMatcher or func(error)bool are allowed" + matchErrorMissingDescription = linterName + ": missing function description as second parameter of MatchError" + matchErrorRedundantArg = linterName + ": redundant MatchError arguments; consider removing them; consider using `%s` instead" + matchErrorNoFuncDescription = linterName + ": The second parameter of MatchError must be the function description (string)" ) + const ( // gomega matchers beEmpty = "BeEmpty" beEquivalentTo = "BeEquivalentTo" @@ -61,6 +67,7 @@ const ( // gomega matchers and = "And" or = "Or" withTransform = "WithTransform" + matchError = "MatchError" ) const ( // gomega actuals @@ -133,6 +140,8 @@ currently, the linter searches for following: * trigger a warning when a ginkgo focus container (FDescribe, FContext, FWhen or FIt) is found. [Bug] +* validate the MatchError gomega matcher [Bug] + * trigger a warning when using the Equal or the BeIdentical matcher with two different types, as these matchers will fail in runtime. @@ -179,6 +188,8 @@ func (l *ginkgoLinter) run(pass *analysis.Pass) (interface{}, error) { continue } + //gomegaMatcher = getMatcherInterface(pass, file) + ast.Inspect(file, func(n ast.Node) bool { if ginkgoHndlr != nil && fileConfig.ForbidFocus { spec, ok := n.(*ast.ValueSpec) @@ -304,6 +315,8 @@ func checkExpression(pass *analysis.Pass, config types.Config, assertionExp *ast } return bool(config.SuppressCompare) || checkComparison(expr, pass, matcher, handler, first, second, op, oldExpr) + } else if checkMatchError(pass, assertionExp, actualArg, handler, oldExpr) { + return false } else if isExprError(pass, actualArg) { return bool(config.SuppressErr) || checkNilError(pass, expr, handler, actualArg, oldExpr) @@ -318,6 +331,128 @@ func checkExpression(pass *analysis.Pass, config types.Config, assertionExp *ast return true } +func checkMatchError(pass *analysis.Pass, origExp *ast.CallExpr, actualArg ast.Expr, handler gomegahandler.Handler, oldExpr string) bool { + matcher, ok := origExp.Args[0].(*ast.CallExpr) + if !ok { + return false + } + + return doCheckMatchError(pass, origExp, matcher, actualArg, handler, oldExpr) +} + +func doCheckMatchError(pass *analysis.Pass, origExp *ast.CallExpr, matcher *ast.CallExpr, actualArg ast.Expr, handler gomegahandler.Handler, oldExpr string) bool { + if name, ok := handler.GetActualFuncName(matcher); ok { + switch name { + case matchError: + case not: + nested, ok := matcher.Args[0].(*ast.CallExpr) + if !ok { + return false + } + + return doCheckMatchError(pass, origExp, nested, actualArg, handler, oldExpr) + case and, or: + res := true + for _, arg := range matcher.Args { + if nested, ok := arg.(*ast.CallExpr); ok { + if !doCheckMatchError(pass, origExp, nested, actualArg, handler, oldExpr) { + res = false + } + } + } + return res + default: + return false + } + } + + if !isExprError(pass, actualArg) { + reportNoFix(pass, origExp.Pos(), matchErrorArgWrongType, goFmt(pass.Fset, actualArg)) + } + + expr := astcopy.CallExpr(matcher) + + validAssertion, requiredParams := checkMatchErrorAssertion(pass, matcher) + if !validAssertion { + reportNoFix(pass, expr.Pos(), matchErrorWrongTypeAssertion, goFmt(pass.Fset, matcher.Args[0])) + return false + } + + numParams := len(matcher.Args) + if numParams == requiredParams { + if numParams == 2 { + t := pass.TypesInfo.TypeOf(matcher.Args[1]) + if !gotypes.Identical(t, gotypes.Typ[gotypes.String]) { + pass.Reportf(expr.Pos(), matchErrorNoFuncDescription) + return false + } + } + return true + } + + if requiredParams == 2 && numParams == 1 { + reportNoFix(pass, expr.Pos(), matchErrorMissingDescription) + return false + } + + var newArgsSuggestion = []ast.Expr{expr.Args[0]} + if requiredParams == 2 { + newArgsSuggestion = append(newArgsSuggestion, expr.Args[1]) + } + expr.Args = newArgsSuggestion + report(pass, expr, matchErrorRedundantArg, oldExpr) + return false +} + +func checkMatchErrorAssertion(pass *analysis.Pass, matcher *ast.CallExpr) (bool, int) { + if isErrorMatcherValidArg(pass, matcher.Args[0]) { + return true, 1 + } + + t1 := pass.TypesInfo.TypeOf(matcher.Args[0]) + if isFuncErrBool(t1) { + return true, 2 + } + + return false, 0 +} + +// isFuncErrBool checks if a function is with the signature `func(error) bool` +func isFuncErrBool(t gotypes.Type) bool { + sig, ok := t.(*gotypes.Signature) + if !ok { + return false + } + if sig.Params().Len() != 1 || sig.Results().Len() != 1 { + return false + } + + if !interfaces.ImplementsError(sig.Params().At(0).Type()) { + return false + } + + b, ok := sig.Results().At(0).Type().(*gotypes.Basic) + if ok && b.Name() == "bool" && b.Info() == gotypes.IsBoolean && b.Kind() == gotypes.Bool { + return true + } + + return false +} + +func isErrorMatcherValidArg(pass *analysis.Pass, arg ast.Expr) bool { + if isExprError(pass, arg) { + return true + } + + if t, ok := pass.TypesInfo.TypeOf(arg).(*gotypes.Basic); ok && t.Kind() == gotypes.String { + return true + } + + t := pass.TypesInfo.TypeOf(arg) + + return interfaces.ImplementsGomegaMatcher(t) +} + func checkEqualWrongType(pass *analysis.Pass, origExp *ast.CallExpr, actualArg ast.Expr, handler gomegahandler.Handler, old string) bool { matcher, ok := origExp.Args[0].(*ast.CallExpr) if !ok { @@ -1297,28 +1432,18 @@ func goFmt(fset *token.FileSet, x ast.Expr) string { return b.String() } -var errorType *gotypes.Interface - -func init() { - errorType = gotypes.Universe.Lookup("error").Type().Underlying().(*gotypes.Interface) -} - -func isError(t gotypes.Type) bool { - return gotypes.Implements(t, errorType) -} - func isExprError(pass *analysis.Pass, expr ast.Expr) bool { actualArgType := pass.TypesInfo.TypeOf(expr) switch t := actualArgType.(type) { case *gotypes.Named: - if isError(actualArgType) { + if interfaces.ImplementsError(actualArgType) { return true } case *gotypes.Tuple: if t.Len() > 0 { switch t0 := t.At(0).Type().(type) { case *gotypes.Named, *gotypes.Pointer: - if isError(t0) { + if interfaces.ImplementsError(t0) { return true } } diff --git a/ginkgo_linter_test.go b/ginkgo_linter_test.go index b36b808..eff11ef 100644 --- a/ginkgo_linter_test.go +++ b/ginkgo_linter_test.go @@ -81,6 +81,10 @@ func TestAllUseCases(t *testing.T) { testName: "equal with different type", testData: "a/comparetypes", }, + { + testName: "MatchError", + testData: "a/matcherror", + }, } { t.Run(tc.testName, func(tt *testing.T) { analysistest.Run(tt, analysistest.TestData(), ginkgolinter.NewAnalyzer(), tc.testData) diff --git a/go.mod b/go.mod index d3c63cc..4fea9d3 100644 --- a/go.mod +++ b/go.mod @@ -1,6 +1,6 @@ module github.com/nunnatsa/ginkgolinter -go 1.20 +go 1.21 require ( github.com/go-toolsmith/astcopy v1.1.0 diff --git a/go.sum b/go.sum index 083135d..7f70f3c 100644 --- a/go.sum +++ b/go.sum @@ -12,6 +12,7 @@ golang.org/x/exp/typeparams v0.0.0-20230203172020-98cc5a0785f9/go.mod h1:AbB0pIl golang.org/x/mod v0.13.0 h1:I/DsJXRlw/8l/0c24sM9yb0T4z9liZTduXvdAWYiysY= golang.org/x/mod v0.13.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c= golang.org/x/sync v0.4.0 h1:zxkM55ReGkDlKSM+Fu41A+zmbZuaPVbGMzvvdUPznYQ= +golang.org/x/sync v0.4.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y= golang.org/x/sys v0.13.0 h1:Af8nKPmuFypiUBjVoU9V20FiaFXOcuZI21p0ycVYYGE= golang.org/x/sys v0.13.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/tools v0.14.0 h1:jvNa2pY0M4r62jkRQ6RwEZZyPcymeL9XZMLBbV7U2nc= diff --git a/gomegahandler/handler.go b/gomegahandler/handler.go index 0c34cb7..419145b 100644 --- a/gomegahandler/handler.go +++ b/gomegahandler/handler.go @@ -5,6 +5,10 @@ import ( "go/token" ) +const ( + importPath = `"github.com/onsi/gomega"` +) + // Handler provide different handling, depend on the way gomega was imported, whether // in imported with "." name, custom name or without any name. type Handler interface { @@ -23,7 +27,7 @@ type Handler interface { // GetGomegaHandler returns a gomegar handler according to the way gomega was imported in the specific file func GetGomegaHandler(file *ast.File) Handler { for _, imp := range file.Imports { - if imp.Path.Value != `"github.com/onsi/gomega"` { + if imp.Path.Value != importPath { continue } diff --git a/interfaces/interfaces.go b/interfaces/interfaces.go new file mode 100644 index 0000000..dafeacd --- /dev/null +++ b/interfaces/interfaces.go @@ -0,0 +1,76 @@ +package interfaces + +import ( + "go/token" + gotypes "go/types" +) + +var ( + errorType *gotypes.Interface + gomegaMatcherType *gotypes.Interface +) + +func init() { + errorType = gotypes.Universe.Lookup("error").Type().Underlying().(*gotypes.Interface) + gomegaMatcherType = generateTheGomegaMatcherInfType() +} + +// generateTheGomegaMatcherInfType generates a types.Interface instance that represents the +// GomegaMatcher interface. +// The original code is (copied from https://github.com/nunnatsa/ginkgolinter/blob/8fdd05eee922578d4699f49d267001c01e0b9f1e/testdata/src/a/vendor/github.com/onsi/gomega/types/types.go) +// +// type GomegaMatcher interface { +// Match(actual interface{}) (success bool, err error) +// FailureMessage(actual interface{}) (message string) +// NegatedFailureMessage(actual interface{}) (message string) +// } +func generateTheGomegaMatcherInfType() *gotypes.Interface { + err := gotypes.Universe.Lookup("error").Type() + bl := gotypes.Typ[gotypes.Bool] + str := gotypes.Typ[gotypes.String] + anyType := gotypes.Universe.Lookup("any").Type() + + return gotypes.NewInterfaceType([]*gotypes.Func{ + // Match(actual interface{}) (success bool, err error) + gotypes.NewFunc(token.NoPos, nil, "Match", gotypes.NewSignatureType( + nil, nil, nil, + gotypes.NewTuple( + gotypes.NewVar(token.NoPos, nil, "actual", anyType), + ), + gotypes.NewTuple( + gotypes.NewVar(token.NoPos, nil, "", bl), + gotypes.NewVar(token.NoPos, nil, "", err), + ), false), + ), + // FailureMessage(actual interface{}) (message string) + gotypes.NewFunc(token.NoPos, nil, "FailureMessage", gotypes.NewSignatureType( + nil, nil, nil, + gotypes.NewTuple( + gotypes.NewVar(token.NoPos, nil, "", anyType), + ), + gotypes.NewTuple( + gotypes.NewVar(token.NoPos, nil, "", str), + ), + false), + ), + //NegatedFailureMessage(actual interface{}) (message string) + gotypes.NewFunc(token.NoPos, nil, "NegatedFailureMessage", gotypes.NewSignatureType( + nil, nil, nil, + gotypes.NewTuple( + gotypes.NewVar(token.NoPos, nil, "", anyType), + ), + gotypes.NewTuple( + gotypes.NewVar(token.NoPos, nil, "", str), + ), + false), + ), + }, nil) +} + +func ImplementsError(t gotypes.Type) bool { + return gotypes.Implements(t, errorType) +} + +func ImplementsGomegaMatcher(t gotypes.Type) bool { + return gotypes.Implements(t, gomegaMatcherType) +} diff --git a/testdata/src/a/go.mod b/testdata/src/a/go.mod index 9334ba6..efdbc0a 100644 --- a/testdata/src/a/go.mod +++ b/testdata/src/a/go.mod @@ -1,20 +1,20 @@ module a -go 1.20 +go 1.21 require ( - github.com/onsi/ginkgo/v2 v2.9.7 - github.com/onsi/gomega v1.27.7 + github.com/onsi/ginkgo/v2 v2.13.0 + github.com/onsi/gomega v1.29.0 ) require ( github.com/go-logr/logr v1.2.4 // indirect github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 // indirect - github.com/google/go-cmp v0.5.9 // indirect + github.com/google/go-cmp v0.6.0 // indirect github.com/google/pprof v0.0.0-20230602150820-91b7bce49751 // indirect - golang.org/x/net v0.10.0 // indirect - golang.org/x/sys v0.8.0 // indirect - golang.org/x/text v0.9.0 // indirect - golang.org/x/tools v0.9.3 // indirect + golang.org/x/net v0.17.0 // indirect + golang.org/x/sys v0.13.0 // indirect + golang.org/x/text v0.13.0 // indirect + golang.org/x/tools v0.12.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) diff --git a/testdata/src/a/go.sum b/testdata/src/a/go.sum index 5c60617..6c9b389 100644 --- a/testdata/src/a/go.sum +++ b/testdata/src/a/go.sum @@ -6,29 +6,32 @@ github.com/go-logr/logr v1.2.4/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbV github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 h1:tfuBGBXKqDEevZMzYi5KSi8KkcZtzBcTgAUUtapy0OI= github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572/go.mod h1:9Pwr4B2jHnOSGXyyzV8ROjYa2ojvAY6HCGYYfMoC3Ls= github.com/golang/protobuf v1.5.3 h1:KhyjKVUg7Usr/dYsdSqoFveMYd5ko72D+zANwlG1mmg= -github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= -github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= +github.com/golang/protobuf v1.5.3/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY= +github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= +github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/pprof v0.0.0-20230602150820-91b7bce49751 h1:hR7/MlvK23p6+lIw9SN1TigNLn9ZnF3W4SYRKq2gAHs= github.com/google/pprof v0.0.0-20230602150820-91b7bce49751/go.mod h1:Jh3hGz2jkYak8qXPD19ryItVnUgpgeqzdkY/D0EaeuA= -github.com/onsi/ginkgo/v2 v2.9.7 h1:06xGQy5www2oN160RtEZoTvnP2sPhEfePYmCDc2szss= -github.com/onsi/ginkgo/v2 v2.9.7/go.mod h1:cxrmXWykAwTwhQsJOPfdIDiJ+l2RYq7U8hFU+M/1uw0= -github.com/onsi/gomega v1.27.7 h1:fVih9JD6ogIiHUN6ePK7HJidyEDpWGVB5mzM7cWNXoU= -github.com/onsi/gomega v1.27.7/go.mod h1:1p8OOlwo2iUUDsHnOrjE5UKYJ+e3W8eQ3qSlRahPmr4= +github.com/onsi/ginkgo/v2 v2.13.0 h1:0jY9lJquiL8fcf3M4LAXN5aMlS/b2BV86HFFPCPMgE4= +github.com/onsi/ginkgo/v2 v2.13.0/go.mod h1:TE309ZR8s5FsKKpuB1YAQYBzCaAfUgatB/xlT/ETL/o= +github.com/onsi/gomega v1.29.0 h1:KIA/t2t5UBzoirT4H9tsML45GEbo3ouUnBHsCfD2tVg= +github.com/onsi/gomega v1.29.0/go.mod h1:9sxs+SwGrKI0+PWe4Fxa9tFQQBG5xSsSbMXOI8PPpoQ= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.6.1 h1:hDPOHmpOpP40lSULcqw7IrRb/u7w6RpDC9399XyoNd0= github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= -golang.org/x/mod v0.10.0 h1:lFO9qtOdlre5W1jxS3r/4szv2/6iXxScdzjoBMXNhYk= -golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= -golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= -golang.org/x/sys v0.8.0 h1:EBmGv8NaZBZTWvrbjNoL6HVt+IVy3QDQpJs7VRIw3tU= -golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= -golang.org/x/tools v0.9.3 h1:Gn1I8+64MsuTb/HpH+LmQtNas23LhUVr3rYZ0eKuaMM= -golang.org/x/tools v0.9.3/go.mod h1:owI94Op576fPu3cIGQeHs3joujW/2Oc6MtlxbF5dfNc= +golang.org/x/mod v0.12.0 h1:rmsUpXtvNzj340zd98LZ4KntptpfRHwpFOHG188oHXc= +golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/net v0.17.0 h1:pVaXccu2ozPjCXewfr1S7xza/zcXTity9cCdXQYSjIM= +golang.org/x/net v0.17.0/go.mod h1:NxSsAGuq816PNPmqtQdLE42eU2Fs7NoRIZrHJAlaCOE= +golang.org/x/sys v0.13.0 h1:Af8nKPmuFypiUBjVoU9V20FiaFXOcuZI21p0ycVYYGE= +golang.org/x/sys v0.13.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= +golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= +golang.org/x/tools v0.12.0 h1:YW6HUoUmYBpwSgyaGaZq1fHjrBjX1rlpZ54T6mu2kss= +golang.org/x/tools v0.12.0/go.mod h1:Sc0INKfu04TlqNoRA1hgpFZbhYXHPr4V5DzpSBTPqQM= google.golang.org/protobuf v1.28.0 h1:w43yiav+6bVFTBQFZX0r7ipe9JQ1QsbMgHwbBziscLw= +google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/testdata/src/a/matcherror/matcherror.go b/testdata/src/a/matcherror/matcherror.go new file mode 100644 index 0000000..88c88dd --- /dev/null +++ b/testdata/src/a/matcherror/matcherror.go @@ -0,0 +1,161 @@ +package matcherror + +import ( + "errors" + "fmt" + "github.com/onsi/gomega/types" + + . "github.com/onsi/ginkgo/v2" + . "github.com/onsi/gomega" +) + +type e string + +func (err e) Error() string { + return string(err) +} + +func isExample(err error) bool { + return err.Error() == "example" +} + +func compareString(err error, s string) bool { + return err.Error() == s +} + +func f1() error { + return errors.New("example") +} + +func f2() string { + return "example" +} + +func f3() (string, error) { + return "example", errors.New("example") +} + +type customMatcher struct{} + +func (customMatcher) Match(actual interface{}) (success bool, err error) { + return true, nil +} +func (customMatcher) FailureMessage(actual interface{}) (message string) { + return "FailureMessage" +} +func (customMatcher) NegatedFailureMessage(actual interface{}) (message string) { + return "NegatedFailureMessage" +} + +func CustomMatcher() customMatcher { + return customMatcher{} +} + +func CustomMatcherP() *customMatcher { + return &customMatcher{} +} + +var _ = Describe("Check MatchError", func() { + e1 := e("example") + e2 := e("example") + + It("one argument - valid", func() { + Expect(e1).To(MatchError(e2)) + Expect(errors.New("example")).To(MatchError("example")) + Expect(e1).To(MatchError("example")) + Expect(e1).To(MatchError(ContainSubstring("amp"))) + Expect(e1).To(MatchError(Not(ContainSubstring("abc")))) + Expect(e1).To(MatchError(CustomMatcher())) + Expect(e1).To(MatchError(CustomMatcherP())) + Expect(e1).To(MatchError(customMatcher{})) + Expect(e1).To(MatchError(&customMatcher{})) + + var gm types.GomegaMatcher = customMatcher{} + Expect(e1).To(MatchError(gm)) + }) + + It("one argument - error", func() { + Expect("example").To(MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \("example"\)` + one := 1 + Expect(one).To(MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(one\)` + Expect(e1).To(MatchError(isExample)) // want `ginkgo-linter: missing function description as second parameter of MatchError` + Expect(e1).To(MatchError(f1)) // want `ginkgo-linter: MatchError first parameter \(f1\) must be error, string, GomegaMatcher or func\(error\)bool are allowed` + }) + + It("two arguments - valid", func() { + Expect(e1).To(MatchError(func(_ error) bool { + return true + }, "a description")) + Expect(e1).ToNot(MatchError(func(_ error) bool { + return false + }, "a description")) + Expect(e1).To(MatchError(func(err error) bool { + err.Error() + return true + }, "a description")) + Expect(e1).ToNot(MatchError(func(err error) bool { + err.Error() + return false + }, "a description")) + Expect(e1).To(MatchError(isExample, "is it the example error")) + Expect(e1).To(MatchError(isExample, fmt.Sprint("is it the example error"))) + }) + + It("two arguments - wrong usage", func() { + Expect(e1).To(MatchError(e2, "not used"), "this text is ok") // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(e2\). instead` + Expect(e1).To(MatchError("example", "not used"), "this text is ok") // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("example"\). instead` + Expect(e1).To(MatchError(ContainSubstring("amp"), "not used"), "this text is ok") // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(ContainSubstring\("amp"\)\). instead` + }) + + It("two arguments - invalid", func() { + Expect(e1).To(MatchError(1, "not used"), "wrong type - int") // want `ginkgo-linter: MatchError first parameter \(1\) must be error, string, GomegaMatcher or func\(error\)bool are allowed` + Expect(e1).To(MatchError(compareString, "wrong function signature")) // want `ginkgo-linter: MatchError first parameter \(compareString\) must be error, string, GomegaMatcher or func\(error\)bool are allowed` + }) + + It("two arguments. Second is not a string", func() { + Expect(e1).To(MatchError(isExample, 1)) // want `ginkgo-linter: The second parameter of MatchError must be the function description \(string\)` + Expect(e1).To(MatchError(isExample, func() int { return 1 })) // want `ginkgo-linter: The second parameter of MatchError must be the function description \(string\)` + Expect(e1).To(MatchError(isExample, func() int { return 1 }())) // want `ginkgo-linter: The second parameter of MatchError must be the function description \(string\)` + }) + + It("multiple arguments", func() { + Expect(e1).To(MatchError(isExample, "is it the example error", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(isExample, "is it the example error"\). instead` + Expect(e1).To(MatchError(isExample, "is it the example error", "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(isExample, "is it the example error"\). instead` + Expect(e1).To(MatchError(e2, "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(e2\). instead` + Expect(e1).To(MatchError("example", "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("example"\). instead` + Expect(e1).To(MatchError(ContainSubstring("amp"), "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(ContainSubstring\("amp"\)\). instead` + }) + + It("funcs - valid", func() { + Expect(f1()).To(MatchError(errors.New("example"))) + Expect(f1()).To(MatchError("example")) + Expect(f1()).To(MatchError(ContainSubstring("amp"))) + }) + + It("funcs - invalid", func() { + Expect(f2()).To(MatchError(errors.New("example"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f2\(\)\)` + Expect(f2()).To(MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f2\(\)\)` + Expect(f2()).To(MatchError(ContainSubstring("amp"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f2\(\)\)` + Expect(f3()).To(MatchError(errors.New("example"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f3\(\)\)` + Expect(f3()).To(MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f3\(\)\)` + Expect(f3()).To(MatchError(ContainSubstring("amp"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f3\(\)\)` + }) + + It("and - invalid", func() { + var err error = e1 + Expect(err).To(And(Not(BeNil()), MatchError("expect", "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("expect"\). instead` + Expect(err).To(And(MatchError("expect"), MatchError(e2))) // valid + Expect(err).To(And(MatchError("expect", "not used"), MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("expect"\). instead` `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(e2\). instead` + Expect(err).To(And(MatchError("expect", "not used"), MatchError(e2))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("expect"\). instead` + Expect(err).To(And(MatchError("expect"), MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(e2\). instead` + }) + + It("or - invalid", func() { + var err error = e1 + Expect(err).To(Or(Not(BeNil()), MatchError("expect", "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("expect"\). instead` + Expect(err).To(Or(MatchError("expect"), MatchError(e2))) // valid + Expect(err).To(Or(MatchError("expect", "not used"), MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("expect"\). instead` `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(e2\). instead` + Expect(err).To(Or(MatchError("expect", "not used"), MatchError(e2))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\("expect"\). instead` + Expect(err).To(Or(MatchError("expect"), MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .MatchError\(e2\). instead` + }) +}) diff --git a/testdata/src/a/matcherror/matcherror.gomega.go b/testdata/src/a/matcherror/matcherror.gomega.go new file mode 100644 index 0000000..7b659d4 --- /dev/null +++ b/testdata/src/a/matcherror/matcherror.gomega.go @@ -0,0 +1,116 @@ +package matcherror + +import ( + "errors" + "fmt" + "github.com/onsi/gomega/types" + + . "github.com/onsi/ginkgo/v2" + "github.com/onsi/gomega" +) + +var _ = Describe("Check MatchError", func() { + e1 := e("example") + e2 := e("example") + + It("one argument - valid", func() { + gomega.Expect(e1).To(gomega.MatchError(e2)) + gomega.Expect(errors.New("example")).To(gomega.MatchError("example")) + gomega.Expect(e1).To(gomega.MatchError("example")) + gomega.Expect(e1).To(gomega.MatchError(gomega.ContainSubstring("amp"))) + gomega.Expect(e1).To(gomega.MatchError(gomega.Not(gomega.ContainSubstring("abc")))) + gomega.Expect(e1).To(gomega.MatchError(CustomMatcher())) + gomega.Expect(e1).To(gomega.MatchError(CustomMatcherP())) + gomega.Expect(e1).To(gomega.MatchError(customMatcher{})) + gomega.Expect(e1).To(gomega.MatchError(&customMatcher{})) + + var gm types.GomegaMatcher = customMatcher{} + gomega.Expect(e1).To(gomega.MatchError(gm)) + }) + + It("one argument - error", func() { + gomega.Expect("example").To(gomega.MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \("example"\)` + one := 1 + gomega.Expect(one).To(gomega.MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(one\)` + gomega.Expect(e1).To(gomega.MatchError(isExample)) // want `ginkgo-linter: missing function description as second parameter of MatchError` + gomega.Expect(e1).To(gomega.MatchError(f1)) // want `ginkgo-linter: MatchError first parameter \(f1\) must be error, string, GomegaMatcher or func\(error\)bool are allowed` + }) + + It("two arguments - valid", func() { + gomega.Expect(e1).To(gomega.MatchError(func(_ error) bool { + return true + }, "a description")) + gomega.Expect(e1).ToNot(gomega.MatchError(func(_ error) bool { + return false + }, "a description")) + gomega.Expect(e1).To(gomega.MatchError(func(err error) bool { + err.Error() + return true + }, "a description")) + gomega.Expect(e1).ToNot(gomega.MatchError(func(err error) bool { + err.Error() + return false + }, "a description")) + gomega.Expect(e1).To(gomega.MatchError(isExample, "is it the example error")) + gomega.Expect(e1).To(gomega.MatchError(isExample, fmt.Sprint("is it the example error"))) + }) + + It("two arguments - wrong usage", func() { + gomega.Expect(e1).To(gomega.MatchError(e2, "not used"), "this text is ok") // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(e2\). instead` + gomega.Expect(e1).To(gomega.MatchError("example", "not used"), "this text is ok") // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("example"\). instead` + gomega.Expect(e1).To(gomega.MatchError(gomega.ContainSubstring("amp"), "not used"), "this text is ok") // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(gomega\.ContainSubstring\("amp"\)\). instead` + }) + + It("two arguments - invalid", func() { + gomega.Expect(e1).To(gomega.MatchError(1, "not used"), "wrong type - int") // want `ginkgo-linter: MatchError first parameter \(1\) must be error, string, GomegaMatcher or func\(error\)bool are allowed` + gomega.Expect(e1).To(gomega.MatchError(compareString, "wrong function signature")) // want `ginkgo-linter: MatchError first parameter \(compareString\) must be error, string, GomegaMatcher or func\(error\)bool are allowed` + }) + + It("two arguments. Second is not a string", func() { + gomega.Expect(e1).To(gomega.MatchError(isExample, 1)) // want `ginkgo-linter: The second parameter of MatchError must be the function description \(string\)` + gomega.Expect(e1).To(gomega.MatchError(isExample, func() int { return 1 })) // want `ginkgo-linter: The second parameter of MatchError must be the function description \(string\)` + gomega.Expect(e1).To(gomega.MatchError(isExample, func() int { return 1 }())) // want `ginkgo-linter: The second parameter of MatchError must be the function description \(string\)` + }) + + It("multiple arguments", func() { + gomega.Expect(e1).To(gomega.MatchError(isExample, "is it the example error", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(isExample, "is it the example error"\). instead` + gomega.Expect(e1).To(gomega.MatchError(isExample, "is it the example error", "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(isExample, "is it the example error"\). instead` + gomega.Expect(e1).To(gomega.MatchError(e2, "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(e2\). instead` + gomega.Expect(e1).To(gomega.MatchError("example", "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("example"\). instead` + gomega.Expect(e1).To(gomega.MatchError(gomega.ContainSubstring("amp"), "not used", "not used")) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(gomega\.ContainSubstring\("amp"\)\). instead` + }) + + It("funcs - valid", func() { + gomega.Expect(f1()).To(gomega.MatchError(errors.New("example"))) + gomega.Expect(f1()).To(gomega.MatchError("example")) + gomega.Expect(f1()).To(gomega.MatchError(gomega.ContainSubstring("amp"))) + }) + + It("funcs - invalid", func() { + gomega.Expect(f2()).To(gomega.MatchError(errors.New("example"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f2\(\)\)` + gomega.Expect(f2()).To(gomega.MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f2\(\)\)` + gomega.Expect(f2()).To(gomega.MatchError(gomega.ContainSubstring("amp"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f2\(\)\)` + gomega.Expect(f3()).To(gomega.MatchError(errors.New("example"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f3\(\)\)` + gomega.Expect(f3()).To(gomega.MatchError("example")) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f3\(\)\)` + gomega.Expect(f3()).To(gomega.MatchError(gomega.ContainSubstring("amp"))) // want `ginkgo-linter: the MatchError matcher used to assert a non error type \(f3\(\)\)` + }) + + It("and - invalid", func() { + var err error = e1 + gomega.Expect(err).To(gomega.And(gomega.Not(gomega.BeNil()), gomega.MatchError("expect", "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("expect"\). instead` + gomega.Expect(err).To(gomega.And(gomega.MatchError("expect"), gomega.MatchError(e2))) // valid + gomega.Expect(err).To(gomega.And(gomega.MatchError("expect", "not used"), gomega.MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("expect"\). instead` `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(e2\). instead` + gomega.Expect(err).To(gomega.And(gomega.MatchError("expect", "not used"), gomega.MatchError(e2))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("expect"\). instead` + gomega.Expect(err).To(gomega.And(gomega.MatchError("expect"), gomega.MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(e2\). instead` + }) + + It("or - invalid", func() { + var err error = e1 + gomega.Expect(err).To(gomega.Or(gomega.Not(gomega.BeNil()), gomega.MatchError("expect", "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("expect"\). instead` + gomega.Expect(err).To(gomega.Or(gomega.MatchError("expect"), gomega.MatchError(e2))) // valid + gomega.Expect(err).To(gomega.Or(gomega.MatchError("expect", "not used"), gomega.MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("expect"\). instead` `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(e2\). instead` + gomega.Expect(err).To(gomega.Or(gomega.MatchError("expect", "not used"), gomega.MatchError(e2))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\("expect"\). instead` + gomega.Expect(err).To(gomega.Or(gomega.MatchError("expect"), gomega.MatchError(e2, "not used"))) // want `ginkgo-linter: redundant MatchError arguments; consider removing them; consider using .gomega\.MatchError\(e2\). instead` + }) + +}) diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/compare.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/compare.go index 087320d..0f5b8a4 100644 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/compare.go +++ b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/compare.go @@ -5,7 +5,7 @@ // Package cmp determines equality of values. // // This package is intended to be a more powerful and safer alternative to -// reflect.DeepEqual for comparing whether two values are semantically equal. +// [reflect.DeepEqual] for comparing whether two values are semantically equal. // It is intended to only be used in tests, as performance is not a goal and // it may panic if it cannot compare the values. Its propensity towards // panicking means that its unsuitable for production environments where a @@ -18,16 +18,17 @@ // For example, an equality function may report floats as equal so long as // they are within some tolerance of each other. // -// - Types with an Equal method may use that method to determine equality. -// This allows package authors to determine the equality operation -// for the types that they define. +// - Types with an Equal method (e.g., [time.Time.Equal]) may use that method +// to determine equality. This allows package authors to determine +// the equality operation for the types that they define. // // - If no custom equality functions are used and no Equal method is defined, // equality is determined by recursively comparing the primitive kinds on -// both values, much like reflect.DeepEqual. Unlike reflect.DeepEqual, +// both values, much like [reflect.DeepEqual]. Unlike [reflect.DeepEqual], // unexported fields are not compared by default; they result in panics -// unless suppressed by using an Ignore option (see cmpopts.IgnoreUnexported) -// or explicitly compared using the Exporter option. +// unless suppressed by using an [Ignore] option +// (see [github.com/google/go-cmp/cmp/cmpopts.IgnoreUnexported]) +// or explicitly compared using the [Exporter] option. package cmp import ( @@ -45,14 +46,14 @@ import ( // Equal reports whether x and y are equal by recursively applying the // following rules in the given order to x and y and all of their sub-values: // -// - Let S be the set of all Ignore, Transformer, and Comparer options that +// - Let S be the set of all [Ignore], [Transformer], and [Comparer] options that // remain after applying all path filters, value filters, and type filters. -// If at least one Ignore exists in S, then the comparison is ignored. -// If the number of Transformer and Comparer options in S is non-zero, +// If at least one [Ignore] exists in S, then the comparison is ignored. +// If the number of [Transformer] and [Comparer] options in S is non-zero, // then Equal panics because it is ambiguous which option to use. -// If S contains a single Transformer, then use that to transform +// If S contains a single [Transformer], then use that to transform // the current values and recursively call Equal on the output values. -// If S contains a single Comparer, then use that to compare the current values. +// If S contains a single [Comparer], then use that to compare the current values. // Otherwise, evaluation proceeds to the next rule. // // - If the values have an Equal method of the form "(T) Equal(T) bool" or @@ -66,21 +67,22 @@ import ( // Functions are only equal if they are both nil, otherwise they are unequal. // // Structs are equal if recursively calling Equal on all fields report equal. -// If a struct contains unexported fields, Equal panics unless an Ignore option -// (e.g., cmpopts.IgnoreUnexported) ignores that field or the Exporter option -// explicitly permits comparing the unexported field. +// If a struct contains unexported fields, Equal panics unless an [Ignore] option +// (e.g., [github.com/google/go-cmp/cmp/cmpopts.IgnoreUnexported]) ignores that field +// or the [Exporter] option explicitly permits comparing the unexported field. // // Slices are equal if they are both nil or both non-nil, where recursively // calling Equal on all non-ignored slice or array elements report equal. // Empty non-nil slices and nil slices are not equal; to equate empty slices, -// consider using cmpopts.EquateEmpty. +// consider using [github.com/google/go-cmp/cmp/cmpopts.EquateEmpty]. // // Maps are equal if they are both nil or both non-nil, where recursively // calling Equal on all non-ignored map entries report equal. // Map keys are equal according to the == operator. -// To use custom comparisons for map keys, consider using cmpopts.SortMaps. +// To use custom comparisons for map keys, consider using +// [github.com/google/go-cmp/cmp/cmpopts.SortMaps]. // Empty non-nil maps and nil maps are not equal; to equate empty maps, -// consider using cmpopts.EquateEmpty. +// consider using [github.com/google/go-cmp/cmp/cmpopts.EquateEmpty]. // // Pointers and interfaces are equal if they are both nil or both non-nil, // where they have the same underlying concrete type and recursively diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_unsafe.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export.go similarity index 94% rename from testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_unsafe.go rename to testdata/src/a/vendor/github.com/google/go-cmp/cmp/export.go index e2c0f74..29f82fe 100644 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_unsafe.go +++ b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export.go @@ -2,9 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build !purego -// +build !purego - package cmp import ( @@ -12,8 +9,6 @@ import ( "unsafe" ) -const supportExporters = true - // retrieveUnexportedField uses unsafe to forcibly retrieve any field from // a struct such that the value has read-write permissions. // diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_panic.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_panic.go deleted file mode 100644 index ae851fe..0000000 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/export_panic.go +++ /dev/null @@ -1,16 +0,0 @@ -// Copyright 2017, The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build purego -// +build purego - -package cmp - -import "reflect" - -const supportExporters = false - -func retrieveUnexportedField(reflect.Value, reflect.StructField, bool) reflect.Value { - panic("no support for forcibly accessing unexported fields") -} diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_unsafe.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer.go similarity index 95% rename from testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_unsafe.go rename to testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer.go index 16e6860..e5dfff6 100644 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_unsafe.go +++ b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer.go @@ -2,9 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build !purego -// +build !purego - package value import ( diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go deleted file mode 100644 index 1a71bfc..0000000 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go +++ /dev/null @@ -1,34 +0,0 @@ -// Copyright 2018, The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build purego -// +build purego - -package value - -import "reflect" - -// Pointer is an opaque typed pointer and is guaranteed to be comparable. -type Pointer struct { - p uintptr - t reflect.Type -} - -// PointerOf returns a Pointer from v, which must be a -// reflect.Ptr, reflect.Slice, or reflect.Map. -func PointerOf(v reflect.Value) Pointer { - // NOTE: Storing a pointer as an uintptr is technically incorrect as it - // assumes that the GC implementation does not use a moving collector. - return Pointer{v.Pointer(), v.Type()} -} - -// IsNil reports whether the pointer is nil. -func (p Pointer) IsNil() bool { - return p.p == 0 -} - -// Uintptr returns the pointer as a uintptr. -func (p Pointer) Uintptr() uintptr { - return p.p -} diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/options.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/options.go index 1f9ca9c..754496f 100644 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/options.go +++ b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/options.go @@ -13,15 +13,15 @@ import ( "github.com/google/go-cmp/cmp/internal/function" ) -// Option configures for specific behavior of Equal and Diff. In particular, -// the fundamental Option functions (Ignore, Transformer, and Comparer), +// Option configures for specific behavior of [Equal] and [Diff]. In particular, +// the fundamental Option functions ([Ignore], [Transformer], and [Comparer]), // configure how equality is determined. // -// The fundamental options may be composed with filters (FilterPath and -// FilterValues) to control the scope over which they are applied. +// The fundamental options may be composed with filters ([FilterPath] and +// [FilterValues]) to control the scope over which they are applied. // -// The cmp/cmpopts package provides helper functions for creating options that -// may be used with Equal and Diff. +// The [github.com/google/go-cmp/cmp/cmpopts] package provides helper functions +// for creating options that may be used with [Equal] and [Diff]. type Option interface { // filter applies all filters and returns the option that remains. // Each option may only read s.curPath and call s.callTTBFunc. @@ -56,9 +56,9 @@ type core struct{} func (core) isCore() {} -// Options is a list of Option values that also satisfies the Option interface. +// Options is a list of [Option] values that also satisfies the [Option] interface. // Helper comparison packages may return an Options value when packing multiple -// Option values into a single Option. When this package processes an Options, +// [Option] values into a single [Option]. When this package processes an Options, // it will be implicitly expanded into a flat list. // // Applying a filter on an Options is equivalent to applying that same filter @@ -105,16 +105,16 @@ func (opts Options) String() string { return fmt.Sprintf("Options{%s}", strings.Join(ss, ", ")) } -// FilterPath returns a new Option where opt is only evaluated if filter f -// returns true for the current Path in the value tree. +// FilterPath returns a new [Option] where opt is only evaluated if filter f +// returns true for the current [Path] in the value tree. // // This filter is called even if a slice element or map entry is missing and // provides an opportunity to ignore such cases. The filter function must be // symmetric such that the filter result is identical regardless of whether the // missing value is from x or y. // -// The option passed in may be an Ignore, Transformer, Comparer, Options, or -// a previously filtered Option. +// The option passed in may be an [Ignore], [Transformer], [Comparer], [Options], or +// a previously filtered [Option]. func FilterPath(f func(Path) bool, opt Option) Option { if f == nil { panic("invalid path filter function") @@ -142,7 +142,7 @@ func (f pathFilter) String() string { return fmt.Sprintf("FilterPath(%s, %v)", function.NameOf(reflect.ValueOf(f.fnc)), f.opt) } -// FilterValues returns a new Option where opt is only evaluated if filter f, +// FilterValues returns a new [Option] where opt is only evaluated if filter f, // which is a function of the form "func(T, T) bool", returns true for the // current pair of values being compared. If either value is invalid or // the type of the values is not assignable to T, then this filter implicitly @@ -154,8 +154,8 @@ func (f pathFilter) String() string { // If T is an interface, it is possible that f is called with two values with // different concrete types that both implement T. // -// The option passed in may be an Ignore, Transformer, Comparer, Options, or -// a previously filtered Option. +// The option passed in may be an [Ignore], [Transformer], [Comparer], [Options], or +// a previously filtered [Option]. func FilterValues(f interface{}, opt Option) Option { v := reflect.ValueOf(f) if !function.IsType(v.Type(), function.ValueFilter) || v.IsNil() { @@ -192,9 +192,9 @@ func (f valuesFilter) String() string { return fmt.Sprintf("FilterValues(%s, %v)", function.NameOf(f.fnc), f.opt) } -// Ignore is an Option that causes all comparisons to be ignored. -// This value is intended to be combined with FilterPath or FilterValues. -// It is an error to pass an unfiltered Ignore option to Equal. +// Ignore is an [Option] that causes all comparisons to be ignored. +// This value is intended to be combined with [FilterPath] or [FilterValues]. +// It is an error to pass an unfiltered Ignore option to [Equal]. func Ignore() Option { return ignore{} } type ignore struct{ core } @@ -234,6 +234,8 @@ func (validator) apply(s *state, vx, vy reflect.Value) { name = fmt.Sprintf("%q.%v", t.PkgPath(), t.Name()) // e.g., "path/to/package".MyType if _, ok := reflect.New(t).Interface().(error); ok { help = "consider using cmpopts.EquateErrors to compare error values" + } else if t.Comparable() { + help = "consider using cmpopts.EquateComparable to compare comparable Go types" } } else { // Unnamed type with unexported fields. Derive PkgPath from field. @@ -254,7 +256,7 @@ const identRx = `[_\p{L}][_\p{L}\p{N}]*` var identsRx = regexp.MustCompile(`^` + identRx + `(\.` + identRx + `)*$`) -// Transformer returns an Option that applies a transformation function that +// Transformer returns an [Option] that applies a transformation function that // converts values of a certain type into that of another. // // The transformer f must be a function "func(T) R" that converts values of @@ -265,13 +267,14 @@ var identsRx = regexp.MustCompile(`^` + identRx + `(\.` + identRx + `)*$`) // same transform to the output of itself (e.g., in the case where the // input and output types are the same), an implicit filter is added such that // a transformer is applicable only if that exact transformer is not already -// in the tail of the Path since the last non-Transform step. +// in the tail of the [Path] since the last non-[Transform] step. // For situations where the implicit filter is still insufficient, -// consider using cmpopts.AcyclicTransformer, which adds a filter -// to prevent the transformer from being recursively applied upon itself. +// consider using [github.com/google/go-cmp/cmp/cmpopts.AcyclicTransformer], +// which adds a filter to prevent the transformer from +// being recursively applied upon itself. // -// The name is a user provided label that is used as the Transform.Name in the -// transformation PathStep (and eventually shown in the Diff output). +// The name is a user provided label that is used as the [Transform.Name] in the +// transformation [PathStep] (and eventually shown in the [Diff] output). // The name must be a valid identifier or qualified identifier in Go syntax. // If empty, an arbitrary name is used. func Transformer(name string, f interface{}) Option { @@ -329,7 +332,7 @@ func (tr transformer) String() string { return fmt.Sprintf("Transformer(%s, %s)", tr.name, function.NameOf(tr.fnc)) } -// Comparer returns an Option that determines whether two values are equal +// Comparer returns an [Option] that determines whether two values are equal // to each other. // // The comparer f must be a function "func(T, T) bool" and is implicitly @@ -377,35 +380,32 @@ func (cm comparer) String() string { return fmt.Sprintf("Comparer(%s)", function.NameOf(cm.fnc)) } -// Exporter returns an Option that specifies whether Equal is allowed to +// Exporter returns an [Option] that specifies whether [Equal] is allowed to // introspect into the unexported fields of certain struct types. // // Users of this option must understand that comparing on unexported fields // from external packages is not safe since changes in the internal -// implementation of some external package may cause the result of Equal +// implementation of some external package may cause the result of [Equal] // to unexpectedly change. However, it may be valid to use this option on types // defined in an internal package where the semantic meaning of an unexported // field is in the control of the user. // -// In many cases, a custom Comparer should be used instead that defines +// In many cases, a custom [Comparer] should be used instead that defines // equality as a function of the public API of a type rather than the underlying // unexported implementation. // -// For example, the reflect.Type documentation defines equality to be determined +// For example, the [reflect.Type] documentation defines equality to be determined // by the == operator on the interface (essentially performing a shallow pointer -// comparison) and most attempts to compare *regexp.Regexp types are interested +// comparison) and most attempts to compare *[regexp.Regexp] types are interested // in only checking that the regular expression strings are equal. -// Both of these are accomplished using Comparers: +// Both of these are accomplished using [Comparer] options: // // Comparer(func(x, y reflect.Type) bool { return x == y }) // Comparer(func(x, y *regexp.Regexp) bool { return x.String() == y.String() }) // -// In other cases, the cmpopts.IgnoreUnexported option can be used to ignore -// all unexported fields on specified struct types. +// In other cases, the [github.com/google/go-cmp/cmp/cmpopts.IgnoreUnexported] +// option can be used to ignore all unexported fields on specified struct types. func Exporter(f func(reflect.Type) bool) Option { - if !supportExporters { - panic("Exporter is not supported on purego builds") - } return exporter(f) } @@ -415,10 +415,10 @@ func (exporter) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableO panic("not implemented") } -// AllowUnexported returns an Options that allows Equal to forcibly introspect +// AllowUnexported returns an [Option] that allows [Equal] to forcibly introspect // unexported fields of the specified struct types. // -// See Exporter for the proper use of this option. +// See [Exporter] for the proper use of this option. func AllowUnexported(types ...interface{}) Option { m := make(map[reflect.Type]bool) for _, typ := range types { @@ -432,7 +432,7 @@ func AllowUnexported(types ...interface{}) Option { } // Result represents the comparison result for a single node and -// is provided by cmp when calling Report (see Reporter). +// is provided by cmp when calling Report (see [Reporter]). type Result struct { _ [0]func() // Make Result incomparable flags resultFlags @@ -445,7 +445,7 @@ func (r Result) Equal() bool { } // ByIgnore reports whether the node is equal because it was ignored. -// This never reports true if Equal reports false. +// This never reports true if [Result.Equal] reports false. func (r Result) ByIgnore() bool { return r.flags&reportByIgnore != 0 } @@ -455,7 +455,7 @@ func (r Result) ByMethod() bool { return r.flags&reportByMethod != 0 } -// ByFunc reports whether a Comparer function determined equality. +// ByFunc reports whether a [Comparer] function determined equality. func (r Result) ByFunc() bool { return r.flags&reportByFunc != 0 } @@ -478,7 +478,7 @@ const ( reportByCycle ) -// Reporter is an Option that can be passed to Equal. When Equal traverses +// Reporter is an [Option] that can be passed to [Equal]. When [Equal] traverses // the value trees, it calls PushStep as it descends into each node in the // tree and PopStep as it ascend out of the node. The leaves of the tree are // either compared (determined to be equal or not equal) or ignored and reported diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/path.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/path.go index a0a5885..c3c1456 100644 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/path.go +++ b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/path.go @@ -14,9 +14,9 @@ import ( "github.com/google/go-cmp/cmp/internal/value" ) -// Path is a list of PathSteps describing the sequence of operations to get +// Path is a list of [PathStep] describing the sequence of operations to get // from some root type to the current position in the value tree. -// The first Path element is always an operation-less PathStep that exists +// The first Path element is always an operation-less [PathStep] that exists // simply to identify the initial type. // // When traversing structs with embedded structs, the embedded struct will @@ -29,8 +29,13 @@ type Path []PathStep // a value's tree structure. Users of this package never need to implement // these types as values of this type will be returned by this package. // -// Implementations of this interface are -// StructField, SliceIndex, MapIndex, Indirect, TypeAssertion, and Transform. +// Implementations of this interface: +// - [StructField] +// - [SliceIndex] +// - [MapIndex] +// - [Indirect] +// - [TypeAssertion] +// - [Transform] type PathStep interface { String() string @@ -70,8 +75,9 @@ func (pa *Path) pop() { *pa = (*pa)[:len(*pa)-1] } -// Last returns the last PathStep in the Path. -// If the path is empty, this returns a non-nil PathStep that reports a nil Type. +// Last returns the last [PathStep] in the Path. +// If the path is empty, this returns a non-nil [PathStep] +// that reports a nil [PathStep.Type]. func (pa Path) Last() PathStep { return pa.Index(-1) } @@ -79,7 +85,8 @@ func (pa Path) Last() PathStep { // Index returns the ith step in the Path and supports negative indexing. // A negative index starts counting from the tail of the Path such that -1 // refers to the last step, -2 refers to the second-to-last step, and so on. -// If index is invalid, this returns a non-nil PathStep that reports a nil Type. +// If index is invalid, this returns a non-nil [PathStep] +// that reports a nil [PathStep.Type]. func (pa Path) Index(i int) PathStep { if i < 0 { i = len(pa) + i @@ -168,7 +175,8 @@ func (ps pathStep) String() string { return fmt.Sprintf("{%s}", s) } -// StructField represents a struct field access on a field called Name. +// StructField is a [PathStep] that represents a struct field access +// on a field called [StructField.Name]. type StructField struct{ *structField } type structField struct { pathStep @@ -204,10 +212,11 @@ func (sf StructField) String() string { return fmt.Sprintf(".%s", sf.name) } func (sf StructField) Name() string { return sf.name } // Index is the index of the field in the parent struct type. -// See reflect.Type.Field. +// See [reflect.Type.Field]. func (sf StructField) Index() int { return sf.idx } -// SliceIndex is an index operation on a slice or array at some index Key. +// SliceIndex is a [PathStep] that represents an index operation on +// a slice or array at some index [SliceIndex.Key]. type SliceIndex struct{ *sliceIndex } type sliceIndex struct { pathStep @@ -247,12 +256,12 @@ func (si SliceIndex) Key() int { // all of the indexes to be shifted. If an index is -1, then that // indicates that the element does not exist in the associated slice. // -// Key is guaranteed to return -1 if and only if the indexes returned -// by SplitKeys are not the same. SplitKeys will never return -1 for +// [SliceIndex.Key] is guaranteed to return -1 if and only if the indexes +// returned by SplitKeys are not the same. SplitKeys will never return -1 for // both indexes. func (si SliceIndex) SplitKeys() (ix, iy int) { return si.xkey, si.ykey } -// MapIndex is an index operation on a map at some index Key. +// MapIndex is a [PathStep] that represents an index operation on a map at some index Key. type MapIndex struct{ *mapIndex } type mapIndex struct { pathStep @@ -266,7 +275,7 @@ func (mi MapIndex) String() string { return fmt.Sprintf("[%#v]", // Key is the value of the map key. func (mi MapIndex) Key() reflect.Value { return mi.key } -// Indirect represents pointer indirection on the parent type. +// Indirect is a [PathStep] that represents pointer indirection on the parent type. type Indirect struct{ *indirect } type indirect struct { pathStep @@ -276,7 +285,7 @@ func (in Indirect) Type() reflect.Type { return in.typ } func (in Indirect) Values() (vx, vy reflect.Value) { return in.vx, in.vy } func (in Indirect) String() string { return "*" } -// TypeAssertion represents a type assertion on an interface. +// TypeAssertion is a [PathStep] that represents a type assertion on an interface. type TypeAssertion struct{ *typeAssertion } type typeAssertion struct { pathStep @@ -286,7 +295,8 @@ func (ta TypeAssertion) Type() reflect.Type { return ta.typ } func (ta TypeAssertion) Values() (vx, vy reflect.Value) { return ta.vx, ta.vy } func (ta TypeAssertion) String() string { return fmt.Sprintf(".(%v)", value.TypeString(ta.typ, false)) } -// Transform is a transformation from the parent type to the current type. +// Transform is a [PathStep] that represents a transformation +// from the parent type to the current type. type Transform struct{ *transform } type transform struct { pathStep @@ -297,13 +307,13 @@ func (tf Transform) Type() reflect.Type { return tf.typ } func (tf Transform) Values() (vx, vy reflect.Value) { return tf.vx, tf.vy } func (tf Transform) String() string { return fmt.Sprintf("%s()", tf.trans.name) } -// Name is the name of the Transformer. +// Name is the name of the [Transformer]. func (tf Transform) Name() string { return tf.trans.name } // Func is the function pointer to the transformer function. func (tf Transform) Func() reflect.Value { return tf.trans.fnc } -// Option returns the originally constructed Transformer option. +// Option returns the originally constructed [Transformer] option. // The == operator can be used to detect the exact option used. func (tf Transform) Option() Option { return tf.trans } diff --git a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/report_reflect.go b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/report_reflect.go index 2ab41fa..e39f422 100644 --- a/testdata/src/a/vendor/github.com/google/go-cmp/cmp/report_reflect.go +++ b/testdata/src/a/vendor/github.com/google/go-cmp/cmp/report_reflect.go @@ -199,7 +199,7 @@ func (opts formatOptions) FormatValue(v reflect.Value, parentKind reflect.Kind, break } sf := t.Field(i) - if supportExporters && !isExported(sf.Name) { + if !isExported(sf.Name) { vv = retrieveUnexportedField(v, sf, true) } s := opts.WithTypeMode(autoType).FormatValue(vv, t.Kind(), ptrs) diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/CHANGELOG.md b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/CHANGELOG.md index f4671ec..fea6752 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/CHANGELOG.md +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/CHANGELOG.md @@ -1,3 +1,62 @@ +## 2.13.0 + +### Features + +Add PreviewSpect() to enable programmatic preview access to the suite report (fixes #1225) + +## 2.12.1 + +### Fixes +- Print logr prefix if it exists (#1275) [90d4846] + +### Maintenance +- Bump actions/checkout from 3 to 4 (#1271) [555f543] +- Bump golang.org/x/sys from 0.11.0 to 0.12.0 (#1270) [d867b7d] + +## 2.12.0 + +### Features + +- feat: allow MustPassRepeatedly decorator to be set at suite level (#1266) [05de518] + +### Fixes + +- fix-errors-in-readme (#1244) [27c2f5d] + +### Maintenance + +Various chores/dependency bumps. + +## 2.11.0 + +In prior versions of Ginkgo specs the CLI filter flags (e.g. `--focus`, `--label-filter`) would _override_ any programmatic focus. This behavior has proved surprising and confusing in at least the following ways: + +- users cannot combine programmatic filters and CLI filters to more efficiently select subsets of tests +- CLI filters can override programmatic focus on CI systems resulting in an exit code of 0 despite the presence of (incorrectly!) committed focused specs. + +Going forward Ginkgo will AND all programmatic and CLI filters. Moreover, the presence of any programmatic focused tests will always result in a non-zero exit code. + +This change is technically a change in Ginkgo's external contract and may require some users to make changes to successfully adopt. Specifically: it's possible some users were intentionally using CLI filters to override programmatic focus. If this is you please open an issue so we can explore solutions to the underlying problem you are trying to solve. + +### Fixes +- Programmatic focus is no longer overwrriten by CLI filters [d6bba86] + +### Maintenance +- Bump github.com/onsi/gomega from 1.27.7 to 1.27.8 (#1218) [4a70a38] +- Bump golang.org/x/sys from 0.8.0 to 0.9.0 (#1219) [97eda4d] + +## 2.10.0 + +### Features +- feat(ginkgo/generators): add --tags flag (#1216) [a782a77] + adds a new --tags flag to ginkgo generate + +### Fixes +- Fix broken link of MIGRATING_TO_V2.md (#1217) [548d78e] + +### Maintenance +- Bump golang.org/x/tools from 0.9.1 to 0.9.3 (#1215) [2b76a5e] + ## 2.9.7 ### Fixes diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/README.md b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/README.md index d0473a4..cb23ffd 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/README.md +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/README.md @@ -15,7 +15,7 @@ import ( ... ) -Describe("Checking books out of the library", Label("library"), func() { +var _ = Describe("Checking books out of the library", Label("library"), func() { var library *libraries.Library var book *books.Book var valjean *users.User @@ -50,7 +50,7 @@ Describe("Checking books out of the library", Label("library"), func() { It("tells the user", func(ctx SpecContext) { err := valjean.Checkout(ctx, library, "Les Miserables") - Expect(error).To(MatchError("Les Miserables is currently checked out")) + Expect(err).To(MatchError("Les Miserables is currently checked out")) }, SpecTimeout(time.Second * 5)) It("lets the user place a hold and get notified later", func(ctx SpecContext) { @@ -74,7 +74,7 @@ Describe("Checking books out of the library", Label("library"), func() { When("the library does not have the book in question", func() { It("tells the reader the book is unavailable", func(ctx SpecContext) { err := valjean.Checkout(ctx, library, "Les Miserables") - Expect(error).To(MatchError("Les Miserables is not in the library catalog")) + Expect(err).To(MatchError("Les Miserables is not in the library catalog")) }, SpecTimeout(time.Second * 5)) }) }) diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/core_dsl.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/core_dsl.go index a244bdc..2d7a70e 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/core_dsl.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/core_dsl.go @@ -248,31 +248,13 @@ func RunSpecs(t GinkgoTestingT, description string, args ...interface{}) bool { exitIfErr(types.GinkgoErrors.RerunningSuite()) } suiteDidRun = true - - suiteLabels := Labels{} - configErrors := []error{} - for _, arg := range args { - switch arg := arg.(type) { - case types.SuiteConfig: - suiteConfig = arg - case types.ReporterConfig: - reporterConfig = arg - case Labels: - suiteLabels = append(suiteLabels, arg...) - default: - configErrors = append(configErrors, types.GinkgoErrors.UnknownTypePassedToRunSpecs(arg)) - } + err := global.PushClone() + if err != nil { + exitIfErr(err) } - exitIfErrors(configErrors) + defer global.PopClone() - configErrors = types.VetConfig(flagSet, suiteConfig, reporterConfig) - if len(configErrors) > 0 { - fmt.Fprintf(formatter.ColorableStdErr, formatter.F("{{red}}Ginkgo detected configuration issues:{{/}}\n")) - for _, err := range configErrors { - fmt.Fprintf(formatter.ColorableStdErr, err.Error()) - } - os.Exit(1) - } + suiteLabels := extractSuiteConfiguration(args) var reporter reporters.Reporter if suiteConfig.ParallelTotal == 1 { @@ -308,9 +290,8 @@ func RunSpecs(t GinkgoTestingT, description string, args ...interface{}) bool { registerReportAfterSuiteNodeForAutogeneratedReports(reporterConfig) } - err := global.Suite.BuildTree() + err = global.Suite.BuildTree() exitIfErr(err) - suitePath, err := os.Getwd() exitIfErr(err) suitePath, err = filepath.Abs(suitePath) @@ -335,6 +316,69 @@ func RunSpecs(t GinkgoTestingT, description string, args ...interface{}) bool { return passed } +func extractSuiteConfiguration(args []interface{}) Labels { + suiteLabels := Labels{} + configErrors := []error{} + for _, arg := range args { + switch arg := arg.(type) { + case types.SuiteConfig: + suiteConfig = arg + case types.ReporterConfig: + reporterConfig = arg + case Labels: + suiteLabels = append(suiteLabels, arg...) + default: + configErrors = append(configErrors, types.GinkgoErrors.UnknownTypePassedToRunSpecs(arg)) + } + } + exitIfErrors(configErrors) + + configErrors = types.VetConfig(flagSet, suiteConfig, reporterConfig) + if len(configErrors) > 0 { + fmt.Fprintf(formatter.ColorableStdErr, formatter.F("{{red}}Ginkgo detected configuration issues:{{/}}\n")) + for _, err := range configErrors { + fmt.Fprintf(formatter.ColorableStdErr, err.Error()) + } + os.Exit(1) + } + + return suiteLabels +} + +/* +PreviewSpecs walks the testing tree and produces a report without actually invoking the specs. +See http://onsi.github.io/ginkgo/#previewing-specs for more information. +*/ +func PreviewSpecs(description string, args ...any) Report { + err := global.PushClone() + if err != nil { + exitIfErr(err) + } + defer global.PopClone() + + suiteLabels := extractSuiteConfiguration(args) + priorDryRun, priorParallelTotal, priorParallelProcess := suiteConfig.DryRun, suiteConfig.ParallelTotal, suiteConfig.ParallelProcess + suiteConfig.DryRun, suiteConfig.ParallelTotal, suiteConfig.ParallelProcess = true, 1, 1 + defer func() { + suiteConfig.DryRun, suiteConfig.ParallelTotal, suiteConfig.ParallelProcess = priorDryRun, priorParallelTotal, priorParallelProcess + }() + reporter := reporters.NoopReporter{} + outputInterceptor = internal.NoopOutputInterceptor{} + client = nil + writer := GinkgoWriter.(*internal.Writer) + + err = global.Suite.BuildTree() + exitIfErr(err) + suitePath, err := os.Getwd() + exitIfErr(err) + suitePath, err = filepath.Abs(suitePath) + exitIfErr(err) + + global.Suite.Run(description, suiteLabels, suitePath, global.Failer, reporter, writer, outputInterceptor, interrupt_handler.NewInterruptHandler(client), client, internal.RegisterForProgressSignal, suiteConfig) + + return global.Suite.GetPreviewReport() +} + /* Skip instructs Ginkgo to skip the current spec diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go index 48d23f9..be01dec 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_command.go @@ -32,6 +32,9 @@ func BuildGenerateCommand() command.Command { {Name: "template-data", KeyPath: "CustomTemplateData", UsageArgument: "template-data-file", Usage: "If specified, generate will use the contents of the file passed as data to be rendered in the test file template"}, + {Name: "tags", KeyPath: "Tags", + UsageArgument: "build-tags", + Usage: "If specified, generate will create a test file that uses the given build tags (i.e. `--tags e2e,!unit` will add `//go:build e2e,!unit`)"}, }, &conf, types.GinkgoFlagSections{}, @@ -59,6 +62,7 @@ You can also pass a of the form "file.go" and generate will emit "fil } type specData struct { + BuildTags string Package string Subject string PackageImportPath string @@ -93,6 +97,7 @@ func generateTestFileForSubject(subject string, conf GeneratorsConfig) { } data := specData{ + BuildTags: getBuildTags(conf.Tags), Package: determinePackageName(packageName, conf.Internal), Subject: formattedName, PackageImportPath: getPackageImportPath(), diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go index c3470ad..4dab07d 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generate_templates.go @@ -1,6 +1,7 @@ package generators -var specText = `package {{.Package}} +var specText = `{{.BuildTags}} +package {{.Package}} import ( {{.GinkgoImport}} @@ -14,7 +15,8 @@ var _ = {{.GinkgoPackage}}Describe("{{.Subject}}", func() { }) ` -var agoutiSpecText = `package {{.Package}} +var agoutiSpecText = `{{.BuildTags}} +package {{.Package}} import ( {{.GinkgoImport}} diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go index 3046a44..28c7aa6 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/generators/generators_common.go @@ -1,6 +1,7 @@ package generators import ( + "fmt" "go/build" "os" "path/filepath" @@ -14,6 +15,7 @@ type GeneratorsConfig struct { Agouti, NoDot, Internal bool CustomTemplate string CustomTemplateData string + Tags string } func getPackageAndFormattedName() (string, string, string) { @@ -62,3 +64,13 @@ func determinePackageName(name string, internal bool) string { return name + "_test" } + +// getBuildTags returns the resultant string to be added. +// If the input string is not empty, then returns a `//go:build {}` string, +// otherwise returns an empty string. +func getBuildTags(tags string) string { + if tags != "" { + return fmt.Sprintf("//go:build %s\n", tags) + } + return "" +} diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go index 0b9b19f..958dacc 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/ginkgo/outline/ginkgo.go @@ -244,9 +244,7 @@ func labelFromCallExpr(ce *ast.CallExpr) []string { } if id.Name == "Label" { ls := extractLabels(expr) - for _, label := range ls { - labels = append(labels, label) - } + labels = append(labels, ls...) } } } diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/focus.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/focus.go index 966ea0c..e3da7d1 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/focus.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/focus.go @@ -8,22 +8,22 @@ import ( ) /* - If a container marked as focus has a descendant that is also marked as focus, Ginkgo's policy is to - unmark the container's focus. This gives developers a more intuitive experience when debugging specs. - It is common to focus a container to just run a subset of specs, then identify the specific specs within the container to focus - - this policy allows the developer to simply focus those specific specs and not need to go back and turn the focus off of the container: - - As a common example, consider: - - FDescribe("something to debug", function() { - It("works", function() {...}) - It("works", function() {...}) - FIt("doesn't work", function() {...}) - It("works", function() {...}) - }) - - here the developer's intent is to focus in on the `"doesn't work"` spec and not to run the adjacent specs in the focused `"something to debug"` container. - The nested policy applied by this function enables this behavior. +If a container marked as focus has a descendant that is also marked as focus, Ginkgo's policy is to +unmark the container's focus. This gives developers a more intuitive experience when debugging specs. +It is common to focus a container to just run a subset of specs, then identify the specific specs within the container to focus - +this policy allows the developer to simply focus those specific specs and not need to go back and turn the focus off of the container: + +As a common example, consider: + + FDescribe("something to debug", function() { + It("works", function() {...}) + It("works", function() {...}) + FIt("doesn't work", function() {...}) + It("works", function() {...}) + }) + +here the developer's intent is to focus in on the `"doesn't work"` spec and not to run the adjacent specs in the focused `"something to debug"` container. +The nested policy applied by this function enables this behavior. */ func ApplyNestedFocusPolicyToTree(tree *TreeNode) { var walkTree func(tree *TreeNode) bool @@ -44,46 +44,43 @@ func ApplyNestedFocusPolicyToTree(tree *TreeNode) { } /* - Ginkgo supports focussing specs using `FIt`, `FDescribe`, etc. - this is called "programmatic focus" - It also supports focussing specs using regular expressions on the command line (`-focus=`, `-skip=`) that match against spec text - and file filters (`-focus-files=`, `-skip-files=`) that match against code locations for nodes in specs. +Ginkgo supports focussing specs using `FIt`, `FDescribe`, etc. - this is called "programmatic focus" +It also supports focussing specs using regular expressions on the command line (`-focus=`, `-skip=`) that match against spec text and file filters (`-focus-files=`, `-skip-files=`) that match against code locations for nodes in specs. - If any of the CLI flags are provided they take precedence. The file filters run first followed by the regex filters. +When both programmatic and file filters are provided their results are ANDed together. If multiple kinds of filters are provided, the file filters run first followed by the regex filters. - This function sets the `Skip` property on specs by applying Ginkgo's focus policy: - - If there are no CLI arguments and no programmatic focus, do nothing. - - If there are no CLI arguments but a spec somewhere has programmatic focus, skip any specs that have no programmatic focus. - - If there are CLI arguments parse them and skip any specs that either don't match the focus filters or do match the skip filters. +This function sets the `Skip` property on specs by applying Ginkgo's focus policy: +- If there are no CLI arguments and no programmatic focus, do nothing. +- If a spec somewhere has programmatic focus skip any specs that have no programmatic focus. +- If there are CLI arguments parse them and skip any specs that either don't match the focus filters or do match the skip filters. - *Note:* specs with pending nodes are Skipped when created by NewSpec. +*Note:* specs with pending nodes are Skipped when created by NewSpec. */ func ApplyFocusToSpecs(specs Specs, description string, suiteLabels Labels, suiteConfig types.SuiteConfig) (Specs, bool) { focusString := strings.Join(suiteConfig.FocusStrings, "|") skipString := strings.Join(suiteConfig.SkipStrings, "|") - hasFocusCLIFlags := focusString != "" || skipString != "" || len(suiteConfig.SkipFiles) > 0 || len(suiteConfig.FocusFiles) > 0 || suiteConfig.LabelFilter != "" - type SkipCheck func(spec Spec) bool // by default, skip any specs marked pending skipChecks := []SkipCheck{func(spec Spec) bool { return spec.Nodes.HasNodeMarkedPending() }} hasProgrammaticFocus := false - if !hasFocusCLIFlags { - // check for programmatic focus - for _, spec := range specs { - if spec.Nodes.HasNodeMarkedFocus() && !spec.Nodes.HasNodeMarkedPending() { - skipChecks = append(skipChecks, func(spec Spec) bool { return !spec.Nodes.HasNodeMarkedFocus() }) - hasProgrammaticFocus = true - break - } + for _, spec := range specs { + if spec.Nodes.HasNodeMarkedFocus() && !spec.Nodes.HasNodeMarkedPending() { + hasProgrammaticFocus = true + break } } + if hasProgrammaticFocus { + skipChecks = append(skipChecks, func(spec Spec) bool { return !spec.Nodes.HasNodeMarkedFocus() }) + } + if suiteConfig.LabelFilter != "" { labelFilter, _ := types.ParseLabelFilter(suiteConfig.LabelFilter) - skipChecks = append(skipChecks, func(spec Spec) bool { - return !labelFilter(UnionOfLabels(suiteLabels, spec.Nodes.UnionOfLabels())) + skipChecks = append(skipChecks, func(spec Spec) bool { + return !labelFilter(UnionOfLabels(suiteLabels, spec.Nodes.UnionOfLabels())) }) } diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/global/init.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/global/init.go index f2c0fd8..464e3c9 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/global/init.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/global/init.go @@ -6,6 +6,7 @@ import ( var Suite *internal.Suite var Failer *internal.Failer +var backupSuite *internal.Suite func init() { InitializeGlobals() @@ -15,3 +16,13 @@ func InitializeGlobals() { Failer = internal.NewFailer() Suite = internal.NewSuite() } + +func PushClone() error { + var err error + backupSuite, err = Suite.Clone() + return err +} + +func PopClone() { + Suite = backupSuite +} diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/group.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/group.go index ae1b7b0..02c9fe4 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/group.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/group.go @@ -321,7 +321,10 @@ func (g *group) run(specs Specs) { if !skip { var maxAttempts = 1 - if g.suite.currentSpecReport.MaxMustPassRepeatedly > 0 { + if g.suite.config.MustPassRepeatedly > 0 { + maxAttempts = g.suite.config.MustPassRepeatedly + g.suite.currentSpecReport.MaxMustPassRepeatedly = maxAttempts + } else if g.suite.currentSpecReport.MaxMustPassRepeatedly > 0 { maxAttempts = max(1, spec.MustPassRepeatedly()) } else if g.suite.config.FlakeAttempts > 0 { maxAttempts = g.suite.config.FlakeAttempts diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/node.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/node.go index 14c7cf5..16f0dc2 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/node.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/node.go @@ -597,12 +597,16 @@ func (n Node) IsZero() bool { /* Nodes */ type Nodes []Node +func (n Nodes) Clone() Nodes { + nodes := make(Nodes, len(n)) + copy(nodes, n) + return nodes +} + func (n Nodes) CopyAppend(nodes ...Node) Nodes { numN := len(n) out := make(Nodes, numN+len(nodes)) - for i, node := range n { - out[i] = node - } + copy(out, n) for j, node := range nodes { out[numN+j] = node } diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/suite.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/suite.go index ea0d259..fe6e828 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/suite.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/suite.go @@ -77,6 +77,20 @@ func NewSuite() *Suite { } } +func (suite *Suite) Clone() (*Suite, error) { + if suite.phase != PhaseBuildTopLevel { + return nil, fmt.Errorf("cnanot clone suite after tree has been built") + } + return &Suite{ + tree: &TreeNode{}, + phase: PhaseBuildTopLevel, + ProgressReporterManager: NewProgressReporterManager(), + topLevelContainers: suite.topLevelContainers.Clone(), + suiteNodes: suite.suiteNodes.Clone(), + selectiveLock: &sync.Mutex{}, + }, nil +} + func (suite *Suite) BuildTree() error { // During PhaseBuildTopLevel, the top level containers are stored in suite.topLevelCotainers and entered // We now enter PhaseBuildTree where these top level containers are entered and added to the spec tree @@ -328,6 +342,16 @@ func (suite *Suite) CurrentSpecReport() types.SpecReport { return report } +// Only valid in the preview context. In general suite.report only includes +// the specs run by _this_ node - it is only at the end of the suite that +// the parallel reports are aggregated. However in the preview context we run +// in series and +func (suite *Suite) GetPreviewReport() types.Report { + suite.selectiveLock.Lock() + defer suite.selectiveLock.Unlock() + return suite.report +} + func (suite *Suite) AddReportEntry(entry ReportEntry) error { if suite.phase != PhaseRun { return types.GinkgoErrors.AddReportEntryNotDuringRunPhase(entry.Location) diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/writer.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/writer.go index 574f172..aab42d5 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/writer.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/internal/writer.go @@ -135,6 +135,10 @@ func (w *Writer) Println(a ...interface{}) { func GinkgoLogrFunc(writer *Writer) logr.Logger { return funcr.New(func(prefix, args string) { - writer.Printf("%s\n", args) + if prefix == "" { + writer.Printf("%s\n", args) + } else { + writer.Printf("%s %s\n", prefix, args) + } }, funcr.Options{}) } diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/config.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/config.go index 1014c7b..c88fc85 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/config.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/config.go @@ -27,6 +27,7 @@ type SuiteConfig struct { FailOnPending bool FailFast bool FlakeAttempts int + MustPassRepeatedly int DryRun bool PollProgressAfter time.Duration PollProgressInterval time.Duration diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/errors.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/errors.go index 1e0dbfd..4fbdc3e 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/errors.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/errors.go @@ -453,8 +453,8 @@ func (g ginkgoErrors) InvalidEntryDescription(cl CodeLocation) error { func (g ginkgoErrors) MissingParametersForTableFunction(cl CodeLocation) error { return GinkgoError{ - Heading: fmt.Sprintf("No parameters have been passed to the Table Function"), - Message: fmt.Sprintf("The Table Function expected at least 1 parameter"), + Heading: "No parameters have been passed to the Table Function", + Message: "The Table Function expected at least 1 parameter", CodeLocation: cl, DocLink: "table-specs", } diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/types.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/types.go index d048a8a..aae69b0 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/types.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/types.go @@ -97,9 +97,7 @@ func (report Report) Add(other Report) Report { report.RunTime = report.EndTime.Sub(report.StartTime) reports := make(SpecReports, len(report.SpecReports)+len(other.SpecReports)) - for i := range report.SpecReports { - reports[i] = report.SpecReports[i] - } + copy(reports, report.SpecReports) offset := len(report.SpecReports) for i := range other.SpecReports { reports[i+offset] = other.SpecReports[i] diff --git a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/version.go b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/version.go index 6bc4615..a37f308 100644 --- a/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/version.go +++ b/testdata/src/a/vendor/github.com/onsi/ginkgo/v2/types/version.go @@ -1,3 +1,3 @@ package types -const VERSION = "2.9.7" +const VERSION = "2.13.0" diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/CHANGELOG.md b/testdata/src/a/vendor/github.com/onsi/gomega/CHANGELOG.md index 07a3a5a..4fc45f2 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/CHANGELOG.md +++ b/testdata/src/a/vendor/github.com/onsi/gomega/CHANGELOG.md @@ -1,3 +1,59 @@ +## 1.29.0 + +### Features +- MatchError can now take an optional func(error) bool + description [2b39142] + +## 1.28.1 + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.12.0 to 2.13.0 [635d196] +- Bump github.com/google/go-cmp from 0.5.9 to 0.6.0 [14f8859] +- Bump golang.org/x/net from 0.14.0 to 0.17.0 [d8a6508] +- #703 doc(matchers): HaveEach() doc comment updated [2705bdb] +- Minor typos (#699) [375648c] + +## 1.28.0 + +### Features +- Add VerifyHost handler to ghttp (#698) [0b03b36] + +### Fixes +- Read Body for Newer Responses in HaveHTTPBodyMatcher (#686) [18d6673] + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.11.0 to 2.12.0 (#693) [55a33f3] +- Typo in matchers.go (#691) [de68e8f] +- Bump commonmarker from 0.23.9 to 0.23.10 in /docs (#690) [ab17f5e] +- chore: update test matrix for Go 1.21 (#689) [5069017] +- Bump golang.org/x/net from 0.12.0 to 0.14.0 (#688) [babe25f] + +## 1.27.10 + +### Fixes +- fix: go 1.21 adding goroutine ID to creator+location (#685) [bdc7803] + +## 1.27.9 + +### Fixes +- Prevent nil-dereference in format.Object for boxed nil error (#681) [3b31fc3] + +### Maintenance +- Bump golang.org/x/net from 0.11.0 to 0.12.0 (#679) [360849b] +- chore: use String() instead of fmt.Sprintf (#678) [86f3659] +- Bump golang.org/x/net from 0.10.0 to 0.11.0 (#674) [642ead0] +- chore: unnecessary use of fmt.Sprintf (#677) [ceb9ca6] +- Bump github.com/onsi/ginkgo/v2 from 2.10.0 to 2.11.0 (#675) [a2087d8] +- docs: fix ContainSubstring references (#673) [fc9a89f] +- Bump github.com/onsi/ginkgo/v2 from 2.9.7 to 2.10.0 (#671) [9076019] + +## 1.27.8 + +### Fixes +- HaveExactElement should not call FailureMessage if a submatcher returned an error [096f392] + +### Maintenance +- Bump github.com/onsi/ginkgo/v2 from 2.9.5 to 2.9.7 (#669) [8884bee] + ## 1.27.7 ### Fixes diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/format/format.go b/testdata/src/a/vendor/github.com/onsi/gomega/format/format.go index 56bdd05..6c16806 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/format/format.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/format/format.go @@ -259,7 +259,7 @@ func Object(object interface{}, indentation uint) string { indent := strings.Repeat(Indent, int(indentation)) value := reflect.ValueOf(object) commonRepresentation := "" - if err, ok := object.(error); ok { + if err, ok := object.(error); ok && !isNilValue(value) { // isNilValue check needed here to avoid nil deref due to boxed nil commonRepresentation += "\n" + IndentString(err.Error(), indentation) + "\n" + indent } return fmt.Sprintf("%s<%s>: %s%s", indent, formatType(value), commonRepresentation, formatValue(value, indentation)) @@ -302,7 +302,7 @@ func formatType(v reflect.Value) string { case reflect.Map: return fmt.Sprintf("%s | len:%d", v.Type(), v.Len()) default: - return fmt.Sprintf("%s", v.Type()) + return v.Type().String() } } diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/gomega_dsl.go b/testdata/src/a/vendor/github.com/onsi/gomega/gomega_dsl.go index 82ef524..ba08214 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/gomega_dsl.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/gomega_dsl.go @@ -22,7 +22,7 @@ import ( "github.com/onsi/gomega/types" ) -const GOMEGA_VERSION = "1.27.7" +const GOMEGA_VERSION = "1.29.0" const nilGomegaPanic = `You are trying to make an assertion, but haven't registered Gomega's fail handler. If you're using Ginkgo then you probably forgot to put your assertion in an It(). @@ -242,7 +242,7 @@ func ExpectWithOffset(offset int, actual interface{}, extra ...interface{}) Asse Eventually enables making assertions on asynchronous behavior. Eventually checks that an assertion *eventually* passes. Eventually blocks when called and attempts an assertion periodically until it passes or a timeout occurs. Both the timeout and polling interval are configurable as optional arguments. -The first optional argument is the timeout (which defaults to 1s), the second is the polling interval (which defaults to 10ms). Both intervals can be specified as time.Duration, parsable duration strings or floats/integers (in which case they are interpreted as seconds). In addition an optional context.Context can be passed in - Eventually will keep trying until either the timeout epxires or the context is cancelled, whichever comes first. +The first optional argument is the timeout (which defaults to 1s), the second is the polling interval (which defaults to 10ms). Both intervals can be specified as time.Duration, parsable duration strings or floats/integers (in which case they are interpreted as seconds). In addition an optional context.Context can be passed in - Eventually will keep trying until either the timeout expires or the context is cancelled, whichever comes first. Eventually works with any Gomega compatible matcher and supports making assertions against three categories of actual value: @@ -313,13 +313,13 @@ It is important to note that the function passed into Eventually is invoked *syn }).Should(BeNumerically(">=", 17)) }, SpecTimeout(time.Second)) -you an also use Eventually().WithContext(ctx) to pass in the context. Passed-in contexts play nicely with paseed-in arguments as long as the context appears first. You can rewrite the above example as: +you an also use Eventually().WithContext(ctx) to pass in the context. Passed-in contexts play nicely with passed-in arguments as long as the context appears first. You can rewrite the above example as: It("fetches the correct count", func(ctx SpecContext) { Eventually(client.FetchCount).WithContext(ctx).WithArguments("/users").Should(BeNumerically(">=", 17)) }, SpecTimeout(time.Second)) -Either way the context passd to Eventually is also passed to the underlying funciton. Now, when Ginkgo cancels the context both the FetchCount client and Gomega will be informed and can exit. +Either way the context passd to Eventually is also passed to the underlying function. Now, when Ginkgo cancels the context both the FetchCount client and Gomega will be informed and can exit. **Category 3: Making assertions _in_ the function passed into Eventually** @@ -349,7 +349,7 @@ For example: will rerun the function until all assertions pass. -You can also pass additional arugments to functions that take a Gomega. The only rule is that the Gomega argument must be first. If you also want to pass the context attached to Eventually you must ensure that is the second argument. For example: +You can also pass additional arguments to functions that take a Gomega. The only rule is that the Gomega argument must be first. If you also want to pass the context attached to Eventually you must ensure that is the second argument. For example: Eventually(func(g Gomega, ctx context.Context, path string, expected ...string){ tok, err := client.GetToken(ctx) diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers.go index b832f3d..cd3f431 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers.go @@ -88,19 +88,44 @@ func Succeed() types.GomegaMatcher { } // MatchError succeeds if actual is a non-nil error that matches the passed in -// string, error, or matcher. +// string, error, function, or matcher. // // These are valid use-cases: // -// Expect(err).Should(MatchError("an error")) //asserts that err.Error() == "an error" -// Expect(err).Should(MatchError(SomeError)) //asserts that err == SomeError (via reflect.DeepEqual) -// Expect(err).Should(MatchError(ContainsSubstring("sprocket not found"))) // asserts that edrr.Error() contains substring "sprocket not found" +// When passed a string: +// +// Expect(err).To(MatchError("an error")) +// +// asserts that err.Error() == "an error" +// +// When passed an error: +// +// Expect(err).To(MatchError(SomeError)) +// +// First checks if errors.Is(err, SomeError). +// If that fails then it checks if reflect.DeepEqual(err, SomeError) repeatedly for err and any errors wrapped by err +// +// When passed a matcher: +// +// Expect(err).To(MatchError(ContainSubstring("sprocket not found"))) +// +// the matcher is passed err.Error(). In this case it asserts that err.Error() contains substring "sprocket not found" +// +// When passed a func(err) bool and a description: +// +// Expect(err).To(MatchError(os.IsNotExist, "IsNotExist")) +// +// the function is passed err and matches if the return value is true. The description is required to allow Gomega +// to print a useful error message. // // It is an error for err to be nil or an object that does not implement the // Error interface -func MatchError(expected interface{}) types.GomegaMatcher { +// +// The optional second argument is a description of the error function, if used. This is required when passing a function but is ignored in all other cases. +func MatchError(expected interface{}, functionErrorDescription ...any) types.GomegaMatcher { return &matchers.MatchErrorMatcher{ - Expected: expected, + Expected: expected, + FuncErrDescription: functionErrorDescription, } } @@ -381,7 +406,7 @@ func ContainElements(elements ...interface{}) types.GomegaMatcher { } // HaveEach succeeds if actual solely contains elements that match the passed in element. -// Please note that if actual is empty, HaveEach always will succeed. +// Please note that if actual is empty, HaveEach always will fail. // By default HaveEach() uses Equal() to perform the match, however a // matcher can be passed in instead: // diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go index acffc85..93d4497 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_directory.go @@ -52,5 +52,5 @@ func (matcher *BeADirectoryMatcher) FailureMessage(actual interface{}) (message } func (matcher *BeADirectoryMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not be a directory")) + return format.Message(actual, "not be a directory") } diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go index 89441c8..8fefc4d 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_a_regular_file.go @@ -52,5 +52,5 @@ func (matcher *BeARegularFileMatcher) FailureMessage(actual interface{}) (messag } func (matcher *BeARegularFileMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not be a regular file")) + return format.Message(actual, "not be a regular file") } diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go index ec6506b..e2bdd28 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/be_an_existing_file.go @@ -32,9 +32,9 @@ func (matcher *BeAnExistingFileMatcher) Match(actual interface{}) (success bool, } func (matcher *BeAnExistingFileMatcher) FailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("to exist")) + return format.Message(actual, "to exist") } func (matcher *BeAnExistingFileMatcher) NegatedFailureMessage(actual interface{}) (message string) { - return format.Message(actual, fmt.Sprintf("not to exist")) + return format.Message(actual, "not to exist") } diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go index 7cce776..dca5b94 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_exact_elements.go @@ -44,7 +44,12 @@ func (matcher *HaveExactElementsMatcher) Match(actual interface{}) (success bool elemMatcher := matchers[i].(omegaMatcher) match, err := elemMatcher.Match(values[i]) - if err != nil || !match { + if err != nil { + matcher.mismatchFailures = append(matcher.mismatchFailures, mismatchFailure{ + index: i, + failure: err.Error(), + }) + } else if !match { matcher.mismatchFailures = append(matcher.mismatchFailures, mismatchFailure{ index: i, failure: elemMatcher.FailureMessage(values[i]), diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go index 6a3dcdc..d14d9e5 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/have_http_body_matcher.go @@ -11,8 +11,9 @@ import ( ) type HaveHTTPBodyMatcher struct { - Expected interface{} - cachedBody []byte + Expected interface{} + cachedResponse interface{} + cachedBody []byte } func (matcher *HaveHTTPBodyMatcher) Match(actual interface{}) (bool, error) { @@ -73,7 +74,7 @@ func (matcher *HaveHTTPBodyMatcher) NegatedFailureMessage(actual interface{}) (m // the Reader is closed and it is not readable again in FailureMessage() // or NegatedFailureMessage() func (matcher *HaveHTTPBodyMatcher) body(actual interface{}) ([]byte, error) { - if matcher.cachedBody != nil { + if matcher.cachedResponse == actual && matcher.cachedBody != nil { return matcher.cachedBody, nil } @@ -91,8 +92,10 @@ func (matcher *HaveHTTPBodyMatcher) body(actual interface{}) ([]byte, error) { switch a := actual.(type) { case *http.Response: + matcher.cachedResponse = a return body(a) case *httptest.ResponseRecorder: + matcher.cachedResponse = a return body(a.Result()) default: return nil, fmt.Errorf("HaveHTTPBody matcher expects *http.Response or *httptest.ResponseRecorder. Got:\n%s", format.Object(actual, 1)) diff --git a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go index 827475e..c539dd3 100644 --- a/testdata/src/a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go +++ b/testdata/src/a/vendor/github.com/onsi/gomega/matchers/match_error_matcher.go @@ -9,10 +9,14 @@ import ( ) type MatchErrorMatcher struct { - Expected interface{} + Expected any + FuncErrDescription []any + isFunc bool } -func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err error) { +func (matcher *MatchErrorMatcher) Match(actual any) (success bool, err error) { + matcher.isFunc = false + if isNil(actual) { return false, fmt.Errorf("Expected an error, got nil") } @@ -42,6 +46,17 @@ func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err e return actualErr.Error() == expected, nil } + v := reflect.ValueOf(expected) + t := v.Type() + errorInterface := reflect.TypeOf((*error)(nil)).Elem() + if t.Kind() == reflect.Func && t.NumIn() == 1 && t.In(0).Implements(errorInterface) && t.NumOut() == 1 && t.Out(0).Kind() == reflect.Bool { + if len(matcher.FuncErrDescription) == 0 { + return false, fmt.Errorf("MatchError requires an additional description when passed a function") + } + matcher.isFunc = true + return v.Call([]reflect.Value{reflect.ValueOf(actualErr)})[0].Bool(), nil + } + var subMatcher omegaMatcher var hasSubMatcher bool if expected != nil { @@ -57,9 +72,15 @@ func (matcher *MatchErrorMatcher) Match(actual interface{}) (success bool, err e } func (matcher *MatchErrorMatcher) FailureMessage(actual interface{}) (message string) { + if matcher.isFunc { + return format.Message(actual, fmt.Sprintf("to match error function %s", matcher.FuncErrDescription[0])) + } return format.Message(actual, "to match error", matcher.Expected) } func (matcher *MatchErrorMatcher) NegatedFailureMessage(actual interface{}) (message string) { + if matcher.isFunc { + return format.Message(actual, fmt.Sprintf("not to match error function %s", matcher.FuncErrDescription[0])) + } return format.Message(actual, "not to match error", matcher.Expected) } diff --git a/testdata/src/a/vendor/golang.org/x/net/html/render.go b/testdata/src/a/vendor/golang.org/x/net/html/render.go index 8b28031..e8c1233 100644 --- a/testdata/src/a/vendor/golang.org/x/net/html/render.go +++ b/testdata/src/a/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/testdata/src/a/vendor/golang.org/x/net/html/token.go b/testdata/src/a/vendor/golang.org/x/net/html/token.go index 5c2a1f4..de67f93 100644 --- a/testdata/src/a/vendor/golang.org/x/net/html/token.go +++ b/testdata/src/a/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/mkall.sh b/testdata/src/a/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c..e6f31d3 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/mkerrors.sh b/testdata/src/a/vendor/golang.org/x/sys/unix/mkerrors.sh index be0423e..47fa6a7 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -519,7 +519,7 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || @@ -583,6 +583,7 @@ ccflags="$@" $2 ~ /^PERF_/ || $2 ~ /^SECCOMP_MODE_/ || $2 ~ /^SEEK_/ || + $2 ~ /^SCHED_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || $2 !~ /IOC_MAGIC/ && @@ -624,7 +625,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -741,7 +742,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -760,7 +762,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/testdata/src/a/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 0000000..ca05136 --- /dev/null +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,14 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris +// +build aix darwin dragonfly freebsd openbsd solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/mremap.go b/testdata/src/a/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 0000000..fa93d0a --- /dev/null +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,53 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd +// +build linux netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_darwin.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_darwin.go index 39dba6c..463c3ef 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_darwin.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_darwin.go @@ -7,12 +7,6 @@ package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) error { return ptrace1(request, pid, addr, data) } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) error { - return ptrace1Ptr(request, pid, addr, data) -} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_ios.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_ios.go index 9ea6633..ed0509a 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_ios.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ptrace_ios.go @@ -7,12 +7,6 @@ package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) { return ENOTSUP } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - return ENOTSUP -} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_aix.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_aix.go index c406ae0..e94e6cd 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -487,8 +487,6 @@ func Fsync(fd int) error { //sys Unlinkat(dirfd int, path string, flags int) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) //sys write(fd int, p []byte) (n int, err error) -//sys readlen(fd int, p *byte, np int) (n int, err error) = read -//sys writelen(fd int, p *byte, np int) (n int, err error) = write //sys Dup2(oldfd int, newfd int) (err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = posix_fadvise64 @@ -535,21 +533,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c32..4217de5 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -601,20 +601,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin.go index 2069215..59542a8 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) @@ -638,189 +644,3 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// sendfile -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go index 9fa8798..b37310c 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go @@ -47,6 +47,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT64 //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys Statfs(path string, stat *Statfs_t) (err error) = SYS_STATFS64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go index f17b8c5..d51ec99 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go @@ -47,6 +47,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT //sys Lstat(path string, stat *Stat_t) (err error) //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, stat *Statfs_t) (err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index d4ce988..97cb916 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -343,203 +343,5 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - * TODO(jsing): Update this list for DragonFly. - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Getxattr -// Fgetxattr -// Setxattr -// Fsetxattr -// Removexattr -// Fremovexattr -// Listxattr -// Flistxattr -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_freebsd.go index afb1010..64d1bb4 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -449,197 +449,5 @@ func Dup3(oldfd, newfd, flags int) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdents -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux.go index fbaeb5f..fb4e502 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -693,10 +693,10 @@ type SockaddrALG struct { func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { // Leave room for NUL byte terminator. - if len(sa.Type) > 13 { + if len(sa.Type) > len(sa.raw.Type)-1 { return nil, 0, EINVAL } - if len(sa.Name) > 63 { + if len(sa.Name) > len(sa.raw.Name)-1 { return nil, 0, EINVAL } @@ -704,17 +704,8 @@ func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { sa.raw.Feat = sa.Feature sa.raw.Mask = sa.Mask - typ, err := ByteSliceFromString(sa.Type) - if err != nil { - return nil, 0, err - } - name, err := ByteSliceFromString(sa.Name) - if err != nil { - return nil, 0, err - } - - copy(sa.raw.Type[:], typ) - copy(sa.raw.Name[:], name) + copy(sa.raw.Type[:], sa.Type) + copy(sa.raw.Name[:], sa.Name) return unsafe.Pointer(&sa.raw), SizeofSockaddrALG, nil } @@ -1699,12 +1690,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1874,7 +1876,7 @@ func Getpgrp() (pid int) { //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -1977,8 +1979,6 @@ func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) { //sys Unshare(flags int) (err error) //sys write(fd int, p []byte) (n int, err error) //sys exitThread(code int) (err error) = SYS_EXIT -//sys readlen(fd int, p *byte, np int) (n int, err error) = SYS_READ -//sys writelen(fd int, p *byte, np int) (n int, err error) = SYS_WRITE //sys readv(fd int, iovs []Iovec) (n int, err error) = SYS_READV //sys writev(fd int, iovs []Iovec) (n int, err error) = SYS_WRITEV //sys preadv(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr) (n int, err error) = SYS_PREADV @@ -2113,21 +2113,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2136,6 +2122,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2420,99 +2412,73 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } -/* - * Unimplemented - */ -// AfsSyscall -// ArchPrctl -// Brk -// ClockNanosleep -// ClockSettime -// Clone -// EpollCtlOld -// EpollPwait -// EpollWaitOld -// Execve -// Fork -// Futex -// GetKernelSyms -// GetMempolicy -// GetRobustList -// GetThreadArea -// Getpmsg -// IoCancel -// IoDestroy -// IoGetevents -// IoSetup -// IoSubmit -// IoprioGet -// IoprioSet -// KexecLoad -// LookupDcookie -// Mbind -// MigratePages -// Mincore -// ModifyLdt -// Mount -// MovePages -// MqGetsetattr -// MqNotify -// MqOpen -// MqTimedreceive -// MqTimedsend -// MqUnlink -// Mremap -// Msgctl -// Msgget -// Msgrcv -// Msgsnd -// Nfsservctl -// Personality -// Pselect6 -// Ptrace -// Putpmsg -// Quotactl -// Readahead -// Readv -// RemapFilePages -// RestartSyscall -// RtSigaction -// RtSigpending -// RtSigqueueinfo -// RtSigreturn -// RtSigsuspend -// RtSigtimedwait -// SchedGetPriorityMax -// SchedGetPriorityMin -// SchedGetparam -// SchedGetscheduler -// SchedRrGetInterval -// SchedSetparam -// SchedYield -// Security -// Semctl -// Semget -// Semop -// Semtimedop -// SetMempolicy -// SetRobustList -// SetThreadArea -// SetTidAddress -// Sigaltstack -// Swapoff -// Swapon -// Sysfs -// TimerCreate -// TimerDelete -// TimerGetoverrun -// TimerGettime -// TimerSettime -// Tkill (obsolete) -// Tuxcall -// Umount2 -// Uselib -// Utimensat -// Vfork -// Vhangup -// Vserver -// _Sysctl +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + +//sys schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) +//sys schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) + +// SchedSetAttr is a wrapper for sched_setattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_setattr.2.html +func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error { + if attr == nil { + return EINVAL + } + attr.Size = SizeofSchedAttr + return schedSetattr(pid, attr, flags) +} + +// SchedGetAttr is a wrapper for sched_getattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_getattr.2.html +func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) { + attr := &SchedAttr{} + if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil { + return nil, err + } + return attr, nil +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 5b21fcf..70601ce 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -40,7 +40,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index a81f574..f526668 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -33,7 +33,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 69d2d7c..f6ab02e 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -28,7 +28,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 76d5640..93fe59d 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -31,7 +31,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 35851ef..5e6ceee 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -32,7 +32,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -177,3 +177,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_netbsd.go index 018d7d4..8816209 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -356,266 +356,16 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) -/* - * Unimplemented - */ -// ____semctl13 -// __clone -// __fhopen40 -// __fhstat40 -// __fhstatvfs140 -// __fstat30 -// __getcwd -// __getfh30 -// __getlogin -// __lstat30 -// __mount50 -// __msgctl13 -// __msync13 -// __ntp_gettime30 -// __posix_chown -// __posix_fchown -// __posix_lchown -// __posix_rename -// __setlogin -// __shmctl13 -// __sigaction_sigtramp -// __sigaltstack14 -// __sigpending14 -// __sigprocmask14 -// __sigsuspend14 -// __sigtimedwait -// __stat30 -// __syscall -// __vfork14 -// _ksem_close -// _ksem_destroy -// _ksem_getvalue -// _ksem_init -// _ksem_open -// _ksem_post -// _ksem_trywait -// _ksem_unlink -// _ksem_wait -// _lwp_continue -// _lwp_create -// _lwp_ctl -// _lwp_detach -// _lwp_exit -// _lwp_getname -// _lwp_getprivate -// _lwp_kill -// _lwp_park -// _lwp_self -// _lwp_setname -// _lwp_setprivate -// _lwp_suspend -// _lwp_unpark -// _lwp_unpark_all -// _lwp_wait -// _lwp_wakeup -// _pset_bind -// _sched_getaffinity -// _sched_getparam -// _sched_setaffinity -// _sched_setparam -// acct -// aio_cancel -// aio_error -// aio_fsync -// aio_read -// aio_return -// aio_suspend -// aio_write -// break -// clock_getres -// clock_gettime -// clock_settime -// compat_09_ogetdomainname -// compat_09_osetdomainname -// compat_09_ouname -// compat_10_omsgsys -// compat_10_osemsys -// compat_10_oshmsys -// compat_12_fstat12 -// compat_12_getdirentries -// compat_12_lstat12 -// compat_12_msync -// compat_12_oreboot -// compat_12_oswapon -// compat_12_stat12 -// compat_13_sigaction13 -// compat_13_sigaltstack13 -// compat_13_sigpending13 -// compat_13_sigprocmask13 -// compat_13_sigreturn13 -// compat_13_sigsuspend13 -// compat_14___semctl -// compat_14_msgctl -// compat_14_shmctl -// compat_16___sigaction14 -// compat_16___sigreturn14 -// compat_20_fhstatfs -// compat_20_fstatfs -// compat_20_getfsstat -// compat_20_statfs -// compat_30___fhstat30 -// compat_30___fstat13 -// compat_30___lstat13 -// compat_30___stat13 -// compat_30_fhopen -// compat_30_fhstat -// compat_30_fhstatvfs1 -// compat_30_getdents -// compat_30_getfh -// compat_30_ntp_gettime -// compat_30_socket -// compat_40_mount -// compat_43_fstat43 -// compat_43_lstat43 -// compat_43_oaccept -// compat_43_ocreat -// compat_43_oftruncate -// compat_43_ogetdirentries -// compat_43_ogetdtablesize -// compat_43_ogethostid -// compat_43_ogethostname -// compat_43_ogetkerninfo -// compat_43_ogetpagesize -// compat_43_ogetpeername -// compat_43_ogetrlimit -// compat_43_ogetsockname -// compat_43_okillpg -// compat_43_olseek -// compat_43_ommap -// compat_43_oquota -// compat_43_orecv -// compat_43_orecvfrom -// compat_43_orecvmsg -// compat_43_osend -// compat_43_osendmsg -// compat_43_osethostid -// compat_43_osethostname -// compat_43_osigblock -// compat_43_osigsetmask -// compat_43_osigstack -// compat_43_osigvec -// compat_43_otruncate -// compat_43_owait -// compat_43_stat43 -// execve -// extattr_delete_fd -// extattr_delete_file -// extattr_delete_link -// extattr_get_fd -// extattr_get_file -// extattr_get_link -// extattr_list_fd -// extattr_list_file -// extattr_list_link -// extattr_set_fd -// extattr_set_file -// extattr_set_link -// extattrctl -// fchroot -// fdatasync -// fgetxattr -// fktrace -// flistxattr -// fork -// fremovexattr -// fsetxattr -// fstatvfs1 -// fsync_range -// getcontext -// getitimer -// getvfsstat -// getxattr -// ktrace -// lchflags -// lchmod -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// lgetxattr -// lio_listio -// listxattr -// llistxattr -// lremovexattr -// lseek -// lsetxattr -// lutimes -// madvise -// mincore -// minherit -// modctl -// mq_close -// mq_getattr -// mq_notify -// mq_open -// mq_receive -// mq_send -// mq_setattr -// mq_timedreceive -// mq_timedsend -// mq_unlink -// mremap -// msgget -// msgrcv -// msgsnd -// nfssvc -// ntp_adjtime -// pmc_control -// pmc_get_info -// pollts -// preadv -// profil -// pselect -// pset_assign -// pset_create -// pset_destroy -// ptrace -// pwritev -// quotactl -// rasctl -// readv -// reboot -// removexattr -// sa_enable -// sa_preempt -// sa_register -// sa_setconcurrency -// sa_stacks -// sa_yield -// sbrk -// sched_yield -// semconfig -// semget -// semop -// setcontext -// setitimer -// setxattr -// shmat -// shmdt -// shmget -// sstk -// statvfs1 -// swapctl -// sysarch -// syscall -// timer_create -// timer_delete -// timer_getoverrun -// timer_gettime -// timer_settime -// undelete -// utrace -// uuidgen -// vadvise -// vfork -// writev +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_openbsd.go index f9c7a96..6f34479 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -151,6 +151,21 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL @@ -311,80 +326,4 @@ func Uname(uname *Utsname) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// __getcwd -// __semctl -// __syscall -// __sysctl -// adjfreq -// break -// clock_getres -// clock_gettime -// clock_settime -// closefrom -// execve -// fhopen -// fhstat -// fhstatfs -// fork -// futimens -// getfh -// getgid -// getitimer -// getlogin -// getresgid -// getresuid -// getthrid -// ktrace -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// mincore -// minherit -// mount -// mquery -// msgctl -// msgget -// msgrcv -// msgsnd -// nfssvc -// nnpfspioctl -// preadv -// profil -// pwritev -// quotactl -// readv -// reboot -// renameat -// rfork -// sched_yield -// semget -// semop -// setgroups -// setitimer -// setsockopt -// shmat -// shmctl -// shmdt -// shmget -// sigaction -// sigaltstack -// sigpending -// sigprocmask -// sigreturn -// sigsuspend -// sysarch -// syscall -// threxit -// thrsigdivert -// thrsleep -// thrwakeup -// vfork -// writev diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_solaris.go index b600a28..b99cfa1 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -698,38 +698,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) = libsocket.setsockopt //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) = libsocket.recvfrom -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_unix.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_unix.go index 8e48c29..f6eda27 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -147,6 +147,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { @@ -541,6 +549,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) { if err != nil { return err } + if (flag&O_NONBLOCK != 0) == nonblocking { + return nil + } if nonblocking { flag |= O_NONBLOCK } else { diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index d3d49ec..4596d04 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -192,7 +192,6 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys fcntl(fd int, cmd int, arg int) (val int, err error) //sys read(fd int, p []byte) (n int, err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ //sys write(fd int, p []byte) (n int, err error) //sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) = SYS___ACCEPT_A @@ -285,25 +284,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux.go index de936b6..f9c7f47 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -493,6 +493,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -826,9 +827,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1198,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1235,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1860,6 +1864,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1880,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1904,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2204,6 +2213,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2231,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2361,6 +2372,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2381,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2403,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2406,6 +2421,15 @@ const ( PR_PAC_GET_ENABLED_KEYS = 0x3d PR_PAC_RESET_KEYS = 0x36 PR_PAC_SET_ENABLED_KEYS = 0x3c + PR_RISCV_V_GET_CONTROL = 0x46 + PR_RISCV_V_SET_CONTROL = 0x45 + PR_RISCV_V_VSTATE_CTRL_CUR_MASK = 0x3 + PR_RISCV_V_VSTATE_CTRL_DEFAULT = 0x0 + PR_RISCV_V_VSTATE_CTRL_INHERIT = 0x10 + PR_RISCV_V_VSTATE_CTRL_MASK = 0x1f + PR_RISCV_V_VSTATE_CTRL_NEXT_MASK = 0xc + PR_RISCV_V_VSTATE_CTRL_OFF = 0x1 + PR_RISCV_V_VSTATE_CTRL_ON = 0x2 PR_SCHED_CORE = 0x3e PR_SCHED_CORE_CREATE = 0x1 PR_SCHED_CORE_GET = 0x0 @@ -2423,6 +2447,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2532,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2563,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2802,6 +2830,23 @@ const ( RWF_SUPPORTED = 0x1f RWF_SYNC = 0x4 RWF_WRITE_LIFE_NOT_SET = 0x0 + SCHED_BATCH = 0x3 + SCHED_DEADLINE = 0x6 + SCHED_FIFO = 0x1 + SCHED_FLAG_ALL = 0x7f + SCHED_FLAG_DL_OVERRUN = 0x4 + SCHED_FLAG_KEEP_ALL = 0x18 + SCHED_FLAG_KEEP_PARAMS = 0x10 + SCHED_FLAG_KEEP_POLICY = 0x8 + SCHED_FLAG_RECLAIM = 0x2 + SCHED_FLAG_RESET_ON_FORK = 0x1 + SCHED_FLAG_UTIL_CLAMP = 0x60 + SCHED_FLAG_UTIL_CLAMP_MAX = 0x40 + SCHED_FLAG_UTIL_CLAMP_MIN = 0x20 + SCHED_IDLE = 0x5 + SCHED_NORMAL = 0x0 + SCHED_RESET_ON_FORK = 0x40000000 + SCHED_RR = 0x2 SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x1d @@ -3072,7 +3117,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3238,6 +3283,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f..30aee00 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3e..8ebfa51 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -318,10 +327,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee2..271a21c 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -324,10 +333,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c..910c330 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -314,10 +323,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 @@ -443,6 +454,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +527,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164..a640798 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -109,6 +118,8 @@ const ( IUCLC = 0x200 IXOFF = 0x1000 IXON = 0x400 + LASX_CTX_MAGIC = 0x41535801 + LSX_CTX_MAGIC = 0x53580001 MAP_ANON = 0x20 MAP_ANONYMOUS = 0x20 MAP_DENYWRITE = 0x800 @@ -308,10 +319,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c..0d5925d 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26a..d72a00e 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e3..02ba129 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce1..8daa6dd 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c8..63c8fa2 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -372,10 +381,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad..930799e 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +385,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1..8605a7d 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +385,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9..95a016f 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -305,10 +314,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db..1ae0108 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -380,10 +389,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f619252..1bb7c63 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -30,22 +30,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +338,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 @@ -371,10 +428,12 @@ const ( SO_NOFCS = 0x27 SO_OOBINLINE = 0x100 SO_PASSCRED = 0x2 + SO_PASSPIDFD = 0x55 SO_PASSSEC = 0x1f SO_PEEK_OFF = 0x26 SO_PEERCRED = 0x40 SO_PEERGROUPS = 0x3d + SO_PEERPIDFD = 0x56 SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x48 SO_PROTOCOL = 0x1028 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index 9a25721..d1d1d23 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -817,28 +817,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.read(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.write(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { r0, er := C.dup2(C.int(oldfd), C.int(newfd)) if r0 == -1 && er != nil { diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index 6de80c2..f99a18a 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -762,28 +762,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callread(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callwrite(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { _, e1 := calldup2(oldfd, newfd) if e1 != 0 { diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 4037ccf..1cad561 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -725,6 +725,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +739,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2410,28 +2412,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat64_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2521,14 +2501,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 4baaed0..8b8bb28 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -5,703 +5,586 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) @@ -712,192 +595,160 @@ DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat64(SB) - GLOBL ·libc_fstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat64_trampoline_addr(SB)/8, $libc_fstat64_trampoline<>(SB) TEXT libc_fstatat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat64(SB) - GLOBL ·libc_fstatat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat64_trampoline_addr(SB)/8, $libc_fstatat64_trampoline<>(SB) TEXT libc_fstatfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs64(SB) - GLOBL ·libc_fstatfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs64_trampoline_addr(SB)/8, $libc_fstatfs64_trampoline<>(SB) TEXT libc_getfsstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat64(SB) - GLOBL ·libc_getfsstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat64_trampoline_addr(SB)/8, $libc_getfsstat64_trampoline<>(SB) TEXT libc_lstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat64(SB) - GLOBL ·libc_lstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat64_trampoline_addr(SB)/8, $libc_lstat64_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat64(SB) - GLOBL ·libc_stat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat64_trampoline_addr(SB)/8, $libc_stat64_trampoline<>(SB) TEXT libc_statfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs64(SB) - GLOBL ·libc_statfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs64_trampoline_addr(SB)/8, $libc_statfs64_trampoline<>(SB) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 51d6f3f..b18edbd 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -725,6 +725,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +739,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2410,28 +2412,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2521,14 +2501,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index c3b82c0..08362c1 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -5,703 +5,586 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) @@ -712,192 +595,160 @@ DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat(SB) - GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat(SB) - GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs(SB) - GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat(SB) - GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat(SB) - GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat(SB) - GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs(SB) - GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go index 0eabac7..0c67df6 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go @@ -1642,28 +1642,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index ee313eb..e6e05d1 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -1862,28 +1862,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index 4c986e4..7508acc 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -1862,28 +1862,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index 5552169..7b56aea 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -1862,28 +1862,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index 67a226f..cc623dc 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -1862,28 +1862,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go index f0b9dda..5818491 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -1862,28 +1862,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go index b57c705..6be25cd 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go @@ -40,7 +40,7 @@ func readv(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procreadv)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -55,7 +55,7 @@ func preadv(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpreadv)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -70,7 +70,7 @@ func writev(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwritev)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -85,7 +85,7 @@ func pwritev(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwritev)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -96,7 +96,7 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept4)), 4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux.go index da63d9d..1ff3aec 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1356,7 +1356,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1734,28 +1734,6 @@ func exitThread(code int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func readv(fd int, iovs []Iovec) (n int, err error) { var _p0 unsafe.Pointer if len(iovs) > 0 { @@ -1868,6 +1846,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2172,3 +2161,37 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) { + _, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 0b29239..0ab4f2e 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -531,3 +531,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index cdb2af5..2df3c5b 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -1824,20 +1824,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1839,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 9d25f76..a60556b 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -1824,20 +1824,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1839,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index d3f8035..9f78891 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -1824,20 +1824,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1839,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 887188a..82a4cb2 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -1824,20 +1824,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1839,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 6699a78..66b3b64 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 04f0de3..3dcacd3 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 1e775fe..c5c4cc1 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 27b6f4d..2763620 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 7f64278..93bfbb3 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index b797045..c922314 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 756ef7b..a107b8f 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index a871266..a6bc32c 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 7bc2e24..c427de5 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 05d4bff..b4e7bce 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 739be62..60c1a99 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 74a25f8..ca3f766 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 7d95a19..52eba36 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2189,28 +2213,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index 990be24..477a7d5 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index 609d1c5..b401894 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -436,7 +436,7 @@ func pipe(p *[2]_C_int) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe)), 1, uintptr(unsafe.Pointer(p)), 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -446,7 +446,7 @@ func pipe(p *[2]_C_int) (n int, err error) { func pipe2(p *[2]_C_int, flags int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe2)), 2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -456,7 +456,7 @@ func pipe2(p *[2]_C_int, flags int) (err error) { func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetsockname)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -471,7 +471,7 @@ func Getcwd(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetcwd)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -482,7 +482,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -492,7 +492,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { func setgroups(ngid int, gid *_Gid_t) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procsetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -503,7 +503,7 @@ func wait4(pid int32, statusp *_C_int, options int, rusage *Rusage) (wpid int32, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwait4)), 4, uintptr(pid), uintptr(unsafe.Pointer(statusp)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int32(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -518,7 +518,7 @@ func gethostname(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -533,7 +533,7 @@ func utimes(path string, times *[2]Timeval) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimes)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -548,7 +548,7 @@ func utimensat(fd int, path string, times *[2]Timespec, flag int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimensat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flag), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -559,7 +559,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfcntl)), 3, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -569,7 +569,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { func futimesat(fildes int, path *byte, times *[2]Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfutimesat)), 3, uintptr(fildes), uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(times)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -580,7 +580,7 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept)), 3, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -591,7 +591,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_recvmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -602,7 +602,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -612,7 +612,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { func acct(path *byte) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procacct)), 1, uintptr(unsafe.Pointer(path)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -647,7 +647,7 @@ func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -658,7 +658,7 @@ func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -669,7 +669,7 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpoll)), 3, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -684,7 +684,7 @@ func Access(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAccess)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -694,7 +694,7 @@ func Access(path string, mode uint32) (err error) { func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAdjtime)), 2, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -709,7 +709,7 @@ func Chdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -724,7 +724,7 @@ func Chmod(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChmod)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -739,7 +739,7 @@ func Chown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -754,7 +754,7 @@ func Chroot(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChroot)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -764,7 +764,7 @@ func Chroot(path string) (err error) { func ClockGettime(clockid int32, time *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClockGettime)), 2, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -774,7 +774,7 @@ func ClockGettime(clockid int32, time *Timespec) (err error) { func Close(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClose)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -790,7 +790,7 @@ func Creat(path string, mode uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procCreat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -801,7 +801,7 @@ func Dup(fd int) (nfd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup)), 1, uintptr(fd), 0, 0, 0, 0, 0) nfd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -811,7 +811,7 @@ func Dup(fd int) (nfd int, err error) { func Dup2(oldfd int, newfd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup2)), 2, uintptr(oldfd), uintptr(newfd), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -833,7 +833,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFaccessat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -843,7 +843,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchdir(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchdir)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -853,7 +853,7 @@ func Fchdir(fd int) (err error) { func Fchmod(fd int, mode uint32) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmod)), 2, uintptr(fd), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -868,7 +868,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -878,7 +878,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchown(fd int, uid int, gid int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchown)), 3, uintptr(fd), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -893,7 +893,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchownat)), 5, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -903,7 +903,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { func Fdatasync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFdatasync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -913,7 +913,7 @@ func Fdatasync(fd int) (err error) { func Flock(fd int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFlock)), 2, uintptr(fd), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -924,7 +924,7 @@ func Fpathconf(fd int, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFpathconf)), 2, uintptr(fd), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -934,7 +934,7 @@ func Fpathconf(fd int, name int) (val int, err error) { func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstat)), 2, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -949,7 +949,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -959,7 +959,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { func Fstatvfs(fd int, vfsstat *Statvfs_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatvfs)), 2, uintptr(fd), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -974,7 +974,7 @@ func Getdents(fd int, buf []byte, basep *uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetdents)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1001,7 +1001,7 @@ func Getpgid(pid int) (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgid)), 1, uintptr(pid), 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1012,7 +1012,7 @@ func Getpgrp() (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgrp)), 0, 0, 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1047,7 +1047,7 @@ func Getpriority(which int, who int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetpriority)), 2, uintptr(which), uintptr(who), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1057,7 +1057,7 @@ func Getpriority(which int, who int) (n int, err error) { func Getrlimit(which int, lim *Rlimit) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1067,7 +1067,7 @@ func Getrlimit(which int, lim *Rlimit) (err error) { func Getrusage(who int, rusage *Rusage) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrusage)), 2, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1078,7 +1078,7 @@ func Getsid(pid int) (sid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0) sid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1088,7 +1088,7 @@ func Getsid(pid int) (sid int, err error) { func Gettimeofday(tv *Timeval) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1106,7 +1106,7 @@ func Getuid() (uid int) { func Kill(pid int, signum syscall.Signal) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procKill)), 2, uintptr(pid), uintptr(signum), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1121,7 +1121,7 @@ func Lchown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLchown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1141,7 +1141,7 @@ func Link(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1151,7 +1151,7 @@ func Link(path string, link string) (err error) { func Listen(s int, backlog int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_llisten)), 2, uintptr(s), uintptr(backlog), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1166,7 +1166,7 @@ func Lstat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLstat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1180,7 +1180,7 @@ func Madvise(b []byte, advice int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMadvise)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(advice), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1195,7 +1195,7 @@ func Mkdir(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdir)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1210,7 +1210,7 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdirat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1225,7 +1225,7 @@ func Mkfifo(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifo)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1240,7 +1240,7 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifoat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1255,7 +1255,7 @@ func Mknod(path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknod)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1270,7 +1270,7 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1284,7 +1284,7 @@ func Mlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1294,7 +1294,7 @@ func Mlock(b []byte) (err error) { func Mlockall(flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlockall)), 1, uintptr(flags), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1308,7 +1308,7 @@ func Mprotect(b []byte, prot int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMprotect)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(prot), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1322,7 +1322,7 @@ func Msync(b []byte, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMsync)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1336,7 +1336,7 @@ func Munlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1346,7 +1346,7 @@ func Munlock(b []byte) (err error) { func Munlockall() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlockall)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1356,7 +1356,7 @@ func Munlockall() (err error) { func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procNanosleep)), 2, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1372,7 +1372,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpen)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1388,7 +1388,7 @@ func Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpenat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), uintptr(mode), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1404,7 +1404,7 @@ func Pathconf(path string, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPathconf)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1414,7 +1414,7 @@ func Pathconf(path string, name int) (val int, err error) { func Pause() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPause)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1429,7 +1429,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1444,7 +1444,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1459,7 +1459,7 @@ func read(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1479,7 +1479,7 @@ func Readlink(path string, buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procReadlink)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(len(buf)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1499,7 +1499,7 @@ func Rename(from string, to string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRename)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1519,7 +1519,7 @@ func Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err e } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRenameat)), 4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1534,7 +1534,7 @@ func Rmdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRmdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1545,7 +1545,7 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proclseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) newoffset = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1556,7 +1556,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSelect)), 5, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1566,7 +1566,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err func Setegid(egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetegid)), 1, uintptr(egid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1576,7 +1576,7 @@ func Setegid(egid int) (err error) { func Seteuid(euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSeteuid)), 1, uintptr(euid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1586,7 +1586,7 @@ func Seteuid(euid int) (err error) { func Setgid(gid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetgid)), 1, uintptr(gid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1600,7 +1600,7 @@ func Sethostname(p []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1610,7 +1610,7 @@ func Sethostname(p []byte) (err error) { func Setpgid(pid int, pgid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetpgid)), 2, uintptr(pid), uintptr(pgid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1620,7 +1620,7 @@ func Setpgid(pid int, pgid int) (err error) { func Setpriority(which int, who int, prio int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSetpriority)), 3, uintptr(which), uintptr(who), uintptr(prio), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1630,7 +1630,7 @@ func Setpriority(which int, who int, prio int) (err error) { func Setregid(rgid int, egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetregid)), 2, uintptr(rgid), uintptr(egid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1640,7 +1640,7 @@ func Setregid(rgid int, egid int) (err error) { func Setreuid(ruid int, euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetreuid)), 2, uintptr(ruid), uintptr(euid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1651,7 +1651,7 @@ func Setsid() (pid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0) pid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1661,7 +1661,7 @@ func Setsid() (pid int, err error) { func Setuid(uid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetuid)), 1, uintptr(uid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1671,7 +1671,7 @@ func Setuid(uid int) (err error) { func Shutdown(s int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procshutdown)), 2, uintptr(s), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1686,7 +1686,7 @@ func Stat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1701,7 +1701,7 @@ func Statvfs(path string, vfsstat *Statvfs_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStatvfs)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1721,7 +1721,7 @@ func Symlink(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSymlink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1731,7 +1731,7 @@ func Symlink(path string, link string) (err error) { func Sync() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSync)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1742,7 +1742,7 @@ func Sysconf(which int) (n int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSysconf)), 1, uintptr(which), 0, 0, 0, 0, 0) n = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1753,7 +1753,7 @@ func Times(tms *Tms) (ticks uintptr, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procTimes)), 1, uintptr(unsafe.Pointer(tms)), 0, 0, 0, 0, 0) ticks = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1768,7 +1768,7 @@ func Truncate(path string, length int64) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procTruncate)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1778,7 +1778,7 @@ func Truncate(path string, length int64) (err error) { func Fsync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFsync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1788,7 +1788,7 @@ func Fsync(fd int) (err error) { func Ftruncate(fd int, length int64) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFtruncate)), 2, uintptr(fd), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1806,7 +1806,7 @@ func Umask(mask int) (oldmask int) { func Uname(buf *Utsname) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procUname)), 1, uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1821,7 +1821,7 @@ func Unmount(target string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procumount)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1836,7 +1836,7 @@ func Unlink(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlink)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1851,7 +1851,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlinkat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1861,7 +1861,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { func Ustat(dev int, ubuf *Ustat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUstat)), 2, uintptr(dev), uintptr(unsafe.Pointer(ubuf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1876,7 +1876,7 @@ func Utime(path string, buf *Utimbuf) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUtime)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1886,7 +1886,7 @@ func Utime(path string, buf *Utimbuf) (err error) { func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_bind)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1896,7 +1896,7 @@ func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_connect)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1907,7 +1907,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmmap)), 6, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1917,7 +1917,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( func munmap(addr uintptr, length uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmunmap)), 2, uintptr(addr), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1928,7 +1928,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsendfile)), 4, uintptr(outfd), uintptr(infd), uintptr(unsafe.Pointer(offset)), uintptr(count), 0, 0) written = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1942,7 +1942,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendto)), 6, uintptr(s), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1953,7 +1953,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socket)), 3, uintptr(domain), uintptr(typ), uintptr(proto), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1963,7 +1963,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socketpair)), 4, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1978,7 +1978,7 @@ func write(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1988,7 +1988,7 @@ func write(fd int, p []byte) (n int, err error) { func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_getsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1998,7 +1998,7 @@ func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetpeername)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2008,7 +2008,7 @@ func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsetsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2023,7 +2023,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procrecvfrom)), 6, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2034,7 +2034,7 @@ func port_create() (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_create)), 0, 0, 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2045,7 +2045,7 @@ func port_associate(port int, source int, object uintptr, events int, user *byte r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_associate)), 5, uintptr(port), uintptr(source), uintptr(object), uintptr(events), uintptr(unsafe.Pointer(user)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2056,7 +2056,7 @@ func port_dissociate(port int, source int, object uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_dissociate)), 3, uintptr(port), uintptr(source), uintptr(object), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2067,7 +2067,7 @@ func port_get(port int, pe *portEvent, timeout *Timespec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_get)), 3, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(unsafe.Pointer(timeout)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2078,7 +2078,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_getn)), 5, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(max), uintptr(unsafe.Pointer(nget)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2088,7 +2088,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2098,7 +2098,7 @@ func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index c316817..1d8fe1d 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -40,17 +40,6 @@ func read(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func write(fd int, p []byte) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index c9c4ad0..9862853 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -447,4 +447,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 12ff341..8901f0f 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -369,4 +369,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index c3fb5e7..6902c37 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -411,4 +411,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index 358c847..a6d3dff 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -314,4 +314,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index 81c4849..b18f3f7 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -308,4 +308,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index 202a57e..0302e5e 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -431,4 +431,5 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 1fbceb5..6693ba4 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -361,4 +361,5 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index b4ffb7a..fd93f49 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -361,4 +361,5 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index 867985f..760ddca 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -431,4 +431,5 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index a8cce69..cff2b25 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -438,4 +438,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index d44c5b3..a4b2405 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -410,4 +410,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 4214dd9..aca54b4 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -410,4 +410,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8..9d1738d 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -251,6 +251,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 @@ -313,4 +315,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea4652..022878d 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -372,7 +372,9 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 92f628e..4100a76 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -389,4 +389,5 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 ) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727..18aa70b 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -866,6 +866,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1543,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1977,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x22 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2564,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2580,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2625,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2636,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2671,7 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,12 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2723,9 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2733,6 +2763,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2778,7 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2803,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2838,6 +2876,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2889,19 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc ) const ( @@ -3605,7 +3660,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3700,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3804,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3842,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4499,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x146 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4728,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4869,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x9a NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5448,7 +5503,7 @@ const ( NL80211_RATE_INFO_HE_RU_ALLOC_52 = 0x1 NL80211_RATE_INFO_HE_RU_ALLOC_996 = 0x5 NL80211_RATE_INFO_HE_RU_ALLOC = 0x11 - NL80211_RATE_INFO_MAX = 0x16 + NL80211_RATE_INFO_MAX = 0x1d NL80211_RATE_INFO_MCS = 0x2 NL80211_RATE_INFO_SHORT_GI = 0x4 NL80211_RATE_INFO_VHT_MCS = 0x6 @@ -5795,6 +5850,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5861,25 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) + +type SchedAttr struct { + Size uint32 + Policy uint32 + Flags uint64 + Nice int32 + Priority uint32 + Runtime uint64 + Deadline uint64 + Period uint64 + Util_min uint32 + Util_max uint32 +} + +const SizeofSchedAttr = 0x38 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc149..6d8acbc 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -337,6 +337,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff..59293c6 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -350,6 +350,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a60..40cfa38 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -328,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651..055bc42 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -329,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c518..f28affb 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -330,6 +330,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4d..9d71e7c 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8f..fd5ccd3 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd..7704de7 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba..df00b87 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf..0942840 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -340,6 +340,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4..0348743 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4..bad0670 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f96..1b4c97c 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -357,6 +357,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +718,30 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_IMA_V = 0x4 + RISCV_HWPROBE_EXT_ZBA = 0x8 + RISCV_HWPROBE_EXT_ZBB = 0x10 + RISCV_HWPROBE_EXT_ZBS = 0x20 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cef..aa268d0 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -352,6 +352,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a013..444045b 100644 --- a/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/testdata/src/a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -334,6 +334,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/testdata/src/a/vendor/golang.org/x/text/internal/language/compact/tables.go b/testdata/src/a/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de..a09ed19 100644 --- a/testdata/src/a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/testdata/src/a/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/testdata/src/a/vendor/golang.org/x/text/internal/language/tables.go b/testdata/src/a/vendor/golang.org/x/text/internal/language/tables.go index fb6b583..14167e7 100644 --- a/testdata/src/a/vendor/golang.org/x/text/internal/language/tables.go +++ b/testdata/src/a/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/testdata/src/a/vendor/golang.org/x/text/language/match.go b/testdata/src/a/vendor/golang.org/x/text/language/match.go index ee45f49..1153baf 100644 --- a/testdata/src/a/vendor/golang.org/x/text/language/match.go +++ b/testdata/src/a/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/testdata/src/a/vendor/golang.org/x/text/language/tables.go b/testdata/src/a/vendor/golang.org/x/text/language/tables.go index 34a732b..a6573dc 100644 --- a/testdata/src/a/vendor/golang.org/x/text/language/tables.go +++ b/testdata/src/a/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/testdata/src/a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go b/testdata/src/a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go index 3fbfebf..1fc1de0 100644 --- a/testdata/src/a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go +++ b/testdata/src/a/vendor/golang.org/x/tools/go/ast/inspector/inspector.go @@ -64,8 +64,9 @@ type event struct { // depth-first order. It calls f(n) for each node n before it visits // n's children. // +// The complete traversal sequence is determined by ast.Inspect. // The types argument, if non-empty, enables type-based filtering of -// events. The function f if is called only for nodes whose type +// events. The function f is called only for nodes whose type // matches an element of the types slice. func (in *Inspector) Preorder(types []ast.Node, f func(ast.Node)) { // Because it avoids postorder calls to f, and the pruning @@ -97,6 +98,7 @@ func (in *Inspector) Preorder(types []ast.Node, f func(ast.Node)) { // of the non-nil children of the node, followed by a call of // f(n, false). // +// The complete traversal sequence is determined by ast.Inspect. // The types argument, if non-empty, enables type-based filtering of // events. The function f if is called only for nodes whose type // matches an element of the types slice. diff --git a/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/common.go b/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/common.go index cfba818..d0d0649 100644 --- a/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/common.go +++ b/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/common.go @@ -23,6 +23,7 @@ package typeparams import ( + "fmt" "go/ast" "go/token" "go/types" @@ -105,6 +106,31 @@ func OriginMethod(fn *types.Func) *types.Func { } orig := NamedTypeOrigin(named) gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name()) + + // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In: + // package p + // type T *int + // func (*T) f() {} + // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}. + // Here we make them consistent by force. + // (The go/types bug is general, but this workaround is reached only + // for generic T thanks to the early return above.) + if gfn == nil { + mset := types.NewMethodSet(types.NewPointer(orig)) + for i := 0; i < mset.Len(); i++ { + m := mset.At(i) + if m.Obj().Id() == fn.Id() { + gfn = m.Obj() + break + } + } + } + + // In golang/go#61196, we observe another crash, this time inexplicable. + if gfn == nil { + panic(fmt.Sprintf("missing origin method for %s.%s; named == origin: %t, named.NumMethods(): %d, origin.NumMethods(): %d", named, fn, named == orig, named.NumMethods(), orig.NumMethods())) + } + return gfn.(*types.Func) } diff --git a/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go b/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go index b478897..7ed86e1 100644 --- a/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go +++ b/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go117.go @@ -129,7 +129,7 @@ func NamedTypeArgs(*types.Named) *TypeList { } // NamedTypeOrigin is the identity method at this Go version. -func NamedTypeOrigin(named *types.Named) types.Type { +func NamedTypeOrigin(named *types.Named) *types.Named { return named } diff --git a/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go b/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go index 114a36b..cf301af 100644 --- a/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go +++ b/testdata/src/a/vendor/golang.org/x/tools/internal/typeparams/typeparams_go118.go @@ -103,7 +103,7 @@ func NamedTypeArgs(named *types.Named) *TypeList { } // NamedTypeOrigin returns named.Orig(). -func NamedTypeOrigin(named *types.Named) types.Type { +func NamedTypeOrigin(named *types.Named) *types.Named { return named.Origin() } diff --git a/testdata/src/a/vendor/modules.txt b/testdata/src/a/vendor/modules.txt index 652501f..f6557b9 100644 --- a/testdata/src/a/vendor/modules.txt +++ b/testdata/src/a/vendor/modules.txt @@ -5,7 +5,7 @@ github.com/go-logr/logr/funcr # github.com/go-task/slim-sprig v0.0.0-20230315185526-52ccab3ef572 ## explicit; go 1.13 github.com/go-task/slim-sprig -# github.com/google/go-cmp v0.5.9 +# github.com/google/go-cmp v0.6.0 ## explicit; go 1.13 github.com/google/go-cmp/cmp github.com/google/go-cmp/cmp/internal/diff @@ -15,7 +15,7 @@ github.com/google/go-cmp/cmp/internal/value # github.com/google/pprof v0.0.0-20230602150820-91b7bce49751 ## explicit; go 1.19 github.com/google/pprof/profile -# github.com/onsi/ginkgo/v2 v2.9.7 +# github.com/onsi/ginkgo/v2 v2.13.0 ## explicit; go 1.18 github.com/onsi/ginkgo/v2 github.com/onsi/ginkgo/v2/config @@ -37,7 +37,7 @@ github.com/onsi/ginkgo/v2/internal/parallel_support github.com/onsi/ginkgo/v2/internal/testingtproxy github.com/onsi/ginkgo/v2/reporters github.com/onsi/ginkgo/v2/types -# github.com/onsi/gomega v1.27.7 +# github.com/onsi/gomega v1.29.0 ## explicit; go 1.18 github.com/onsi/gomega github.com/onsi/gomega/format @@ -51,16 +51,16 @@ github.com/onsi/gomega/matchers/support/goraph/edge github.com/onsi/gomega/matchers/support/goraph/node github.com/onsi/gomega/matchers/support/goraph/util github.com/onsi/gomega/types -# golang.org/x/net v0.10.0 +# golang.org/x/net v0.17.0 ## explicit; go 1.17 golang.org/x/net/context golang.org/x/net/html golang.org/x/net/html/atom golang.org/x/net/html/charset -# golang.org/x/sys v0.8.0 +# golang.org/x/sys v0.13.0 ## explicit; go 1.17 golang.org/x/sys/unix -# golang.org/x/text v0.9.0 +# golang.org/x/text v0.13.0 ## explicit; go 1.17 golang.org/x/text/encoding golang.org/x/text/encoding/charmap @@ -79,7 +79,7 @@ golang.org/x/text/internal/utf8internal golang.org/x/text/language golang.org/x/text/runes golang.org/x/text/transform -# golang.org/x/tools v0.9.3 +# golang.org/x/tools v0.12.0 ## explicit; go 1.18 golang.org/x/tools/go/ast/inspector golang.org/x/tools/internal/typeparams diff --git a/tests/e2e.sh b/tests/e2e.sh index 24a9d97..a9401a8 100755 --- a/tests/e2e.sh +++ b/tests/e2e.sh @@ -6,22 +6,22 @@ cp ginkgolinter testdata/src/a cd testdata/src/a # no suppress -[[ $(./ginkgolinter a/... 2>&1 | wc -l) == 2468 ]] +[[ $(./ginkgolinter a/... 2>&1 | wc -l) == 2534 ]] # suppress all but nil -[[ $(./ginkgolinter --suppress-len-assertion=true --suppress-err-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 1452 ]] +[[ $(./ginkgolinter --suppress-len-assertion=true --suppress-err-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 1518 ]] # suppress all but len -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 750 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 816 ]] # suppress all but err -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 212 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 278 ]] # suppress all but compare -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 222 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-async-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 288 ]] # suppress all but async -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 119 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 185 ]] # suppress all but focus -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --forbid-focus-container=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 143 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --forbid-focus-container=true --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 209 ]] # suppress all but compare different types -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-compare-assertion=true a/... 2>&1 | wc -l) == 215 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-err-assertion=true --suppress-len-assertion=true --suppress-compare-assertion=true --suppress-compare-assertion=true a/... 2>&1 | wc -l) == 281 ]] # allow HaveLen(0) -[[ $(./ginkgolinter --allow-havelen-0=true a/... 2>&1 | wc -l) == 2455 ]] +[[ $(./ginkgolinter --allow-havelen-0=true a/... 2>&1 | wc -l) == 2521 ]] # suppress all - should only return the few non-suppressble -[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-len-assertion=true --suppress-err-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --forbid-focus-container=false --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 88 ]] +[[ $(./ginkgolinter --suppress-nil-assertion=true --suppress-len-assertion=true --suppress-err-assertion=true --suppress-compare-assertion=true --suppress-async-assertion=true --forbid-focus-container=false --suppress-type-compare-assertion=true a/... 2>&1 | wc -l) == 154 ]]