diff --git a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml index d73f5b5fb3..2c678f6816 100644 --- a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml +++ b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml index bf045240fa..c8dfe6084a 100644 --- a/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml +++ b/crds/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml b/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml index 0bc56d8c5e..61478b6c26 100644 --- a/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml +++ b/crds/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/apigee_v1beta1_apigeeenvironment.yaml b/crds/apigee_v1beta1_apigeeenvironment.yaml index d95535b331..63d16b7163 100644 --- a/crds/apigee_v1beta1_apigeeenvironment.yaml +++ b/crds/apigee_v1beta1_apigeeenvironment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/apigee_v1beta1_apigeeorganization.yaml b/crds/apigee_v1beta1_apigeeorganization.yaml index 89ac5d63f4..d24bb732c1 100644 --- a/crds/apigee_v1beta1_apigeeorganization.yaml +++ b/crds/apigee_v1beta1_apigeeorganization.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -190,7 +190,7 @@ spec: description: |- Cloud KMS key name used for encrypting the data that is stored and replicated across runtime instances. Update is not allowed after the organization is created. Required when (#RuntimeType) is `TRIAL`, a Google-Managed encryption key will be used. For example: "projects/foo/locations/us/keyRings/bar/cryptoKeys/baz". **Note:** Not supported for Apigee hybrid. - Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `projects/{{project}}/locations/{{location}}/keyRings/{{key_ring}}/cryptoKeys/{{name}}`). + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). type: string name: description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' diff --git a/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml b/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml index 901a3cfb7c..6cd322ed80 100644 --- a/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml +++ b/crds/artifactregistry_v1beta1_artifactregistryrepository.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigquery_v1beta1_bigquerydataset.yaml b/crds/bigquery_v1beta1_bigquerydataset.yaml index 12e5233f14..96247a9d73 100644 --- a/crds/bigquery_v1beta1_bigquerydataset.yaml +++ b/crds/bigquery_v1beta1_bigquerydataset.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigquery_v1beta1_bigqueryjob.yaml b/crds/bigquery_v1beta1_bigqueryjob.yaml index b638a1f868..de7d651add 100644 --- a/crds/bigquery_v1beta1_bigqueryjob.yaml +++ b/crds/bigquery_v1beta1_bigqueryjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigquery_v1beta1_bigquerytable.yaml b/crds/bigquery_v1beta1_bigquerytable.yaml index b20e6d1752..3e6b8180d2 100644 --- a/crds/bigquery_v1beta1_bigquerytable.yaml +++ b/crds/bigquery_v1beta1_bigquerytable.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtableappprofile.yaml b/crds/bigtable_v1beta1_bigtableappprofile.yaml index ee980bd3d3..8f54149a6b 100644 --- a/crds/bigtable_v1beta1_bigtableappprofile.yaml +++ b/crds/bigtable_v1beta1_bigtableappprofile.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtablegcpolicy.yaml b/crds/bigtable_v1beta1_bigtablegcpolicy.yaml index e1a4e07419..ee0aad56ff 100644 --- a/crds/bigtable_v1beta1_bigtablegcpolicy.yaml +++ b/crds/bigtable_v1beta1_bigtablegcpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtableinstance.yaml b/crds/bigtable_v1beta1_bigtableinstance.yaml index 080b625baa..918870367f 100644 --- a/crds/bigtable_v1beta1_bigtableinstance.yaml +++ b/crds/bigtable_v1beta1_bigtableinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/bigtable_v1beta1_bigtabletable.yaml b/crds/bigtable_v1beta1_bigtabletable.yaml index 6de84bea1a..66f5154553 100644 --- a/crds/bigtable_v1beta1_bigtabletable.yaml +++ b/crds/bigtable_v1beta1_bigtabletable.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml b/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml index 814be8ed23..c4410eab9a 100644 --- a/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml +++ b/crds/billingbudgets_v1beta1_billingbudgetsbudget.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml index d7b42fda2b..db265c5824 100644 --- a/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ b/crds/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml index d5e31593d7..01eff047bf 100644 --- a/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ b/crds/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml b/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml index 94a70046bd..59c92a8dbe 100644 --- a/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml +++ b/crds/cloudbuild_v1beta1_cloudbuildtrigger.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml index 616122f76c..7cbc36bb3f 100644 --- a/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ b/crds/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml b/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml index cce089afe8..ce3783610f 100644 --- a/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml +++ b/crds/cloudidentity_v1beta1_cloudidentitygroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml b/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml index e1bf88b5a7..e544058266 100644 --- a/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml +++ b/crds/cloudidentity_v1beta1_cloudidentitymembership.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml b/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml index 7b6bef3d9f..244a006151 100644 --- a/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml +++ b/crds/cloudscheduler_v1beta1_cloudschedulerjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeaddress.yaml b/crds/compute_v1beta1_computeaddress.yaml index 97b624c6a6..a3bd134751 100644 --- a/crds/compute_v1beta1_computeaddress.yaml +++ b/crds/compute_v1beta1_computeaddress.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computebackendbucket.yaml b/crds/compute_v1beta1_computebackendbucket.yaml index d227de5617..82fa379931 100644 --- a/crds/compute_v1beta1_computebackendbucket.yaml +++ b/crds/compute_v1beta1_computebackendbucket.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computebackendservice.yaml b/crds/compute_v1beta1_computebackendservice.yaml index 398b9d3e6e..4bbad1212b 100644 --- a/crds/compute_v1beta1_computebackendservice.yaml +++ b/crds/compute_v1beta1_computebackendservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computedisk.yaml b/crds/compute_v1beta1_computedisk.yaml index 0729b4897c..c6b01ed152 100644 --- a/crds/compute_v1beta1_computedisk.yaml +++ b/crds/compute_v1beta1_computedisk.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeexternalvpngateway.yaml b/crds/compute_v1beta1_computeexternalvpngateway.yaml index 42d4644be2..fcccec61be 100644 --- a/crds/compute_v1beta1_computeexternalvpngateway.yaml +++ b/crds/compute_v1beta1_computeexternalvpngateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computefirewall.yaml b/crds/compute_v1beta1_computefirewall.yaml index 7cee15610d..ff9fb78a0a 100644 --- a/crds/compute_v1beta1_computefirewall.yaml +++ b/crds/compute_v1beta1_computefirewall.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computefirewallpolicy.yaml b/crds/compute_v1beta1_computefirewallpolicy.yaml index edc9716e9a..09a9d42f81 100644 --- a/crds/compute_v1beta1_computefirewallpolicy.yaml +++ b/crds/compute_v1beta1_computefirewallpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computefirewallpolicyassociation.yaml b/crds/compute_v1beta1_computefirewallpolicyassociation.yaml index 59670a19fb..e0e275592c 100644 --- a/crds/compute_v1beta1_computefirewallpolicyassociation.yaml +++ b/crds/compute_v1beta1_computefirewallpolicyassociation.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computefirewallpolicyrule.yaml b/crds/compute_v1beta1_computefirewallpolicyrule.yaml index 1d54546362..3e03e8cfc0 100644 --- a/crds/compute_v1beta1_computefirewallpolicyrule.yaml +++ b/crds/compute_v1beta1_computefirewallpolicyrule.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeforwardingrule.yaml b/crds/compute_v1beta1_computeforwardingrule.yaml index 7da9c22b7e..df54faeb1c 100644 --- a/crds/compute_v1beta1_computeforwardingrule.yaml +++ b/crds/compute_v1beta1_computeforwardingrule.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computehealthcheck.yaml b/crds/compute_v1beta1_computehealthcheck.yaml index 07d48c881a..7b27362a9e 100644 --- a/crds/compute_v1beta1_computehealthcheck.yaml +++ b/crds/compute_v1beta1_computehealthcheck.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computehttphealthcheck.yaml b/crds/compute_v1beta1_computehttphealthcheck.yaml index cb2c2d7394..8dc853fb3f 100644 --- a/crds/compute_v1beta1_computehttphealthcheck.yaml +++ b/crds/compute_v1beta1_computehttphealthcheck.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computehttpshealthcheck.yaml b/crds/compute_v1beta1_computehttpshealthcheck.yaml index 4213a6b40a..48998170ba 100644 --- a/crds/compute_v1beta1_computehttpshealthcheck.yaml +++ b/crds/compute_v1beta1_computehttpshealthcheck.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeimage.yaml b/crds/compute_v1beta1_computeimage.yaml index 8ca7ddc0ea..7f8d3b5e87 100644 --- a/crds/compute_v1beta1_computeimage.yaml +++ b/crds/compute_v1beta1_computeimage.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinstance.yaml b/crds/compute_v1beta1_computeinstance.yaml index 1dffca1176..6647836d91 100644 --- a/crds/compute_v1beta1_computeinstance.yaml +++ b/crds/compute_v1beta1_computeinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinstancegroup.yaml b/crds/compute_v1beta1_computeinstancegroup.yaml index e43db5baf5..6e232be803 100644 --- a/crds/compute_v1beta1_computeinstancegroup.yaml +++ b/crds/compute_v1beta1_computeinstancegroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinstancegroupmanager.yaml b/crds/compute_v1beta1_computeinstancegroupmanager.yaml index bd73678bbe..71d97bd8b0 100644 --- a/crds/compute_v1beta1_computeinstancegroupmanager.yaml +++ b/crds/compute_v1beta1_computeinstancegroupmanager.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeinstancetemplate.yaml b/crds/compute_v1beta1_computeinstancetemplate.yaml index 47d867211b..d0b2717535 100644 --- a/crds/compute_v1beta1_computeinstancetemplate.yaml +++ b/crds/compute_v1beta1_computeinstancetemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeinterconnectattachment.yaml b/crds/compute_v1beta1_computeinterconnectattachment.yaml index 612b8aa50e..f3bb8e5af9 100644 --- a/crds/compute_v1beta1_computeinterconnectattachment.yaml +++ b/crds/compute_v1beta1_computeinterconnectattachment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenetwork.yaml b/crds/compute_v1beta1_computenetwork.yaml index e33a65a4e8..cc4ca6c899 100644 --- a/crds/compute_v1beta1_computenetwork.yaml +++ b/crds/compute_v1beta1_computenetwork.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenetworkendpointgroup.yaml b/crds/compute_v1beta1_computenetworkendpointgroup.yaml index 553fe6e07f..6ed8acbbb3 100644 --- a/crds/compute_v1beta1_computenetworkendpointgroup.yaml +++ b/crds/compute_v1beta1_computenetworkendpointgroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenetworkpeering.yaml b/crds/compute_v1beta1_computenetworkpeering.yaml index 5ef0df208d..9bf1708e9f 100644 --- a/crds/compute_v1beta1_computenetworkpeering.yaml +++ b/crds/compute_v1beta1_computenetworkpeering.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenodegroup.yaml b/crds/compute_v1beta1_computenodegroup.yaml index aa58c44b68..2055918e54 100644 --- a/crds/compute_v1beta1_computenodegroup.yaml +++ b/crds/compute_v1beta1_computenodegroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computenodetemplate.yaml b/crds/compute_v1beta1_computenodetemplate.yaml index 468aa91437..977760bc58 100644 --- a/crds/compute_v1beta1_computenodetemplate.yaml +++ b/crds/compute_v1beta1_computenodetemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computepacketmirroring.yaml b/crds/compute_v1beta1_computepacketmirroring.yaml index e24d956e22..d5bdccc85e 100644 --- a/crds/compute_v1beta1_computepacketmirroring.yaml +++ b/crds/compute_v1beta1_computepacketmirroring.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computeprojectmetadata.yaml b/crds/compute_v1beta1_computeprojectmetadata.yaml index fe94cc28d7..a1a5403b72 100644 --- a/crds/compute_v1beta1_computeprojectmetadata.yaml +++ b/crds/compute_v1beta1_computeprojectmetadata.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeregionnetworkendpointgroup.yaml b/crds/compute_v1beta1_computeregionnetworkendpointgroup.yaml index e9733df0af..e6eebfcaa7 100644 --- a/crds/compute_v1beta1_computeregionnetworkendpointgroup.yaml +++ b/crds/compute_v1beta1_computeregionnetworkendpointgroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computereservation.yaml b/crds/compute_v1beta1_computereservation.yaml index 8ea5fdc1d4..5a7ad9fea1 100644 --- a/crds/compute_v1beta1_computereservation.yaml +++ b/crds/compute_v1beta1_computereservation.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeresourcepolicy.yaml b/crds/compute_v1beta1_computeresourcepolicy.yaml index 5d5874fe5d..204b15a9ef 100644 --- a/crds/compute_v1beta1_computeresourcepolicy.yaml +++ b/crds/compute_v1beta1_computeresourcepolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeroute.yaml b/crds/compute_v1beta1_computeroute.yaml index 052d9ff4ef..68b23133c7 100644 --- a/crds/compute_v1beta1_computeroute.yaml +++ b/crds/compute_v1beta1_computeroute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouter.yaml b/crds/compute_v1beta1_computerouter.yaml index 7374fdc286..993175d42c 100644 --- a/crds/compute_v1beta1_computerouter.yaml +++ b/crds/compute_v1beta1_computerouter.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouterinterface.yaml b/crds/compute_v1beta1_computerouterinterface.yaml index 2b9af13f1f..13205806d1 100644 --- a/crds/compute_v1beta1_computerouterinterface.yaml +++ b/crds/compute_v1beta1_computerouterinterface.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouternat.yaml b/crds/compute_v1beta1_computerouternat.yaml index 6f6e152029..3d170a2b89 100644 --- a/crds/compute_v1beta1_computerouternat.yaml +++ b/crds/compute_v1beta1_computerouternat.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computerouterpeer.yaml b/crds/compute_v1beta1_computerouterpeer.yaml index 8c1ac885cb..f4ff865002 100644 --- a/crds/compute_v1beta1_computerouterpeer.yaml +++ b/crds/compute_v1beta1_computerouterpeer.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesecuritypolicy.yaml b/crds/compute_v1beta1_computesecuritypolicy.yaml index 8689ec44c3..b6bc4dcba5 100644 --- a/crds/compute_v1beta1_computesecuritypolicy.yaml +++ b/crds/compute_v1beta1_computesecuritypolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeserviceattachment.yaml b/crds/compute_v1beta1_computeserviceattachment.yaml index 191cbdb04f..4c27881862 100644 --- a/crds/compute_v1beta1_computeserviceattachment.yaml +++ b/crds/compute_v1beta1_computeserviceattachment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/compute_v1beta1_computesharedvpchostproject.yaml b/crds/compute_v1beta1_computesharedvpchostproject.yaml index 04eb19509c..fedf987512 100644 --- a/crds/compute_v1beta1_computesharedvpchostproject.yaml +++ b/crds/compute_v1beta1_computesharedvpchostproject.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesharedvpcserviceproject.yaml b/crds/compute_v1beta1_computesharedvpcserviceproject.yaml index 30f699042c..2ff8819f7b 100644 --- a/crds/compute_v1beta1_computesharedvpcserviceproject.yaml +++ b/crds/compute_v1beta1_computesharedvpcserviceproject.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesnapshot.yaml b/crds/compute_v1beta1_computesnapshot.yaml index c5af68c0ed..4b5c773579 100644 --- a/crds/compute_v1beta1_computesnapshot.yaml +++ b/crds/compute_v1beta1_computesnapshot.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesslcertificate.yaml b/crds/compute_v1beta1_computesslcertificate.yaml index 67ae417a4e..30ff6d49fd 100644 --- a/crds/compute_v1beta1_computesslcertificate.yaml +++ b/crds/compute_v1beta1_computesslcertificate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesslpolicy.yaml b/crds/compute_v1beta1_computesslpolicy.yaml index 0ccc954642..a6c923ff23 100644 --- a/crds/compute_v1beta1_computesslpolicy.yaml +++ b/crds/compute_v1beta1_computesslpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computesubnetwork.yaml b/crds/compute_v1beta1_computesubnetwork.yaml index 1b358efb6d..139ea9c27c 100644 --- a/crds/compute_v1beta1_computesubnetwork.yaml +++ b/crds/compute_v1beta1_computesubnetwork.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetgrpcproxy.yaml b/crds/compute_v1beta1_computetargetgrpcproxy.yaml index 971ec92424..56a82f272c 100644 --- a/crds/compute_v1beta1_computetargetgrpcproxy.yaml +++ b/crds/compute_v1beta1_computetargetgrpcproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargethttpproxy.yaml b/crds/compute_v1beta1_computetargethttpproxy.yaml index e9c1171e4e..f76ad27a8b 100644 --- a/crds/compute_v1beta1_computetargethttpproxy.yaml +++ b/crds/compute_v1beta1_computetargethttpproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargethttpsproxy.yaml b/crds/compute_v1beta1_computetargethttpsproxy.yaml index 824fbc6ecb..a7f20a8ab0 100644 --- a/crds/compute_v1beta1_computetargethttpsproxy.yaml +++ b/crds/compute_v1beta1_computetargethttpsproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetinstance.yaml b/crds/compute_v1beta1_computetargetinstance.yaml index 92b37dc6c5..ebf5b477fb 100644 --- a/crds/compute_v1beta1_computetargetinstance.yaml +++ b/crds/compute_v1beta1_computetargetinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetpool.yaml b/crds/compute_v1beta1_computetargetpool.yaml index ed97bb488d..c546185bec 100644 --- a/crds/compute_v1beta1_computetargetpool.yaml +++ b/crds/compute_v1beta1_computetargetpool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetsslproxy.yaml b/crds/compute_v1beta1_computetargetsslproxy.yaml index 7ef25f4c62..98701a0636 100644 --- a/crds/compute_v1beta1_computetargetsslproxy.yaml +++ b/crds/compute_v1beta1_computetargetsslproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargettcpproxy.yaml b/crds/compute_v1beta1_computetargettcpproxy.yaml index 225f21b22d..b7e5bd3b43 100644 --- a/crds/compute_v1beta1_computetargettcpproxy.yaml +++ b/crds/compute_v1beta1_computetargettcpproxy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computetargetvpngateway.yaml b/crds/compute_v1beta1_computetargetvpngateway.yaml index e1be43a697..f1f0744f99 100644 --- a/crds/compute_v1beta1_computetargetvpngateway.yaml +++ b/crds/compute_v1beta1_computetargetvpngateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computeurlmap.yaml b/crds/compute_v1beta1_computeurlmap.yaml index c793baaba9..b202232837 100644 --- a/crds/compute_v1beta1_computeurlmap.yaml +++ b/crds/compute_v1beta1_computeurlmap.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computevpngateway.yaml b/crds/compute_v1beta1_computevpngateway.yaml index dd161d48ee..883707960c 100644 --- a/crds/compute_v1beta1_computevpngateway.yaml +++ b/crds/compute_v1beta1_computevpngateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/compute_v1beta1_computevpntunnel.yaml b/crds/compute_v1beta1_computevpntunnel.yaml index 39c98248e5..1052b9a90d 100644 --- a/crds/compute_v1beta1_computevpntunnel.yaml +++ b/crds/compute_v1beta1_computevpntunnel.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/configcontroller_v1beta1_configcontrollerinstance.yaml b/crds/configcontroller_v1beta1_configcontrollerinstance.yaml index 628ced3fe0..d9b674fc69 100644 --- a/crds/configcontroller_v1beta1_configcontrollerinstance.yaml +++ b/crds/configcontroller_v1beta1_configcontrollerinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/container_v1beta1_containercluster.yaml b/crds/container_v1beta1_containercluster.yaml index c572286d0e..eeeba2a557 100644 --- a/crds/container_v1beta1_containercluster.yaml +++ b/crds/container_v1beta1_containercluster.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/container_v1beta1_containernodepool.yaml b/crds/container_v1beta1_containernodepool.yaml index 3c6bcaac30..9f103f979d 100644 --- a/crds/container_v1beta1_containernodepool.yaml +++ b/crds/container_v1beta1_containernodepool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/containeranalysis_v1beta1_containeranalysisnote.yaml b/crds/containeranalysis_v1beta1_containeranalysisnote.yaml index 7214dc2b4e..a6679c0184 100644 --- a/crds/containeranalysis_v1beta1_containeranalysisnote.yaml +++ b/crds/containeranalysis_v1beta1_containeranalysisnote.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml b/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml index f5b94ef27d..2740bb1a2e 100644 --- a/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml +++ b/crds/dataflow_v1beta1_dataflowflextemplatejob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/dataflow_v1beta1_dataflowjob.yaml b/crds/dataflow_v1beta1_dataflowjob.yaml index f2dd420bea..c3f8433b49 100644 --- a/crds/dataflow_v1beta1_dataflowjob.yaml +++ b/crds/dataflow_v1beta1_dataflowjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/datafusion_v1beta1_datafusioninstance.yaml b/crds/datafusion_v1beta1_datafusioninstance.yaml index 4a67bcb354..d87893fb8e 100644 --- a/crds/datafusion_v1beta1_datafusioninstance.yaml +++ b/crds/datafusion_v1beta1_datafusioninstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml b/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml index b66397970f..3819d6708d 100644 --- a/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml +++ b/crds/dataproc_v1beta1_dataprocautoscalingpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataproc_v1beta1_dataproccluster.yaml b/crds/dataproc_v1beta1_dataproccluster.yaml index b11786630b..5970affb62 100644 --- a/crds/dataproc_v1beta1_dataproccluster.yaml +++ b/crds/dataproc_v1beta1_dataproccluster.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml b/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml index 18fca65a90..00d99e79a8 100644 --- a/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml +++ b/crds/dataproc_v1beta1_dataprocworkflowtemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dlp_v1beta1_dlpdeidentifytemplate.yaml b/crds/dlp_v1beta1_dlpdeidentifytemplate.yaml new file mode 100644 index 0000000000..6e31b423e0 --- /dev/null +++ b/crds/dlp_v1beta1_dlpdeidentifytemplate.yaml @@ -0,0 +1,4188 @@ +# Copyright 2020 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.95.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: dlpdeidentifytemplates.dlp.cnrm.cloud.google.com +spec: + group: dlp.cnrm.cloud.google.com + names: + categories: + - gcp + kind: DLPDeidentifyTemplate + plural: dlpdeidentifytemplates + shortNames: + - gcpdlpdeidentifytemplate + - gcpdlpdeidentifytemplates + singular: dlpdeidentifytemplate + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + oneOf: + - required: + - organizationRef + - required: + - projectRef + properties: + deidentifyConfig: + description: The core content of the template. + properties: + infoTypeTransformations: + description: Treat the dataset as free-form text and apply the + same free text transformation everywhere. + properties: + transformations: + description: Required. Transformation for each infoType. Cannot + specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation to. + An empty list will cause this transformation to apply + to all findings that correspond to infoTypes that + were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information type. Either + a name of your choosing when creating a CustomInfoType, + or one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When sending + Cloud DLP results to Data Catalog, infoType + names should conform to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation to apply + to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + recordTransformations: + description: Treat the dataset as structured. Transformations + can be applied to specific locations within structured datasets, + such as transforming a column within a table. + properties: + fieldTransformations: + description: Transform the record by applying various field + transformations. + items: + properties: + condition: + description: 'Only apply the transformation if the condition + evaluates to true for the given `RecordCondition`. + The conditions are allowed to reference fields that + are not used in the actual transformation. Example + Use Cases: - Apply a different bucket transformation + to an age column if the zip code column for the same + record is within a specific range. - Redact a field + if the date of birth field is greater than 85.' + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + fields: + description: Required. Input field(s) to apply the transformation + to. When you have columns that reference their position + within a list, omit the index from the FieldId. FieldId + name matching ignores the index. For example, instead + of "contact.nums[0].type", use "contact.nums.type". + items: + properties: + name: + description: Name describing the field. + type: string + type: object + type: array + infoTypeTransformations: + description: Treat the contents of the field as free + text, and selectively transform content that matches + an `InfoType`. + properties: + transformations: + description: Required. Transformation for each infoType. + Cannot specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation + to. An empty list will cause this transformation + to apply to all findings that correspond + to infoTypes that were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information + type. Either a name of your choosing + when creating a CustomInfoType, or + one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data + Catalog, infoType names should conform + to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation + to apply to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges + must be non-overlapping. + items: + properties: + max: + description: Upper bound of + the range, exclusive; type + must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of + the range, inclusive. Type + should be the same as max + if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement + value for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, + items in this list will be skipped + when replacing characters. For example, + if the input string is `555-555-5555` + and you instruct Cloud DLP to skip + `-` and mask 5 characters with `*`, + Cloud DLP returns `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not + transform when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters + to not transform when masking. + Useful to avoid removing punctuation. + Possible values: COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, + ALPHA_LOWER_CASE, PUNCTUATION, + WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask + the sensitive values—for example, + `*` for an alphabetic string such + as a name, or `0` for a numeric + string such as ZIP code or credit + card number. This string must have + a length of 1. If not supplied, + this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters + to mask. If not set, all matching + chars will be masked. Skipped characters + do not count towards this tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse + order. For example, if `masking_character` + is `0`, `number_to_mask` is `14`, + and `reverse_order` is `false`, + then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. + If `masking_character` is `*`, `number_to_mask` + is `3`, and `reverse_order` is `true`, + then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used + for higher security and maintaining + referential integrity such that + the same identifier in two different + contexts will be given a distinct + surrogate. The context is appended + to plaintext value being encrypted. + On decryption the provided context + is validated against the value used + during encryption. If a context + was provided during encryption, + same context must be provided during + decryption as well. If the context + is not set, plaintext would be used + as is for encryption. If the context + is set but: 1. there is no record + present when transforming a given + value or 2. the field is not present + when transforming a given value, + plaintext would be used as is for + encryption. Note that case (1) is + expected when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s.' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption + using AES-SIV, the provided key + is internally expanded to 64 bytes + prior to use. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom info + type followed by the number of characters + comprising the surrogate. The following + scheme defines the format: {info + type name}({surrogate character + count}):{surrogate} For example, + if the name of custom info type + is ''MY_TOKEN_INFO_TYPE'' and the + surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate + when inspecting content using the + custom info type ''Surrogate''. + This facilitates reversal of the + surrogate when it occurs in free + text. Note: For record transformations + where the entire cell in a table + is being transformed, surrogates + are not mandatory. Surrogates are + used to denote the location of the + token and are necessary for re-identification + in free form text. In order for + inspection to work properly, the + name of this info type must not + occur naturally anywhere in your + data; otherwise, inspection may + either - reverse a surrogate that + does not correspond to an actual + identifier - be unable to parse + the surrogate and result in an error + Therefore, choose your custom info + type name carefully after considering + what your data looks like. One way + to select a name that has a high + chance of yielding reliable detection + is to include one or more unicode + characters that are highly improbable + to exist in your data. For example, + assuming your data is entered from + a regular ASCII keyboard, the symbol + with the hex code point 29DD might + be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash + function. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible + values: FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, + NUMERIC, HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, + ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context + may be used for higher security + since the same identifier in two + different contexts won''t be given + the same surrogate. If the context + is not set, a default tweak will + be used. If the context is set but: + 1. there is no record present when + transforming a given value or 1. + the field is not present when transforming + a given value, a default tweak will + be used. Note that case (1) is expected + when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s. Currently, + the referenced field may be of value + type integer or string. The tweak + is constructed as a sequence of + bytes in big endian byte order such + that: - a 64 bit integer is encoded + followed by a single byte of value + 1 - a string is encoded in UTF-8 + format followed by a single byte + of value 2' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Required. The key used + by the encryption algorithm. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by + mapping these to the alphanumeric + characters that the FFX mode natively + supports. This happens before/after + encryption/decryption. Each character + listed must appear only once. Number + of characters must be in the range + [2, 95]. This must be encoded as + ASCII. The order of characters does + not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select + the alphabet. Must be in the range + [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom infoType + followed by the number of characters + comprising the surrogate. The following + scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom + infoType is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the + full replacement value will be: + ''MY_TOKEN_INFO_TYPE(3):abc'' This + annotation identifies the surrogate + when inspecting content using the + custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the + surrogate when it occurs in free + text. In order for inspection to + work properly, the name of this + infoType must not occur naturally + anywhere in your data; otherwise, + inspection may find a surrogate + that does not correspond to an actual + identifier. Therefore, choose your + custom infoType name carefully after + considering what your data looks + like. One way to select a name that + has a high chance of yielding reliable + detection is to include one or more + unicode characters that are highly + improbable to exist in your data. + For example, assuming your data + is entered from a regular ASCII + keyboard, the symbol with the hex + code point 29DD might be used like + so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that + contains the context, for example, + an entity id. If set, must also + set cryptoKey. If set, shift will + be consistent for the given context. + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Causes the shift to be + computed based on this key and the + context. This results in the same + shift for the same context and crypto_key. + If set, must also set context. Can + only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, + -5 means shift date to at most 5 + days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift + in days. Actual shift will be selected + at random within this range (inclusive + ends). Negative means shift to earlier + in time. Must not be more than 365250 + days (1000 years) each direction. + For example, 3 means shift date + to at most 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each + bucket (except for minimum and maximum + buckets). So if `lower_bound` = + 10, `upper_bound` = 89, and `bucket_size` + = 10, then the following buckets + would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, + 80-89, 89+. Precision up to 2 decimals + works.' + format: double + type: number + lowerBound: + description: Required. Lower bound + value of buckets. All values less + than `lower_bound` are grouped together + into a single bucket; for example + if `lower_bound` = 10, then all + values less than 10 are replaced + with the value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound + value of buckets. All values greater + than upper_bound are grouped together + into a single bucket; for example + if `upper_bound` = 89, then all + values greater than 89 are replaced + with the value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified + value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time + to keep. Possible values: TIME_PART_UNSPECIFIED, + YEAR, MONTH, DAY_OF_MONTH, DAY_OF_WEEK, + WEEK_OF_YEAR, HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + primitiveTransformation: + description: Apply the transformation to the entire + field. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - fields + type: object + type: array + recordSuppressions: + description: Configuration defining which records get suppressed + entirely. Records that match any suppression rule are omitted + from the output. + items: + properties: + condition: + description: A condition that when it evaluates to true + will result in the record being evaluated to be suppressed + from the transformed content. + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + type: object + type: array + type: object + transformationErrorHandling: + description: Mode for handling transformation errors. If left + unspecified, the default mode is `TransformationErrorHandling.ThrowError`. + properties: + leaveUntransformed: + description: Ignore errors + type: object + x-kubernetes-preserve-unknown-fields: true + throwError: + description: Throw an error + type: object + x-kubernetes-preserve-unknown-fields: true + type: object + type: object + description: + description: Short description (max 256 chars). + type: string + displayName: + description: Display name (max 256 chars). + type: string + location: + description: Immutable. The location of the resource + type: string + organizationRef: + description: Immutable. The Organization that this resource belongs + to. Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a Google Cloud Organization (format: `organizations/{{name}}`).' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + projectRef: + description: Immutable. The Project that this resource belongs to. + Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a `Project` resource (format: `projects/{{name}}`).' + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + resourceID: + description: Immutable. Optional. The service-generated name of the + resource. Used for acquisition only. Leave unset to create a new + resource. + type: string + type: object + status: + properties: + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + createTime: + description: Output only. The creation timestamp of an inspectTemplate. + format: date-time + type: string + locationId: + description: Output only. The geographic location where this resource + is stored. + type: string + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + updateTime: + description: Output only. The last update timestamp of an inspectTemplate. + format: date-time + type: string + type: object + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] diff --git a/crds/dlp_v1beta1_dlpstoredinfotype.yaml b/crds/dlp_v1beta1_dlpstoredinfotype.yaml index 0a4f1ddf0d..21d40422c7 100644 --- a/crds/dlp_v1beta1_dlpstoredinfotype.yaml +++ b/crds/dlp_v1beta1_dlpstoredinfotype.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/dns_v1beta1_dnsmanagedzone.yaml b/crds/dns_v1beta1_dnsmanagedzone.yaml index 5c71ccbd1a..93f17fd6ed 100644 --- a/crds/dns_v1beta1_dnsmanagedzone.yaml +++ b/crds/dns_v1beta1_dnsmanagedzone.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/dns_v1beta1_dnspolicy.yaml b/crds/dns_v1beta1_dnspolicy.yaml index 9673ba077b..93dda3f4f4 100644 --- a/crds/dns_v1beta1_dnspolicy.yaml +++ b/crds/dns_v1beta1_dnspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/dns_v1beta1_dnsrecordset.yaml b/crds/dns_v1beta1_dnsrecordset.yaml index 7c88273173..6ac9db4b66 100644 --- a/crds/dns_v1beta1_dnsrecordset.yaml +++ b/crds/dns_v1beta1_dnsrecordset.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/eventarc_v1beta1_eventarctrigger.yaml b/crds/eventarc_v1beta1_eventarctrigger.yaml index da71fb28a7..b2d4ad45ec 100644 --- a/crds/eventarc_v1beta1_eventarctrigger.yaml +++ b/crds/eventarc_v1beta1_eventarctrigger.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/filestore_v1beta1_filestorebackup.yaml b/crds/filestore_v1beta1_filestorebackup.yaml index 54af41df1f..594c5a3e61 100644 --- a/crds/filestore_v1beta1_filestorebackup.yaml +++ b/crds/filestore_v1beta1_filestorebackup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/filestore_v1beta1_filestoreinstance.yaml b/crds/filestore_v1beta1_filestoreinstance.yaml index f4ea5f117b..078220dd97 100644 --- a/crds/filestore_v1beta1_filestoreinstance.yaml +++ b/crds/filestore_v1beta1_filestoreinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/firestore_v1beta1_firestoreindex.yaml b/crds/firestore_v1beta1_firestoreindex.yaml index 05125d6967..5090d689f7 100644 --- a/crds/firestore_v1beta1_firestoreindex.yaml +++ b/crds/firestore_v1beta1_firestoreindex.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/gameservices_v1beta1_gameservicesrealm.yaml b/crds/gameservices_v1beta1_gameservicesrealm.yaml index ddd24da5d9..0a2e7b28a7 100644 --- a/crds/gameservices_v1beta1_gameservicesrealm.yaml +++ b/crds/gameservices_v1beta1_gameservicesrealm.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/gkehub_v1beta1_gkehubfeature.yaml b/crds/gkehub_v1beta1_gkehubfeature.yaml index 67aff73f04..edfd285741 100644 --- a/crds/gkehub_v1beta1_gkehubfeature.yaml +++ b/crds/gkehub_v1beta1_gkehubfeature.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml b/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml index 4eba9c1de5..f71cb6c17f 100644 --- a/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml +++ b/crds/gkehub_v1beta1_gkehubfeaturemembership.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/gkehub_v1beta1_gkehubmembership.yaml b/crds/gkehub_v1beta1_gkehubmembership.yaml index bef13ab377..c69aa98d4b 100644 --- a/crds/gkehub_v1beta1_gkehubmembership.yaml +++ b/crds/gkehub_v1beta1_gkehubmembership.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iam_v1beta1_iamauditconfig.yaml b/crds/iam_v1beta1_iamauditconfig.yaml index 0b1afb1fbc..daea2c60ef 100644 --- a/crds/iam_v1beta1_iamauditconfig.yaml +++ b/crds/iam_v1beta1_iamauditconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamcustomrole.yaml b/crds/iam_v1beta1_iamcustomrole.yaml index 7edd7bad90..b800915026 100644 --- a/crds/iam_v1beta1_iamcustomrole.yaml +++ b/crds/iam_v1beta1_iamcustomrole.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iampartialpolicy.yaml b/crds/iam_v1beta1_iampartialpolicy.yaml index 745b6d80ab..c6917322c4 100644 --- a/crds/iam_v1beta1_iampartialpolicy.yaml +++ b/crds/iam_v1beta1_iampartialpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iampolicy.yaml b/crds/iam_v1beta1_iampolicy.yaml index 05449cea10..9f73ae038b 100644 --- a/crds/iam_v1beta1_iampolicy.yaml +++ b/crds/iam_v1beta1_iampolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iampolicymember.yaml b/crds/iam_v1beta1_iampolicymember.yaml index ed5d99b61d..43a5a1bf22 100644 --- a/crds/iam_v1beta1_iampolicymember.yaml +++ b/crds/iam_v1beta1_iampolicymember.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamserviceaccount.yaml b/crds/iam_v1beta1_iamserviceaccount.yaml index 09e71b3666..4f5661a615 100644 --- a/crds/iam_v1beta1_iamserviceaccount.yaml +++ b/crds/iam_v1beta1_iamserviceaccount.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamserviceaccountkey.yaml b/crds/iam_v1beta1_iamserviceaccountkey.yaml index df9e6dde39..8211f2f9ef 100644 --- a/crds/iam_v1beta1_iamserviceaccountkey.yaml +++ b/crds/iam_v1beta1_iamserviceaccountkey.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/iam_v1beta1_iamworkforcepool.yaml b/crds/iam_v1beta1_iamworkforcepool.yaml index 15c105a7de..baf0d6611e 100644 --- a/crds/iam_v1beta1_iamworkforcepool.yaml +++ b/crds/iam_v1beta1_iamworkforcepool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iam_v1beta1_iamworkforcepoolprovider.yaml b/crds/iam_v1beta1_iamworkforcepoolprovider.yaml index 05118d1405..7998866d37 100644 --- a/crds/iam_v1beta1_iamworkforcepoolprovider.yaml +++ b/crds/iam_v1beta1_iamworkforcepoolprovider.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iam_v1beta1_iamworkloadidentitypool.yaml b/crds/iam_v1beta1_iamworkloadidentitypool.yaml index 0a918bf390..2f262acde6 100644 --- a/crds/iam_v1beta1_iamworkloadidentitypool.yaml +++ b/crds/iam_v1beta1_iamworkloadidentitypool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml b/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml index b4195f113f..c414900940 100644 --- a/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml +++ b/crds/iam_v1beta1_iamworkloadidentitypoolprovider.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iap_v1beta1_iapbrand.yaml b/crds/iap_v1beta1_iapbrand.yaml index 266522445c..fc71dc9f24 100644 --- a/crds/iap_v1beta1_iapbrand.yaml +++ b/crds/iap_v1beta1_iapbrand.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/iap_v1beta1_iapidentityawareproxyclient.yaml b/crds/iap_v1beta1_iapidentityawareproxyclient.yaml index b3a4ee2f0e..6d67614671 100644 --- a/crds/iap_v1beta1_iapidentityawareproxyclient.yaml +++ b/crds/iap_v1beta1_iapidentityawareproxyclient.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformconfig.yaml b/crds/identityplatform_v1beta1_identityplatformconfig.yaml index dd6c14ec39..7c5dda23fd 100644 --- a/crds/identityplatform_v1beta1_identityplatformconfig.yaml +++ b/crds/identityplatform_v1beta1_identityplatformconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml b/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml index 9ba0f23849..a8a605e6ed 100644 --- a/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml +++ b/crds/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformtenant.yaml b/crds/identityplatform_v1beta1_identityplatformtenant.yaml index 79de6ab7b7..1f82e4392e 100644 --- a/crds/identityplatform_v1beta1_identityplatformtenant.yaml +++ b/crds/identityplatform_v1beta1_identityplatformtenant.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml b/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml index 6aa81333ee..50e2e79a30 100644 --- a/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml +++ b/crds/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/kms_v1beta1_kmscryptokey.yaml b/crds/kms_v1beta1_kmscryptokey.yaml index 5ff062d877..da1f1681f2 100644 --- a/crds/kms_v1beta1_kmscryptokey.yaml +++ b/crds/kms_v1beta1_kmscryptokey.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/kms_v1beta1_kmskeyring.yaml b/crds/kms_v1beta1_kmskeyring.yaml index d05633fba7..fa9b8995b4 100644 --- a/crds/kms_v1beta1_kmskeyring.yaml +++ b/crds/kms_v1beta1_kmskeyring.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/logging_v1beta1_logginglogbucket.yaml b/crds/logging_v1beta1_logginglogbucket.yaml index e6dbe1736c..28efbae9a5 100644 --- a/crds/logging_v1beta1_logginglogbucket.yaml +++ b/crds/logging_v1beta1_logginglogbucket.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/logging_v1beta1_logginglogexclusion.yaml b/crds/logging_v1beta1_logginglogexclusion.yaml index 2532acde2d..336e4688f9 100644 --- a/crds/logging_v1beta1_logginglogexclusion.yaml +++ b/crds/logging_v1beta1_logginglogexclusion.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/logging_v1beta1_logginglogmetric.yaml b/crds/logging_v1beta1_logginglogmetric.yaml index f274eab952..d996f1adca 100644 --- a/crds/logging_v1beta1_logginglogmetric.yaml +++ b/crds/logging_v1beta1_logginglogmetric.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/logging_v1beta1_logginglogsink.yaml b/crds/logging_v1beta1_logginglogsink.yaml index 0f2a2320f0..a6e1025ac6 100644 --- a/crds/logging_v1beta1_logginglogsink.yaml +++ b/crds/logging_v1beta1_logginglogsink.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/logging_v1beta1_logginglogview.yaml b/crds/logging_v1beta1_logginglogview.yaml index ef5ad2a622..cc48c78f61 100644 --- a/crds/logging_v1beta1_logginglogview.yaml +++ b/crds/logging_v1beta1_logginglogview.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/memcache_v1beta1_memcacheinstance.yaml b/crds/memcache_v1beta1_memcacheinstance.yaml index 4d190a4dfc..86b52ad5ee 100644 --- a/crds/memcache_v1beta1_memcacheinstance.yaml +++ b/crds/memcache_v1beta1_memcacheinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/monitoring_v1beta1_monitoringalertpolicy.yaml b/crds/monitoring_v1beta1_monitoringalertpolicy.yaml index 10ba1112d0..97b8ab38d4 100644 --- a/crds/monitoring_v1beta1_monitoringalertpolicy.yaml +++ b/crds/monitoring_v1beta1_monitoringalertpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/monitoring_v1beta1_monitoringdashboard.yaml b/crds/monitoring_v1beta1_monitoringdashboard.yaml index ac70dd3cfc..5e432db97b 100644 --- a/crds/monitoring_v1beta1_monitoringdashboard.yaml +++ b/crds/monitoring_v1beta1_monitoringdashboard.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringgroup.yaml b/crds/monitoring_v1beta1_monitoringgroup.yaml index a6f418f7cc..2bb09f94ad 100644 --- a/crds/monitoring_v1beta1_monitoringgroup.yaml +++ b/crds/monitoring_v1beta1_monitoringgroup.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml b/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml index 66b75d8c9f..3738a2e94c 100644 --- a/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml +++ b/crds/monitoring_v1beta1_monitoringmetricdescriptor.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringmonitoredproject.yaml b/crds/monitoring_v1beta1_monitoringmonitoredproject.yaml index 66b3834e6d..e9cf52d610 100644 --- a/crds/monitoring_v1beta1_monitoringmonitoredproject.yaml +++ b/crds/monitoring_v1beta1_monitoringmonitoredproject.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml b/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml index 4544c14246..31f090bf87 100644 --- a/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ b/crds/monitoring_v1beta1_monitoringnotificationchannel.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/monitoring_v1beta1_monitoringservice.yaml b/crds/monitoring_v1beta1_monitoringservice.yaml index 921cd2c208..52df1f10d0 100644 --- a/crds/monitoring_v1beta1_monitoringservice.yaml +++ b/crds/monitoring_v1beta1_monitoringservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml index 9f97f70741..4ea10ada3a 100644 --- a/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ b/crds/monitoring_v1beta1_monitoringservicelevelobjective.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml b/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml index 625b96e71a..ef3f8c0924 100644 --- a/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml +++ b/crds/monitoring_v1beta1_monitoringuptimecheckconfig.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml b/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml index bb1aa35906..4e8a454f0f 100644 --- a/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml +++ b/crds/networkconnectivity_v1beta1_networkconnectivityhub.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml b/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml index b76d296078..0b030bcb96 100644 --- a/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml +++ b/crds/networkconnectivity_v1beta1_networkconnectivityspoke.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml b/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml index d733a6125a..cdf442e975 100644 --- a/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml +++ b/crds/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml b/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml index a28d2b462e..99ab26c6d8 100644 --- a/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml +++ b/crds/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml b/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml index 142d1d32af..418ad95c08 100644 --- a/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml +++ b/crds/networksecurity_v1beta1_networksecurityservertlspolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml b/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml index 77a39434bf..d2834f2c28 100644 --- a/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml +++ b/crds/networkservices_v1beta1_networkservicesendpointpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesgateway.yaml b/crds/networkservices_v1beta1_networkservicesgateway.yaml index 0535bb020d..d0ce5ece9e 100644 --- a/crds/networkservices_v1beta1_networkservicesgateway.yaml +++ b/crds/networkservices_v1beta1_networkservicesgateway.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml b/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml index 236c801adb..3d9cff7ef3 100644 --- a/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml +++ b/crds/networkservices_v1beta1_networkservicesgrpcroute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkserviceshttproute.yaml b/crds/networkservices_v1beta1_networkserviceshttproute.yaml index 2dd0b7b5b1..c9d2376bba 100644 --- a/crds/networkservices_v1beta1_networkserviceshttproute.yaml +++ b/crds/networkservices_v1beta1_networkserviceshttproute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicesmesh.yaml b/crds/networkservices_v1beta1_networkservicesmesh.yaml index 6341173aee..f37ba8dff0 100644 --- a/crds/networkservices_v1beta1_networkservicesmesh.yaml +++ b/crds/networkservices_v1beta1_networkservicesmesh.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicestcproute.yaml b/crds/networkservices_v1beta1_networkservicestcproute.yaml index 317d12e609..0dc9190229 100644 --- a/crds/networkservices_v1beta1_networkservicestcproute.yaml +++ b/crds/networkservices_v1beta1_networkservicestcproute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/networkservices_v1beta1_networkservicestlsroute.yaml b/crds/networkservices_v1beta1_networkservicestlsroute.yaml index ccdc03bcdc..2fb7cac8f0 100644 --- a/crds/networkservices_v1beta1_networkservicestlsroute.yaml +++ b/crds/networkservices_v1beta1_networkservicestlsroute.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/osconfig_v1beta1_osconfigguestpolicy.yaml b/crds/osconfig_v1beta1_osconfigguestpolicy.yaml index e5a53f6c36..e742e46e05 100644 --- a/crds/osconfig_v1beta1_osconfigguestpolicy.yaml +++ b/crds/osconfig_v1beta1_osconfigguestpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml b/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml index 91a1766731..55a241a4c3 100644 --- a/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml +++ b/crds/osconfig_v1beta1_osconfigospolicyassignment.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacapool.yaml b/crds/privateca_v1beta1_privatecacapool.yaml index a7b7bfd101..ba65ee5a17 100644 --- a/crds/privateca_v1beta1_privatecacapool.yaml +++ b/crds/privateca_v1beta1_privatecacapool.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacertificate.yaml b/crds/privateca_v1beta1_privatecacertificate.yaml index 84bac7f82e..2d0c58df44 100644 --- a/crds/privateca_v1beta1_privatecacertificate.yaml +++ b/crds/privateca_v1beta1_privatecacertificate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacertificateauthority.yaml b/crds/privateca_v1beta1_privatecacertificateauthority.yaml index 67e4966135..a8541db5da 100644 --- a/crds/privateca_v1beta1_privatecacertificateauthority.yaml +++ b/crds/privateca_v1beta1_privatecacertificateauthority.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/privateca_v1beta1_privatecacertificatetemplate.yaml b/crds/privateca_v1beta1_privatecacertificatetemplate.yaml index fff63b8cdf..8ba1a473e8 100644 --- a/crds/privateca_v1beta1_privatecacertificatetemplate.yaml +++ b/crds/privateca_v1beta1_privatecacertificatetemplate.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/pubsub_v1beta1_pubsubschema.yaml b/crds/pubsub_v1beta1_pubsubschema.yaml index ec4c13ca0d..17f7af9ea9 100644 --- a/crds/pubsub_v1beta1_pubsubschema.yaml +++ b/crds/pubsub_v1beta1_pubsubschema.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/pubsub_v1beta1_pubsubsubscription.yaml b/crds/pubsub_v1beta1_pubsubsubscription.yaml index aa58598524..2ff3d677b6 100644 --- a/crds/pubsub_v1beta1_pubsubsubscription.yaml +++ b/crds/pubsub_v1beta1_pubsubsubscription.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/pubsub_v1beta1_pubsubtopic.yaml b/crds/pubsub_v1beta1_pubsubtopic.yaml index bbba28aa32..4db3f4d906 100644 --- a/crds/pubsub_v1beta1_pubsubtopic.yaml +++ b/crds/pubsub_v1beta1_pubsubtopic.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml b/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml index 16ee73f341..ce59cd0f16 100644 --- a/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml +++ b/crds/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/redis_v1beta1_redisinstance.yaml b/crds/redis_v1beta1_redisinstance.yaml index f1135b3ec6..6efd2102d7 100644 --- a/crds/redis_v1beta1_redisinstance.yaml +++ b/crds/redis_v1beta1_redisinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_folder.yaml b/crds/resourcemanager_v1beta1_folder.yaml index d7ff844ff8..69f7d4648d 100644 --- a/crds/resourcemanager_v1beta1_folder.yaml +++ b/crds/resourcemanager_v1beta1_folder.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_project.yaml b/crds/resourcemanager_v1beta1_project.yaml index 7569f79642..4982b4fa4f 100644 --- a/crds/resourcemanager_v1beta1_project.yaml +++ b/crds/resourcemanager_v1beta1_project.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml b/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml index f1b1a64015..1afcdcb012 100644 --- a/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml +++ b/crds/resourcemanager_v1beta1_resourcemanagerlien.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml b/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml index cea1d1c721..cee5ed1852 100644 --- a/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml +++ b/crds/resourcemanager_v1beta1_resourcemanagerpolicy.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/run_v1beta1_runservice.yaml b/crds/run_v1beta1_runservice.yaml index 983286a338..2422792bf4 100644 --- a/crds/run_v1beta1_runservice.yaml +++ b/crds/run_v1beta1_runservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/crds/secretmanager_v1beta1_secretmanagersecret.yaml b/crds/secretmanager_v1beta1_secretmanagersecret.yaml index 5887754dd6..c77472f95a 100644 --- a/crds/secretmanager_v1beta1_secretmanagersecret.yaml +++ b/crds/secretmanager_v1beta1_secretmanagersecret.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml b/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml index 4fb45a4b4f..033a30e3f1 100644 --- a/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml +++ b/crds/secretmanager_v1beta1_secretmanagersecretversion.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/servicedirectory_v1beta1_servicedirectoryendpoint.yaml b/crds/servicedirectory_v1beta1_servicedirectoryendpoint.yaml index 9d70eb9051..9cb5999e50 100644 --- a/crds/servicedirectory_v1beta1_servicedirectoryendpoint.yaml +++ b/crds/servicedirectory_v1beta1_servicedirectoryendpoint.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/servicedirectory_v1beta1_servicedirectorynamespace.yaml b/crds/servicedirectory_v1beta1_servicedirectorynamespace.yaml index 0007f56c98..33cbe849ad 100644 --- a/crds/servicedirectory_v1beta1_servicedirectorynamespace.yaml +++ b/crds/servicedirectory_v1beta1_servicedirectorynamespace.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/servicedirectory_v1beta1_servicedirectoryservice.yaml b/crds/servicedirectory_v1beta1_servicedirectoryservice.yaml index 1513242c39..f5ebcd83ea 100644 --- a/crds/servicedirectory_v1beta1_servicedirectoryservice.yaml +++ b/crds/servicedirectory_v1beta1_servicedirectoryservice.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml index a15b80ac0f..515170b019 100644 --- a/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ b/crds/servicenetworking_v1beta1_servicenetworkingconnection.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/serviceusage_v1beta1_service.yaml b/crds/serviceusage_v1beta1_service.yaml index 861152d05a..ed285c7a88 100644 --- a/crds/serviceusage_v1beta1_service.yaml +++ b/crds/serviceusage_v1beta1_service.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sourcerepo_v1beta1_sourcereporepository.yaml b/crds/sourcerepo_v1beta1_sourcereporepository.yaml index e90fe5e9da..d9566fce3b 100644 --- a/crds/sourcerepo_v1beta1_sourcereporepository.yaml +++ b/crds/sourcerepo_v1beta1_sourcereporepository.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/spanner_v1beta1_spannerdatabase.yaml b/crds/spanner_v1beta1_spannerdatabase.yaml index fbdd476155..0ecde67e95 100644 --- a/crds/spanner_v1beta1_spannerdatabase.yaml +++ b/crds/spanner_v1beta1_spannerdatabase.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/spanner_v1beta1_spannerinstance.yaml b/crds/spanner_v1beta1_spannerinstance.yaml index c5f40c05da..7b157e4706 100644 --- a/crds/spanner_v1beta1_spannerinstance.yaml +++ b/crds/spanner_v1beta1_spannerinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqldatabase.yaml b/crds/sql_v1beta1_sqldatabase.yaml index 6b340d2c15..6103494e16 100644 --- a/crds/sql_v1beta1_sqldatabase.yaml +++ b/crds/sql_v1beta1_sqldatabase.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqlinstance.yaml b/crds/sql_v1beta1_sqlinstance.yaml index 416124b57f..53ef3e5a97 100644 --- a/crds/sql_v1beta1_sqlinstance.yaml +++ b/crds/sql_v1beta1_sqlinstance.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqlsslcert.yaml b/crds/sql_v1beta1_sqlsslcert.yaml index 9ef0b5dad7..61e9d7ab8f 100644 --- a/crds/sql_v1beta1_sqlsslcert.yaml +++ b/crds/sql_v1beta1_sqlsslcert.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/sql_v1beta1_sqluser.yaml b/crds/sql_v1beta1_sqluser.yaml index 5e8af10d78..9faf957a4e 100644 --- a/crds/sql_v1beta1_sqluser.yaml +++ b/crds/sql_v1beta1_sqluser.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagebucket.yaml b/crds/storage_v1beta1_storagebucket.yaml index 743d5d26b4..1e74d4c2fd 100644 --- a/crds/storage_v1beta1_storagebucket.yaml +++ b/crds/storage_v1beta1_storagebucket.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagebucketaccesscontrol.yaml b/crds/storage_v1beta1_storagebucketaccesscontrol.yaml index b7ef05dfaa..b11fa800f4 100644 --- a/crds/storage_v1beta1_storagebucketaccesscontrol.yaml +++ b/crds/storage_v1beta1_storagebucketaccesscontrol.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml b/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml index ace93a26c3..36863dba21 100644 --- a/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml +++ b/crds/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storage_v1beta1_storagenotification.yaml b/crds/storage_v1beta1_storagenotification.yaml index a5cc32aac1..6504c7c28c 100644 --- a/crds/storage_v1beta1_storagenotification.yaml +++ b/crds/storage_v1beta1_storagenotification.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/storagetransfer_v1beta1_storagetransferjob.yaml b/crds/storagetransfer_v1beta1_storagetransferjob.yaml index 8d51a98aa1..cddf42e15d 100644 --- a/crds/storagetransfer_v1beta1_storagetransferjob.yaml +++ b/crds/storagetransfer_v1beta1_storagetransferjob.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" diff --git a/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml b/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml index 2d2486d762..152814e780 100644 --- a/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml +++ b/crds/vpcaccess_v1beta1_vpcaccessconnector.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml b/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml index b3196636cd..4efe8a9fa6 100644 --- a/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml +++ b/install-bundles/install-bundle-gcp-identity/0-cnrm-system.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: Namespace metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-system @@ -25,7 +25,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-controller-manager @@ -35,7 +35,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -45,7 +45,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-resource-stats-recorder @@ -55,7 +55,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-manager @@ -65,7 +65,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-cnrm-system-role @@ -86,7 +86,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-cnrm-system-role @@ -107,7 +107,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -744,7 +744,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role @@ -794,7 +794,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-cluster-role @@ -852,7 +852,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-ns-role @@ -877,7 +877,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-role @@ -907,7 +907,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -1335,7 +1335,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role @@ -1398,7 +1398,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role-binding @@ -1416,7 +1416,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role-binding @@ -1434,7 +1434,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-admin-binding @@ -1457,7 +1457,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-binding @@ -1474,7 +1474,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-binding @@ -1491,7 +1491,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-watcher-binding @@ -1508,7 +1508,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-binding @@ -1525,7 +1525,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-binding @@ -1542,7 +1542,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -1559,7 +1559,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -1581,7 +1581,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 prometheus.io/port: "48797" prometheus.io/scrape: "true" labels: @@ -1602,7 +1602,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -1620,7 +1620,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -1633,8 +1633,8 @@ spec: - /configconnector/recorder env: - name: CONFIG_CONNECTOR_VERSION - value: 1.94.0 - image: gcr.io/cnrm-eap/recorder:900e5e8 + value: 1.95.0 + image: gcr.io/cnrm-eap/recorder:c919d52 imagePullPolicy: Always name: recorder ports: @@ -1659,6 +1659,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false hostNetwork: true serviceAccountName: cnrm-resource-stats-recorder terminationGracePeriodSeconds: 10 @@ -1667,7 +1668,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -1682,7 +1683,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -1695,7 +1696,7 @@ spec: valueFrom: fieldRef: fieldPath: metadata.namespace - image: gcr.io/cnrm-eap/webhook:900e5e8 + image: gcr.io/cnrm-eap/webhook:c919d52 imagePullPolicy: Always name: webhook ports: @@ -1717,6 +1718,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-webhook-manager terminationGracePeriodSeconds: 10 --- @@ -1724,7 +1726,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -1739,7 +1741,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -1752,7 +1754,7 @@ spec: env: - name: GOOGLE_APPLICATION_CREDENTIALS value: /var/secrets/google/key.json - image: gcr.io/cnrm-eap/controller:900e5e8 + image: gcr.io/cnrm-eap/controller:c919d52 imagePullPolicy: Always name: manager ports: @@ -1777,6 +1779,7 @@ spec: volumeMounts: - mountPath: /var/secrets/google name: gcp-service-account + enableServiceLinks: false serviceAccountName: cnrm-controller-manager terminationGracePeriodSeconds: 10 volumes: @@ -1788,7 +1791,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -1803,7 +1806,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -1811,7 +1814,7 @@ spec: containers: - command: - /configconnector/deletiondefender - image: gcr.io/cnrm-eap/deletiondefender:900e5e8 + image: gcr.io/cnrm-eap/deletiondefender:c919d52 imagePullPolicy: Always name: deletiondefender ports: @@ -1833,35 +1836,25 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-deletiondefender terminationGracePeriodSeconds: 10 --- -apiVersion: autoscaling/v2beta2 +apiVersion: autoscaling/v1 kind: HorizontalPodAutoscaler metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + autoscaling.alpha.kubernetes.io/metrics: '[{"type":"Resource","resource":{"name":"memory","targetAverageUtilization":90}}]' + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook namespace: cnrm-system spec: maxReplicas: 20 - metrics: - - resource: - name: cpu - target: - averageUtilization: 90 - type: Utilization - type: Resource - - resource: - name: memory - target: - averageUtilization: 90 - type: Utilization - type: Resource minReplicas: 2 scaleTargetRef: apiVersion: apps/v1 kind: Deployment name: cnrm-webhook-manager + targetCPUUtilizationPercentage: 90 diff --git a/install-bundles/install-bundle-gcp-identity/crds.yaml b/install-bundles/install-bundle-gcp-identity/crds.yaml index 2961e1f46b..a8b8370faf 100644 --- a/install-bundles/install-bundle-gcp-identity/crds.yaml +++ b/install-bundles/install-bundle-gcp-identity/crds.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -402,7 +402,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -532,7 +532,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1740,7 +1740,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -1915,7 +1915,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -2090,7 +2090,7 @@ spec: description: |- Cloud KMS key name used for encrypting the data that is stored and replicated across runtime instances. Update is not allowed after the organization is created. Required when (#RuntimeType) is `TRIAL`, a Google-Managed encryption key will be used. For example: "projects/foo/locations/us/keyRings/bar/cryptoKeys/baz". **Note:** Not supported for Apigee hybrid. - Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `projects/{{project}}/locations/{{location}}/keyRings/{{key_ring}}/cryptoKeys/{{name}}`). + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). type: string name: description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' @@ -2209,7 +2209,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2400,7 +2400,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2749,7 +2749,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3584,7 +3584,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4031,7 +4031,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4208,7 +4208,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4413,7 +4413,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4629,7 +4629,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4791,7 +4791,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5250,7 +5250,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5518,7 +5518,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5943,7 +5943,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7063,7 +7063,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7495,7 +7495,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7689,7 +7689,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7956,7 +7956,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -8494,7 +8494,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8747,7 +8747,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -9012,7 +9012,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10127,7 +10127,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10744,7 +10744,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10890,7 +10890,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11110,7 +11110,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11302,7 +11302,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11592,7 +11592,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11972,7 +11972,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12630,7 +12630,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13094,7 +13094,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13255,7 +13255,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13416,7 +13416,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13695,7 +13695,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -14474,7 +14474,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -14677,7 +14677,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15609,7 +15609,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16350,7 +16350,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16676,7 +16676,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16886,7 +16886,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17081,7 +17081,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17245,7 +17245,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17454,7 +17454,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17635,7 +17635,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -18035,7 +18035,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18153,7 +18153,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18459,7 +18459,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18673,7 +18673,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18974,7 +18974,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19184,7 +19184,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19530,7 +19530,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19836,7 +19836,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20060,7 +20060,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20339,7 +20339,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20682,7 +20682,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -21029,7 +21029,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21135,7 +21135,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21274,7 +21274,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21653,7 +21653,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21868,7 +21868,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22031,7 +22031,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22319,7 +22319,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22497,7 +22497,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22667,7 +22667,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22944,7 +22944,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23140,7 +23140,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23366,7 +23366,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23594,7 +23594,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23761,7 +23761,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23922,7 +23922,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -26633,7 +26633,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -26832,7 +26832,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -27204,7 +27204,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -27450,7 +27450,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -28040,7 +28040,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -29429,7 +29429,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30008,7 +30008,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30134,7 +30134,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30420,7 +30420,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30699,7 +30699,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30994,7 +30994,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -32205,7 +32205,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34147,7 +34147,4183 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: dlpdeidentifytemplates.dlp.cnrm.cloud.google.com +spec: + group: dlp.cnrm.cloud.google.com + names: + categories: + - gcp + kind: DLPDeidentifyTemplate + plural: dlpdeidentifytemplates + shortNames: + - gcpdlpdeidentifytemplate + - gcpdlpdeidentifytemplates + singular: dlpdeidentifytemplate + preserveUnknownFields: false + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + oneOf: + - required: + - organizationRef + - required: + - projectRef + properties: + deidentifyConfig: + description: The core content of the template. + properties: + infoTypeTransformations: + description: Treat the dataset as free-form text and apply the + same free text transformation everywhere. + properties: + transformations: + description: Required. Transformation for each infoType. Cannot + specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation to. + An empty list will cause this transformation to apply + to all findings that correspond to infoTypes that + were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information type. Either + a name of your choosing when creating a CustomInfoType, + or one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When sending + Cloud DLP results to Data Catalog, infoType + names should conform to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation to apply + to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + recordTransformations: + description: Treat the dataset as structured. Transformations + can be applied to specific locations within structured datasets, + such as transforming a column within a table. + properties: + fieldTransformations: + description: Transform the record by applying various field + transformations. + items: + properties: + condition: + description: 'Only apply the transformation if the condition + evaluates to true for the given `RecordCondition`. + The conditions are allowed to reference fields that + are not used in the actual transformation. Example + Use Cases: - Apply a different bucket transformation + to an age column if the zip code column for the same + record is within a specific range. - Redact a field + if the date of birth field is greater than 85.' + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + fields: + description: Required. Input field(s) to apply the transformation + to. When you have columns that reference their position + within a list, omit the index from the FieldId. FieldId + name matching ignores the index. For example, instead + of "contact.nums[0].type", use "contact.nums.type". + items: + properties: + name: + description: Name describing the field. + type: string + type: object + type: array + infoTypeTransformations: + description: Treat the contents of the field as free + text, and selectively transform content that matches + an `InfoType`. + properties: + transformations: + description: Required. Transformation for each infoType. + Cannot specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation + to. An empty list will cause this transformation + to apply to all findings that correspond + to infoTypes that were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information + type. Either a name of your choosing + when creating a CustomInfoType, or + one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data + Catalog, infoType names should conform + to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation + to apply to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges + must be non-overlapping. + items: + properties: + max: + description: Upper bound of + the range, exclusive; type + must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of + the range, inclusive. Type + should be the same as max + if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement + value for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, + items in this list will be skipped + when replacing characters. For example, + if the input string is `555-555-5555` + and you instruct Cloud DLP to skip + `-` and mask 5 characters with `*`, + Cloud DLP returns `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not + transform when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters + to not transform when masking. + Useful to avoid removing punctuation. + Possible values: COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, + ALPHA_LOWER_CASE, PUNCTUATION, + WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask + the sensitive values—for example, + `*` for an alphabetic string such + as a name, or `0` for a numeric + string such as ZIP code or credit + card number. This string must have + a length of 1. If not supplied, + this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters + to mask. If not set, all matching + chars will be masked. Skipped characters + do not count towards this tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse + order. For example, if `masking_character` + is `0`, `number_to_mask` is `14`, + and `reverse_order` is `false`, + then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. + If `masking_character` is `*`, `number_to_mask` + is `3`, and `reverse_order` is `true`, + then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used + for higher security and maintaining + referential integrity such that + the same identifier in two different + contexts will be given a distinct + surrogate. The context is appended + to plaintext value being encrypted. + On decryption the provided context + is validated against the value used + during encryption. If a context + was provided during encryption, + same context must be provided during + decryption as well. If the context + is not set, plaintext would be used + as is for encryption. If the context + is set but: 1. there is no record + present when transforming a given + value or 2. the field is not present + when transforming a given value, + plaintext would be used as is for + encryption. Note that case (1) is + expected when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s.' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption + using AES-SIV, the provided key + is internally expanded to 64 bytes + prior to use. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom info + type followed by the number of characters + comprising the surrogate. The following + scheme defines the format: {info + type name}({surrogate character + count}):{surrogate} For example, + if the name of custom info type + is ''MY_TOKEN_INFO_TYPE'' and the + surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate + when inspecting content using the + custom info type ''Surrogate''. + This facilitates reversal of the + surrogate when it occurs in free + text. Note: For record transformations + where the entire cell in a table + is being transformed, surrogates + are not mandatory. Surrogates are + used to denote the location of the + token and are necessary for re-identification + in free form text. In order for + inspection to work properly, the + name of this info type must not + occur naturally anywhere in your + data; otherwise, inspection may + either - reverse a surrogate that + does not correspond to an actual + identifier - be unable to parse + the surrogate and result in an error + Therefore, choose your custom info + type name carefully after considering + what your data looks like. One way + to select a name that has a high + chance of yielding reliable detection + is to include one or more unicode + characters that are highly improbable + to exist in your data. For example, + assuming your data is entered from + a regular ASCII keyboard, the symbol + with the hex code point 29DD might + be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash + function. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible + values: FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, + NUMERIC, HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, + ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context + may be used for higher security + since the same identifier in two + different contexts won''t be given + the same surrogate. If the context + is not set, a default tweak will + be used. If the context is set but: + 1. there is no record present when + transforming a given value or 1. + the field is not present when transforming + a given value, a default tweak will + be used. Note that case (1) is expected + when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s. Currently, + the referenced field may be of value + type integer or string. The tweak + is constructed as a sequence of + bytes in big endian byte order such + that: - a 64 bit integer is encoded + followed by a single byte of value + 1 - a string is encoded in UTF-8 + format followed by a single byte + of value 2' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Required. The key used + by the encryption algorithm. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by + mapping these to the alphanumeric + characters that the FFX mode natively + supports. This happens before/after + encryption/decryption. Each character + listed must appear only once. Number + of characters must be in the range + [2, 95]. This must be encoded as + ASCII. The order of characters does + not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select + the alphabet. Must be in the range + [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom infoType + followed by the number of characters + comprising the surrogate. The following + scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom + infoType is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the + full replacement value will be: + ''MY_TOKEN_INFO_TYPE(3):abc'' This + annotation identifies the surrogate + when inspecting content using the + custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the + surrogate when it occurs in free + text. In order for inspection to + work properly, the name of this + infoType must not occur naturally + anywhere in your data; otherwise, + inspection may find a surrogate + that does not correspond to an actual + identifier. Therefore, choose your + custom infoType name carefully after + considering what your data looks + like. One way to select a name that + has a high chance of yielding reliable + detection is to include one or more + unicode characters that are highly + improbable to exist in your data. + For example, assuming your data + is entered from a regular ASCII + keyboard, the symbol with the hex + code point 29DD might be used like + so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that + contains the context, for example, + an entity id. If set, must also + set cryptoKey. If set, shift will + be consistent for the given context. + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Causes the shift to be + computed based on this key and the + context. This results in the same + shift for the same context and crypto_key. + If set, must also set context. Can + only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, + -5 means shift date to at most 5 + days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift + in days. Actual shift will be selected + at random within this range (inclusive + ends). Negative means shift to earlier + in time. Must not be more than 365250 + days (1000 years) each direction. + For example, 3 means shift date + to at most 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each + bucket (except for minimum and maximum + buckets). So if `lower_bound` = + 10, `upper_bound` = 89, and `bucket_size` + = 10, then the following buckets + would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, + 80-89, 89+. Precision up to 2 decimals + works.' + format: double + type: number + lowerBound: + description: Required. Lower bound + value of buckets. All values less + than `lower_bound` are grouped together + into a single bucket; for example + if `lower_bound` = 10, then all + values less than 10 are replaced + with the value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound + value of buckets. All values greater + than upper_bound are grouped together + into a single bucket; for example + if `upper_bound` = 89, then all + values greater than 89 are replaced + with the value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified + value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time + to keep. Possible values: TIME_PART_UNSPECIFIED, + YEAR, MONTH, DAY_OF_MONTH, DAY_OF_WEEK, + WEEK_OF_YEAR, HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + primitiveTransformation: + description: Apply the transformation to the entire + field. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - fields + type: object + type: array + recordSuppressions: + description: Configuration defining which records get suppressed + entirely. Records that match any suppression rule are omitted + from the output. + items: + properties: + condition: + description: A condition that when it evaluates to true + will result in the record being evaluated to be suppressed + from the transformed content. + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + type: object + type: array + type: object + transformationErrorHandling: + description: Mode for handling transformation errors. If left + unspecified, the default mode is `TransformationErrorHandling.ThrowError`. + properties: + leaveUntransformed: + description: Ignore errors + type: object + x-kubernetes-preserve-unknown-fields: true + throwError: + description: Throw an error + type: object + x-kubernetes-preserve-unknown-fields: true + type: object + type: object + description: + description: Short description (max 256 chars). + type: string + displayName: + description: Display name (max 256 chars). + type: string + location: + description: Immutable. The location of the resource + type: string + organizationRef: + description: Immutable. The Organization that this resource belongs + to. Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a Google Cloud Organization (format: `organizations/{{name}}`).' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + projectRef: + description: Immutable. The Project that this resource belongs to. + Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a `Project` resource (format: `projects/{{name}}`).' + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + resourceID: + description: Immutable. Optional. The service-generated name of the + resource. Used for acquisition only. Leave unset to create a new + resource. + type: string + type: object + status: + properties: + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + createTime: + description: Output only. The creation timestamp of an inspectTemplate. + format: date-time + type: string + locationId: + description: Output only. The geographic location where this resource + is stored. + type: string + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + updateTime: + description: Output only. The last update timestamp of an inspectTemplate. + format: date-time + type: string + type: object + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] +--- +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34518,7 +38694,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34854,7 +39030,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35050,7 +39226,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35248,7 +39424,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35699,7 +39875,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35921,7 +40097,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -36250,7 +40426,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36404,7 +40580,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36617,7 +40793,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -36755,7 +40931,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37124,7 +41300,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37364,7 +41540,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37729,7 +41905,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -37890,7 +42066,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38030,7 +42206,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38341,7 +42517,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38569,7 +42745,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38796,7 +42972,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38975,7 +43151,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -39112,7 +43288,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39364,7 +43540,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39545,7 +43721,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39841,7 +44017,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40008,7 +44184,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40134,7 +44310,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40288,7 +44464,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40980,7 +45156,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41163,7 +45339,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41380,7 +45556,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41533,7 +45709,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41725,7 +45901,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41851,7 +46027,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42135,7 +46311,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42410,7 +46586,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42831,7 +47007,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -43235,7 +47411,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -43539,7 +47715,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -43876,7 +48052,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -44691,7 +48867,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51573,7 +55749,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51764,7 +55940,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52059,7 +56235,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52186,7 +56362,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -52479,7 +56655,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53050,7 +57226,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53209,7 +57385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53588,7 +57764,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53770,7 +57946,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54115,7 +58291,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54373,7 +58549,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54602,7 +58778,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54846,7 +59022,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55167,7 +59343,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55428,7 +59604,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55901,7 +60077,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56641,7 +60817,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56823,7 +60999,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57159,7 +61335,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57480,7 +61656,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -58249,7 +62425,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59247,7 +63423,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59743,7 +63919,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -60741,7 +64917,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -61652,7 +65828,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -62068,7 +66244,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62293,7 +66469,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62449,7 +66625,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62870,7 +67046,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63087,7 +67263,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -63323,7 +67499,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63772,7 +67948,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63950,7 +68126,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -64231,7 +68407,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -65113,7 +69289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65375,7 +69551,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65575,7 +69751,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65795,7 +69971,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65952,7 +70128,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66104,7 +70280,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66282,7 +70458,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66423,7 +70599,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66622,7 +70798,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66829,7 +71005,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66969,7 +71145,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67133,7 +71309,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67788,7 +71964,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67964,7 +72140,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68171,7 +72347,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68341,7 +72517,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68686,7 +72862,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68872,7 +73048,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -69075,7 +73251,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -69633,7 +73809,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml b/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml index 4d8743fa21..8a1703f576 100644 --- a/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml +++ b/install-bundles/install-bundle-namespaced/0-cnrm-system.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: Namespace metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-system @@ -25,7 +25,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -35,7 +35,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-resource-stats-recorder @@ -45,7 +45,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-manager @@ -55,7 +55,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-cnrm-system-role @@ -76,7 +76,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-cnrm-system-role @@ -97,7 +97,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -734,7 +734,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role @@ -784,7 +784,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-cluster-role @@ -842,7 +842,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-ns-role @@ -867,7 +867,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-role @@ -897,7 +897,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -1325,7 +1325,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role @@ -1388,7 +1388,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role-binding @@ -1406,7 +1406,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role-binding @@ -1424,7 +1424,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-admin-binding @@ -1444,7 +1444,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-binding @@ -1461,7 +1461,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-binding @@ -1478,7 +1478,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-binding @@ -1495,7 +1495,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -1512,7 +1512,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 prometheus.io/port: "48797" prometheus.io/scrape: "true" labels: @@ -1533,7 +1533,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -1551,7 +1551,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -1564,8 +1564,8 @@ spec: - /configconnector/recorder env: - name: CONFIG_CONNECTOR_VERSION - value: 1.94.0 - image: gcr.io/cnrm-eap/recorder:900e5e8 + value: 1.95.0 + image: gcr.io/cnrm-eap/recorder:c919d52 imagePullPolicy: Always name: recorder ports: @@ -1590,6 +1590,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false hostNetwork: true serviceAccountName: cnrm-resource-stats-recorder terminationGracePeriodSeconds: 10 @@ -1598,7 +1599,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -1613,7 +1614,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -1626,7 +1627,7 @@ spec: valueFrom: fieldRef: fieldPath: metadata.namespace - image: gcr.io/cnrm-eap/webhook:900e5e8 + image: gcr.io/cnrm-eap/webhook:c919d52 imagePullPolicy: Always name: webhook ports: @@ -1648,6 +1649,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-webhook-manager terminationGracePeriodSeconds: 10 --- @@ -1655,7 +1657,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -1670,7 +1672,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -1678,7 +1680,7 @@ spec: containers: - command: - /configconnector/deletiondefender - image: gcr.io/cnrm-eap/deletiondefender:900e5e8 + image: gcr.io/cnrm-eap/deletiondefender:c919d52 imagePullPolicy: Always name: deletiondefender ports: @@ -1700,35 +1702,25 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-deletiondefender terminationGracePeriodSeconds: 10 --- -apiVersion: autoscaling/v2beta2 +apiVersion: autoscaling/v1 kind: HorizontalPodAutoscaler metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + autoscaling.alpha.kubernetes.io/metrics: '[{"type":"Resource","resource":{"name":"memory","targetAverageUtilization":90}}]' + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook namespace: cnrm-system spec: maxReplicas: 20 - metrics: - - resource: - name: cpu - target: - averageUtilization: 90 - type: Utilization - type: Resource - - resource: - name: memory - target: - averageUtilization: 90 - type: Utilization - type: Resource minReplicas: 2 scaleTargetRef: apiVersion: apps/v1 kind: Deployment name: cnrm-webhook-manager + targetCPUUtilizationPercentage: 90 diff --git a/install-bundles/install-bundle-namespaced/crds.yaml b/install-bundles/install-bundle-namespaced/crds.yaml index 2961e1f46b..a8b8370faf 100644 --- a/install-bundles/install-bundle-namespaced/crds.yaml +++ b/install-bundles/install-bundle-namespaced/crds.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -402,7 +402,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -532,7 +532,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1740,7 +1740,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -1915,7 +1915,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -2090,7 +2090,7 @@ spec: description: |- Cloud KMS key name used for encrypting the data that is stored and replicated across runtime instances. Update is not allowed after the organization is created. Required when (#RuntimeType) is `TRIAL`, a Google-Managed encryption key will be used. For example: "projects/foo/locations/us/keyRings/bar/cryptoKeys/baz". **Note:** Not supported for Apigee hybrid. - Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `projects/{{project}}/locations/{{location}}/keyRings/{{key_ring}}/cryptoKeys/{{name}}`). + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). type: string name: description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' @@ -2209,7 +2209,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2400,7 +2400,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2749,7 +2749,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3584,7 +3584,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4031,7 +4031,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4208,7 +4208,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4413,7 +4413,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4629,7 +4629,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4791,7 +4791,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5250,7 +5250,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5518,7 +5518,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5943,7 +5943,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7063,7 +7063,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7495,7 +7495,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7689,7 +7689,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7956,7 +7956,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -8494,7 +8494,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8747,7 +8747,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -9012,7 +9012,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10127,7 +10127,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10744,7 +10744,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10890,7 +10890,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11110,7 +11110,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11302,7 +11302,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11592,7 +11592,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11972,7 +11972,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12630,7 +12630,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13094,7 +13094,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13255,7 +13255,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13416,7 +13416,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13695,7 +13695,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -14474,7 +14474,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -14677,7 +14677,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15609,7 +15609,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16350,7 +16350,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16676,7 +16676,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16886,7 +16886,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17081,7 +17081,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17245,7 +17245,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17454,7 +17454,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17635,7 +17635,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -18035,7 +18035,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18153,7 +18153,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18459,7 +18459,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18673,7 +18673,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18974,7 +18974,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19184,7 +19184,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19530,7 +19530,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19836,7 +19836,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20060,7 +20060,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20339,7 +20339,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20682,7 +20682,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -21029,7 +21029,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21135,7 +21135,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21274,7 +21274,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21653,7 +21653,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21868,7 +21868,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22031,7 +22031,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22319,7 +22319,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22497,7 +22497,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22667,7 +22667,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22944,7 +22944,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23140,7 +23140,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23366,7 +23366,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23594,7 +23594,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23761,7 +23761,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23922,7 +23922,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -26633,7 +26633,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -26832,7 +26832,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -27204,7 +27204,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -27450,7 +27450,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -28040,7 +28040,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -29429,7 +29429,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30008,7 +30008,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30134,7 +30134,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30420,7 +30420,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30699,7 +30699,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30994,7 +30994,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -32205,7 +32205,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34147,7 +34147,4183 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: dlpdeidentifytemplates.dlp.cnrm.cloud.google.com +spec: + group: dlp.cnrm.cloud.google.com + names: + categories: + - gcp + kind: DLPDeidentifyTemplate + plural: dlpdeidentifytemplates + shortNames: + - gcpdlpdeidentifytemplate + - gcpdlpdeidentifytemplates + singular: dlpdeidentifytemplate + preserveUnknownFields: false + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + oneOf: + - required: + - organizationRef + - required: + - projectRef + properties: + deidentifyConfig: + description: The core content of the template. + properties: + infoTypeTransformations: + description: Treat the dataset as free-form text and apply the + same free text transformation everywhere. + properties: + transformations: + description: Required. Transformation for each infoType. Cannot + specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation to. + An empty list will cause this transformation to apply + to all findings that correspond to infoTypes that + were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information type. Either + a name of your choosing when creating a CustomInfoType, + or one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When sending + Cloud DLP results to Data Catalog, infoType + names should conform to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation to apply + to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + recordTransformations: + description: Treat the dataset as structured. Transformations + can be applied to specific locations within structured datasets, + such as transforming a column within a table. + properties: + fieldTransformations: + description: Transform the record by applying various field + transformations. + items: + properties: + condition: + description: 'Only apply the transformation if the condition + evaluates to true for the given `RecordCondition`. + The conditions are allowed to reference fields that + are not used in the actual transformation. Example + Use Cases: - Apply a different bucket transformation + to an age column if the zip code column for the same + record is within a specific range. - Redact a field + if the date of birth field is greater than 85.' + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + fields: + description: Required. Input field(s) to apply the transformation + to. When you have columns that reference their position + within a list, omit the index from the FieldId. FieldId + name matching ignores the index. For example, instead + of "contact.nums[0].type", use "contact.nums.type". + items: + properties: + name: + description: Name describing the field. + type: string + type: object + type: array + infoTypeTransformations: + description: Treat the contents of the field as free + text, and selectively transform content that matches + an `InfoType`. + properties: + transformations: + description: Required. Transformation for each infoType. + Cannot specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation + to. An empty list will cause this transformation + to apply to all findings that correspond + to infoTypes that were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information + type. Either a name of your choosing + when creating a CustomInfoType, or + one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data + Catalog, infoType names should conform + to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation + to apply to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges + must be non-overlapping. + items: + properties: + max: + description: Upper bound of + the range, exclusive; type + must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of + the range, inclusive. Type + should be the same as max + if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement + value for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, + items in this list will be skipped + when replacing characters. For example, + if the input string is `555-555-5555` + and you instruct Cloud DLP to skip + `-` and mask 5 characters with `*`, + Cloud DLP returns `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not + transform when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters + to not transform when masking. + Useful to avoid removing punctuation. + Possible values: COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, + ALPHA_LOWER_CASE, PUNCTUATION, + WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask + the sensitive values—for example, + `*` for an alphabetic string such + as a name, or `0` for a numeric + string such as ZIP code or credit + card number. This string must have + a length of 1. If not supplied, + this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters + to mask. If not set, all matching + chars will be masked. Skipped characters + do not count towards this tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse + order. For example, if `masking_character` + is `0`, `number_to_mask` is `14`, + and `reverse_order` is `false`, + then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. + If `masking_character` is `*`, `number_to_mask` + is `3`, and `reverse_order` is `true`, + then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used + for higher security and maintaining + referential integrity such that + the same identifier in two different + contexts will be given a distinct + surrogate. The context is appended + to plaintext value being encrypted. + On decryption the provided context + is validated against the value used + during encryption. If a context + was provided during encryption, + same context must be provided during + decryption as well. If the context + is not set, plaintext would be used + as is for encryption. If the context + is set but: 1. there is no record + present when transforming a given + value or 2. the field is not present + when transforming a given value, + plaintext would be used as is for + encryption. Note that case (1) is + expected when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s.' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption + using AES-SIV, the provided key + is internally expanded to 64 bytes + prior to use. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom info + type followed by the number of characters + comprising the surrogate. The following + scheme defines the format: {info + type name}({surrogate character + count}):{surrogate} For example, + if the name of custom info type + is ''MY_TOKEN_INFO_TYPE'' and the + surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate + when inspecting content using the + custom info type ''Surrogate''. + This facilitates reversal of the + surrogate when it occurs in free + text. Note: For record transformations + where the entire cell in a table + is being transformed, surrogates + are not mandatory. Surrogates are + used to denote the location of the + token and are necessary for re-identification + in free form text. In order for + inspection to work properly, the + name of this info type must not + occur naturally anywhere in your + data; otherwise, inspection may + either - reverse a surrogate that + does not correspond to an actual + identifier - be unable to parse + the surrogate and result in an error + Therefore, choose your custom info + type name carefully after considering + what your data looks like. One way + to select a name that has a high + chance of yielding reliable detection + is to include one or more unicode + characters that are highly improbable + to exist in your data. For example, + assuming your data is entered from + a regular ASCII keyboard, the symbol + with the hex code point 29DD might + be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash + function. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible + values: FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, + NUMERIC, HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, + ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context + may be used for higher security + since the same identifier in two + different contexts won''t be given + the same surrogate. If the context + is not set, a default tweak will + be used. If the context is set but: + 1. there is no record present when + transforming a given value or 1. + the field is not present when transforming + a given value, a default tweak will + be used. Note that case (1) is expected + when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s. Currently, + the referenced field may be of value + type integer or string. The tweak + is constructed as a sequence of + bytes in big endian byte order such + that: - a 64 bit integer is encoded + followed by a single byte of value + 1 - a string is encoded in UTF-8 + format followed by a single byte + of value 2' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Required. The key used + by the encryption algorithm. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by + mapping these to the alphanumeric + characters that the FFX mode natively + supports. This happens before/after + encryption/decryption. Each character + listed must appear only once. Number + of characters must be in the range + [2, 95]. This must be encoded as + ASCII. The order of characters does + not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select + the alphabet. Must be in the range + [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom infoType + followed by the number of characters + comprising the surrogate. The following + scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom + infoType is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the + full replacement value will be: + ''MY_TOKEN_INFO_TYPE(3):abc'' This + annotation identifies the surrogate + when inspecting content using the + custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the + surrogate when it occurs in free + text. In order for inspection to + work properly, the name of this + infoType must not occur naturally + anywhere in your data; otherwise, + inspection may find a surrogate + that does not correspond to an actual + identifier. Therefore, choose your + custom infoType name carefully after + considering what your data looks + like. One way to select a name that + has a high chance of yielding reliable + detection is to include one or more + unicode characters that are highly + improbable to exist in your data. + For example, assuming your data + is entered from a regular ASCII + keyboard, the symbol with the hex + code point 29DD might be used like + so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that + contains the context, for example, + an entity id. If set, must also + set cryptoKey. If set, shift will + be consistent for the given context. + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Causes the shift to be + computed based on this key and the + context. This results in the same + shift for the same context and crypto_key. + If set, must also set context. Can + only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, + -5 means shift date to at most 5 + days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift + in days. Actual shift will be selected + at random within this range (inclusive + ends). Negative means shift to earlier + in time. Must not be more than 365250 + days (1000 years) each direction. + For example, 3 means shift date + to at most 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each + bucket (except for minimum and maximum + buckets). So if `lower_bound` = + 10, `upper_bound` = 89, and `bucket_size` + = 10, then the following buckets + would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, + 80-89, 89+. Precision up to 2 decimals + works.' + format: double + type: number + lowerBound: + description: Required. Lower bound + value of buckets. All values less + than `lower_bound` are grouped together + into a single bucket; for example + if `lower_bound` = 10, then all + values less than 10 are replaced + with the value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound + value of buckets. All values greater + than upper_bound are grouped together + into a single bucket; for example + if `upper_bound` = 89, then all + values greater than 89 are replaced + with the value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified + value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time + to keep. Possible values: TIME_PART_UNSPECIFIED, + YEAR, MONTH, DAY_OF_MONTH, DAY_OF_WEEK, + WEEK_OF_YEAR, HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + primitiveTransformation: + description: Apply the transformation to the entire + field. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - fields + type: object + type: array + recordSuppressions: + description: Configuration defining which records get suppressed + entirely. Records that match any suppression rule are omitted + from the output. + items: + properties: + condition: + description: A condition that when it evaluates to true + will result in the record being evaluated to be suppressed + from the transformed content. + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + type: object + type: array + type: object + transformationErrorHandling: + description: Mode for handling transformation errors. If left + unspecified, the default mode is `TransformationErrorHandling.ThrowError`. + properties: + leaveUntransformed: + description: Ignore errors + type: object + x-kubernetes-preserve-unknown-fields: true + throwError: + description: Throw an error + type: object + x-kubernetes-preserve-unknown-fields: true + type: object + type: object + description: + description: Short description (max 256 chars). + type: string + displayName: + description: Display name (max 256 chars). + type: string + location: + description: Immutable. The location of the resource + type: string + organizationRef: + description: Immutable. The Organization that this resource belongs + to. Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a Google Cloud Organization (format: `organizations/{{name}}`).' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + projectRef: + description: Immutable. The Project that this resource belongs to. + Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a `Project` resource (format: `projects/{{name}}`).' + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + resourceID: + description: Immutable. Optional. The service-generated name of the + resource. Used for acquisition only. Leave unset to create a new + resource. + type: string + type: object + status: + properties: + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + createTime: + description: Output only. The creation timestamp of an inspectTemplate. + format: date-time + type: string + locationId: + description: Output only. The geographic location where this resource + is stored. + type: string + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + updateTime: + description: Output only. The last update timestamp of an inspectTemplate. + format: date-time + type: string + type: object + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] +--- +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34518,7 +38694,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34854,7 +39030,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35050,7 +39226,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35248,7 +39424,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35699,7 +39875,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35921,7 +40097,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -36250,7 +40426,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36404,7 +40580,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36617,7 +40793,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -36755,7 +40931,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37124,7 +41300,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37364,7 +41540,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37729,7 +41905,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -37890,7 +42066,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38030,7 +42206,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38341,7 +42517,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38569,7 +42745,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38796,7 +42972,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38975,7 +43151,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -39112,7 +43288,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39364,7 +43540,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39545,7 +43721,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39841,7 +44017,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40008,7 +44184,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40134,7 +44310,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40288,7 +44464,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40980,7 +45156,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41163,7 +45339,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41380,7 +45556,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41533,7 +45709,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41725,7 +45901,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41851,7 +46027,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42135,7 +46311,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42410,7 +46586,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42831,7 +47007,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -43235,7 +47411,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -43539,7 +47715,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -43876,7 +48052,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -44691,7 +48867,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51573,7 +55749,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51764,7 +55940,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52059,7 +56235,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52186,7 +56362,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -52479,7 +56655,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53050,7 +57226,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53209,7 +57385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53588,7 +57764,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53770,7 +57946,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54115,7 +58291,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54373,7 +58549,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54602,7 +58778,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54846,7 +59022,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55167,7 +59343,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55428,7 +59604,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55901,7 +60077,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56641,7 +60817,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56823,7 +60999,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57159,7 +61335,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57480,7 +61656,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -58249,7 +62425,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59247,7 +63423,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59743,7 +63919,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -60741,7 +64917,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -61652,7 +65828,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -62068,7 +66244,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62293,7 +66469,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62449,7 +66625,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62870,7 +67046,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63087,7 +67263,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -63323,7 +67499,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63772,7 +67948,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63950,7 +68126,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -64231,7 +68407,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -65113,7 +69289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65375,7 +69551,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65575,7 +69751,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65795,7 +69971,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65952,7 +70128,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66104,7 +70280,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66282,7 +70458,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66423,7 +70599,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66622,7 +70798,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66829,7 +71005,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66969,7 +71145,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67133,7 +71309,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67788,7 +71964,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67964,7 +72140,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68171,7 +72347,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68341,7 +72517,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68686,7 +72862,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68872,7 +73048,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -69075,7 +73251,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -69633,7 +73809,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/install-bundles/install-bundle-namespaced/per-namespace-components.yaml b/install-bundles/install-bundle-namespaced/per-namespace-components.yaml index 03a345529b..e47edd440d 100644 --- a/install-bundles/install-bundle-namespaced/per-namespace-components.yaml +++ b/install-bundles/install-bundle-namespaced/per-namespace-components.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 iam.gke.io/gcp-service-account: cnrm-system-${NAMESPACE?}@${PROJECT_ID?}.iam.gserviceaccount.com labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} @@ -28,7 +28,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -47,7 +47,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -66,7 +66,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -85,7 +85,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} cnrm.cloud.google.com/system: "true" @@ -103,7 +103,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -127,7 +127,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} @@ -144,7 +144,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/scoped-namespace: ${NAMESPACE?} @@ -156,7 +156,7 @@ spec: - --prometheus-scrape-endpoint=:8888 command: - /configconnector/manager - image: gcr.io/cnrm-eap/controller:900e5e8 + image: gcr.io/cnrm-eap/controller:c919d52 imagePullPolicy: Always name: manager ports: @@ -178,5 +178,6 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-controller-manager-${NAMESPACE?} terminationGracePeriodSeconds: 10 diff --git a/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml b/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml index 400ddd9d4b..70b74fdba8 100644 --- a/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml +++ b/install-bundles/install-bundle-workload-identity/0-cnrm-system.yaml @@ -16,7 +16,7 @@ apiVersion: v1 kind: Namespace metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-system @@ -25,7 +25,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 iam.gke.io/gcp-service-account: cnrm-system@${PROJECT_ID?}.iam.gserviceaccount.com labels: cnrm.cloud.google.com/system: "true" @@ -36,7 +36,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -46,7 +46,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-resource-stats-recorder @@ -56,7 +56,7 @@ apiVersion: v1 kind: ServiceAccount metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-manager @@ -66,7 +66,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-cnrm-system-role @@ -87,7 +87,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: Role metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-cnrm-system-role @@ -108,7 +108,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -745,7 +745,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role @@ -795,7 +795,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-cluster-role @@ -853,7 +853,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-ns-role @@ -878,7 +878,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-role @@ -908,7 +908,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/system: "true" @@ -1336,7 +1336,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRole metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role @@ -1399,7 +1399,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-role-binding @@ -1417,7 +1417,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: RoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-role-binding @@ -1435,7 +1435,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-admin-binding @@ -1458,7 +1458,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender-binding @@ -1475,7 +1475,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-binding @@ -1492,7 +1492,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-manager-watcher-binding @@ -1509,7 +1509,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-recorder-binding @@ -1526,7 +1526,7 @@ apiVersion: rbac.authorization.k8s.io/v1 kind: ClusterRoleBinding metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook-binding @@ -1543,7 +1543,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-deletiondefender @@ -1560,7 +1560,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 prometheus.io/port: "8888" prometheus.io/scrape: "true" labels: @@ -1582,7 +1582,7 @@ apiVersion: v1 kind: Service metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 prometheus.io/port: "48797" prometheus.io/scrape: "true" labels: @@ -1603,7 +1603,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -1621,7 +1621,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-resource-stats-recorder cnrm.cloud.google.com/system: "true" @@ -1634,8 +1634,8 @@ spec: - /configconnector/recorder env: - name: CONFIG_CONNECTOR_VERSION - value: 1.94.0 - image: gcr.io/cnrm-eap/recorder:900e5e8 + value: 1.95.0 + image: gcr.io/cnrm-eap/recorder:c919d52 imagePullPolicy: Always name: recorder ports: @@ -1660,6 +1660,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false hostNetwork: true serviceAccountName: cnrm-resource-stats-recorder terminationGracePeriodSeconds: 10 @@ -1668,7 +1669,7 @@ apiVersion: apps/v1 kind: Deployment metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -1683,7 +1684,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-webhook-manager cnrm.cloud.google.com/system: "true" @@ -1696,7 +1697,7 @@ spec: valueFrom: fieldRef: fieldPath: metadata.namespace - image: gcr.io/cnrm-eap/webhook:900e5e8 + image: gcr.io/cnrm-eap/webhook:c919d52 imagePullPolicy: Always name: webhook ports: @@ -1718,6 +1719,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-webhook-manager terminationGracePeriodSeconds: 10 --- @@ -1725,7 +1727,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -1740,7 +1742,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-controller-manager cnrm.cloud.google.com/system: "true" @@ -1750,7 +1752,7 @@ spec: - --prometheus-scrape-endpoint=:8888 command: - /configconnector/manager - image: gcr.io/cnrm-eap/controller:900e5e8 + image: gcr.io/cnrm-eap/controller:c919d52 imagePullPolicy: Always name: manager ports: @@ -1772,6 +1774,7 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-controller-manager terminationGracePeriodSeconds: 10 --- @@ -1779,7 +1782,7 @@ apiVersion: apps/v1 kind: StatefulSet metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -1794,7 +1797,7 @@ spec: template: metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/component: cnrm-deletiondefender cnrm.cloud.google.com/system: "true" @@ -1802,7 +1805,7 @@ spec: containers: - command: - /configconnector/deletiondefender - image: gcr.io/cnrm-eap/deletiondefender:900e5e8 + image: gcr.io/cnrm-eap/deletiondefender:c919d52 imagePullPolicy: Always name: deletiondefender ports: @@ -1824,35 +1827,25 @@ spec: privileged: false runAsNonRoot: true runAsUser: 1000 + enableServiceLinks: false serviceAccountName: cnrm-deletiondefender terminationGracePeriodSeconds: 10 --- -apiVersion: autoscaling/v2beta2 +apiVersion: autoscaling/v1 kind: HorizontalPodAutoscaler metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + autoscaling.alpha.kubernetes.io/metrics: '[{"type":"Resource","resource":{"name":"memory","targetAverageUtilization":90}}]' + cnrm.cloud.google.com/version: 1.95.0 labels: cnrm.cloud.google.com/system: "true" name: cnrm-webhook namespace: cnrm-system spec: maxReplicas: 20 - metrics: - - resource: - name: cpu - target: - averageUtilization: 90 - type: Utilization - type: Resource - - resource: - name: memory - target: - averageUtilization: 90 - type: Utilization - type: Resource minReplicas: 2 scaleTargetRef: apiVersion: apps/v1 kind: Deployment name: cnrm-webhook-manager + targetCPUUtilizationPercentage: 90 diff --git a/install-bundles/install-bundle-workload-identity/crds.yaml b/install-bundles/install-bundle-workload-identity/crds.yaml index 2961e1f46b..a8b8370faf 100644 --- a/install-bundles/install-bundle-workload-identity/crds.yaml +++ b/install-bundles/install-bundle-workload-identity/crds.yaml @@ -16,7 +16,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -402,7 +402,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -532,7 +532,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -1740,7 +1740,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -1915,7 +1915,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -2090,7 +2090,7 @@ spec: description: |- Cloud KMS key name used for encrypting the data that is stored and replicated across runtime instances. Update is not allowed after the organization is created. Required when (#RuntimeType) is `TRIAL`, a Google-Managed encryption key will be used. For example: "projects/foo/locations/us/keyRings/bar/cryptoKeys/baz". **Note:** Not supported for Apigee hybrid. - Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `projects/{{project}}/locations/{{location}}/keyRings/{{key_ring}}/cryptoKeys/{{name}}`). + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). type: string name: description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' @@ -2209,7 +2209,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2400,7 +2400,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -2749,7 +2749,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -3584,7 +3584,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4031,7 +4031,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4208,7 +4208,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4413,7 +4413,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4629,7 +4629,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -4791,7 +4791,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5250,7 +5250,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5518,7 +5518,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -5943,7 +5943,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7063,7 +7063,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7495,7 +7495,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -7689,7 +7689,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -7956,7 +7956,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -8494,7 +8494,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -8747,7 +8747,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -9012,7 +9012,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10127,7 +10127,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10744,7 +10744,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -10890,7 +10890,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11110,7 +11110,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11302,7 +11302,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -11592,7 +11592,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -11972,7 +11972,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -12630,7 +12630,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13094,7 +13094,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13255,7 +13255,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13416,7 +13416,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -13695,7 +13695,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -14474,7 +14474,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -14677,7 +14677,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -15609,7 +15609,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16350,7 +16350,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16676,7 +16676,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -16886,7 +16886,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17081,7 +17081,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17245,7 +17245,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17454,7 +17454,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -17635,7 +17635,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -18035,7 +18035,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18153,7 +18153,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18459,7 +18459,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18673,7 +18673,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -18974,7 +18974,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19184,7 +19184,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19530,7 +19530,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -19836,7 +19836,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20060,7 +20060,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20339,7 +20339,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -20682,7 +20682,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -21029,7 +21029,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21135,7 +21135,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21274,7 +21274,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21653,7 +21653,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -21868,7 +21868,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22031,7 +22031,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22319,7 +22319,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22497,7 +22497,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22667,7 +22667,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -22944,7 +22944,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23140,7 +23140,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23366,7 +23366,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23594,7 +23594,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23761,7 +23761,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -23922,7 +23922,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -26633,7 +26633,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -26832,7 +26832,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -27204,7 +27204,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -27450,7 +27450,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -28040,7 +28040,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -29429,7 +29429,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30008,7 +30008,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30134,7 +30134,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -30420,7 +30420,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30699,7 +30699,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -30994,7 +30994,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -32205,7 +32205,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34147,7 +34147,4183 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 + creationTimestamp: null + labels: + cnrm.cloud.google.com/dcl2crd: "true" + cnrm.cloud.google.com/managed-by-kcc: "true" + cnrm.cloud.google.com/stability-level: stable + cnrm.cloud.google.com/system: "true" + name: dlpdeidentifytemplates.dlp.cnrm.cloud.google.com +spec: + group: dlp.cnrm.cloud.google.com + names: + categories: + - gcp + kind: DLPDeidentifyTemplate + plural: dlpdeidentifytemplates + shortNames: + - gcpdlpdeidentifytemplate + - gcpdlpdeidentifytemplates + singular: dlpdeidentifytemplate + preserveUnknownFields: false + scope: Namespaced + versions: + - additionalPrinterColumns: + - jsonPath: .metadata.creationTimestamp + name: Age + type: date + - description: When 'True', the most recent reconcile of the resource succeeded + jsonPath: .status.conditions[?(@.type=='Ready')].status + name: Ready + type: string + - description: The reason for the value in 'Ready' + jsonPath: .status.conditions[?(@.type=='Ready')].reason + name: Status + type: string + - description: The last transition time for the value in 'Status' + jsonPath: .status.conditions[?(@.type=='Ready')].lastTransitionTime + name: Status Age + type: date + name: v1beta1 + schema: + openAPIV3Schema: + properties: + apiVersion: + description: 'apiVersion defines the versioned schema of this representation + of an object. Servers should convert recognized schemas to the latest + internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#resources' + type: string + kind: + description: 'kind is a string value representing the REST resource this + object represents. Servers may infer this from the endpoint the client + submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds' + type: string + metadata: + type: object + spec: + oneOf: + - required: + - organizationRef + - required: + - projectRef + properties: + deidentifyConfig: + description: The core content of the template. + properties: + infoTypeTransformations: + description: Treat the dataset as free-form text and apply the + same free text transformation everywhere. + properties: + transformations: + description: Required. Transformation for each infoType. Cannot + specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation to. + An empty list will cause this transformation to apply + to all findings that correspond to infoTypes that + were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information type. Either + a name of your choosing when creating a CustomInfoType, + or one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When sending + Cloud DLP results to Data Catalog, infoType + names should conform to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation to apply + to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + recordTransformations: + description: Treat the dataset as structured. Transformations + can be applied to specific locations within structured datasets, + such as transforming a column within a table. + properties: + fieldTransformations: + description: Transform the record by applying various field + transformations. + items: + properties: + condition: + description: 'Only apply the transformation if the condition + evaluates to true for the given `RecordCondition`. + The conditions are allowed to reference fields that + are not used in the actual transformation. Example + Use Cases: - Apply a different bucket transformation + to an age column if the zip code column for the same + record is within a specific range. - Redact a field + if the date of birth field is greater than 85.' + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + fields: + description: Required. Input field(s) to apply the transformation + to. When you have columns that reference their position + within a list, omit the index from the FieldId. FieldId + name matching ignores the index. For example, instead + of "contact.nums[0].type", use "contact.nums.type". + items: + properties: + name: + description: Name describing the field. + type: string + type: object + type: array + infoTypeTransformations: + description: Treat the contents of the field as free + text, and selectively transform content that matches + an `InfoType`. + properties: + transformations: + description: Required. Transformation for each infoType. + Cannot specify more than one for a given infoType. + items: + properties: + infoTypes: + description: InfoTypes to apply the transformation + to. An empty list will cause this transformation + to apply to all findings that correspond + to infoTypes that were requested in `InspectConfig`. + items: + properties: + name: + description: Name of the information + type. Either a name of your choosing + when creating a CustomInfoType, or + one of the names listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data + Catalog, infoType names should conform + to the pattern `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: array + primitiveTransformation: + description: Required. Primitive transformation + to apply to the infoType. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges + must be non-overlapping. + items: + properties: + max: + description: Upper bound of + the range, exclusive; type + must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of + the range, inclusive. Type + should be the same as max + if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement + value for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of + a month. Must be from + 1 to 31 and valid + for the year and month, + or 0 to specify a + year by itself or + a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of + a year. Must be from + 1 to 12, or 0 to specify + a year without a month + and day. + format: int64 + type: integer + year: + description: Year of + the date. Must be + from 1 to 9999, or + 0 to specify a date + without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week + Possible values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of + day in 24 hour format. + Should be from 0 to + 23. An API may choose + to allow the value + "24:00:00" for scenarios + like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes + of hour of day. Must + be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions + of seconds in nanoseconds. + Must be from 0 to + 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds + of minutes of the + time. Must normally + be from 0 to 59. An + API may allow the + value 60 if it allows + leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, + items in this list will be skipped + when replacing characters. For example, + if the input string is `555-555-5555` + and you instruct Cloud DLP to skip + `-` and mask 5 characters with `*`, + Cloud DLP returns `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not + transform when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters + to not transform when masking. + Useful to avoid removing punctuation. + Possible values: COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, + ALPHA_LOWER_CASE, PUNCTUATION, + WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask + the sensitive values—for example, + `*` for an alphabetic string such + as a name, or `0` for a numeric + string such as ZIP code or credit + card number. This string must have + a length of 1. If not supplied, + this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters + to mask. If not set, all matching + chars will be masked. Skipped characters + do not count towards this tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse + order. For example, if `masking_character` + is `0`, `number_to_mask` is `14`, + and `reverse_order` is `false`, + then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. + If `masking_character` is `*`, `number_to_mask` + is `3`, and `reverse_order` is `true`, + then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used + for higher security and maintaining + referential integrity such that + the same identifier in two different + contexts will be given a distinct + surrogate. The context is appended + to plaintext value being encrypted. + On decryption the provided context + is validated against the value used + during encryption. If a context + was provided during encryption, + same context must be provided during + decryption as well. If the context + is not set, plaintext would be used + as is for encryption. If the context + is set but: 1. there is no record + present when transforming a given + value or 2. the field is not present + when transforming a given value, + plaintext would be used as is for + encryption. Note that case (1) is + expected when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s.' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption + using AES-SIV, the provided key + is internally expanded to 64 bytes + prior to use. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom info + type followed by the number of characters + comprising the surrogate. The following + scheme defines the format: {info + type name}({surrogate character + count}):{surrogate} For example, + if the name of custom info type + is ''MY_TOKEN_INFO_TYPE'' and the + surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate + when inspecting content using the + custom info type ''Surrogate''. + This facilitates reversal of the + surrogate when it occurs in free + text. Note: For record transformations + where the entire cell in a table + is being transformed, surrogates + are not mandatory. Surrogates are + used to denote the location of the + token and are necessary for re-identification + in free form text. In order for + inspection to work properly, the + name of this info type must not + occur naturally anywhere in your + data; otherwise, inspection may + either - reverse a surrogate that + does not correspond to an actual + identifier - be unable to parse + the surrogate and result in an error + Therefore, choose your custom info + type name carefully after considering + what your data looks like. One way + to select a name that has a high + chance of yielding reliable detection + is to include one or more unicode + characters that are highly improbable + to exist in your data. For example, + assuming your data is entered from + a regular ASCII keyboard, the symbol + with the hex code point 29DD might + be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash + function. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible + values: FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, + NUMERIC, HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, + ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context + may be used for higher security + since the same identifier in two + different contexts won''t be given + the same surrogate. If the context + is not set, a default tweak will + be used. If the context is set but: + 1. there is no record present when + transforming a given value or 1. + the field is not present when transforming + a given value, a default tweak will + be used. Note that case (1) is expected + when an `InfoTypeTransformation` + is applied to both structured and + non-structured `ContentItem`s. Currently, + the referenced field may be of value + type integer or string. The tweak + is constructed as a sequence of + bytes in big endian byte order such + that: - a 64 bit integer is encoded + followed by a single byte of value + 1 - a string is encoded in UTF-8 + format followed by a single byte + of value 2' + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Required. The key used + by the encryption algorithm. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by + mapping these to the alphanumeric + characters that the FFX mode natively + supports. This happens before/after + encryption/decryption. Each character + listed must appear only once. Number + of characters must be in the range + [2, 95]. This must be encoded as + ASCII. The order of characters does + not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select + the alphabet. Must be in the range + [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType + to annotate the surrogate with. + This annotation will be applied + to the surrogate by prefixing it + with the name of the custom infoType + followed by the number of characters + comprising the surrogate. The following + scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom + infoType is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the + full replacement value will be: + ''MY_TOKEN_INFO_TYPE(3):abc'' This + annotation identifies the surrogate + when inspecting content using the + custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the + surrogate when it occurs in free + text. In order for inspection to + work properly, the name of this + infoType must not occur naturally + anywhere in your data; otherwise, + inspection may find a surrogate + that does not correspond to an actual + identifier. Therefore, choose your + custom infoType name carefully after + considering what your data looks + like. One way to select a name that + has a high chance of yielding reliable + detection is to include one or more + unicode characters that are highly + improbable to exist in your data. + For example, assuming your data + is entered from a regular ASCII + keyboard, the symbol with the hex + code point 29DD might be used like + so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information + type. Either a name of your + choosing when creating a CustomInfoType, + or one of the names listed at + https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. + When sending Cloud DLP results + to Data Catalog, infoType names + should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that + contains the context, for example, + an entity id. If set, must also + set cryptoKey. If set, shift will + be consistent for the given context. + properties: + name: + description: Name describing the + field. + type: string + type: object + cryptoKey: + description: Causes the shift to be + computed based on this key and the + context. This results in the same + shift for the same context and crypto_key. + If set, must also set context. Can + only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using + Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of + the referent. More info: + https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace + of the referent. More + info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The + wrapped data crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto + key + properties: + name: + description: 'Required. Name + of the key. This is an arbitrary + string used to differentiate + different keys. A unique + key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated + key if their names are the + same. When the data crypto + key is generated, this name + is not used in any way (repeating + the api call will result + in a different key being + generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto + key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, + -5 means shift date to at most 5 + days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift + in days. Actual shift will be selected + at random within this range (inclusive + ends). Negative means shift to earlier + in time. Must not be more than 365250 + days (1000 years) each direction. + For example, 3 means shift date + to at most 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each + bucket (except for minimum and maximum + buckets). So if `lower_bound` = + 10, `upper_bound` = 89, and `bucket_size` + = 10, then the following buckets + would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, + 80-89, 89+. Precision up to 2 decimals + works.' + format: double + type: number + lowerBound: + description: Required. Lower bound + value of buckets. All values less + than `lower_bound` are grouped together + into a single bucket; for example + if `lower_bound` = 10, then all + values less than 10 are replaced + with the value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound + value of buckets. All values greater + than upper_bound are grouped together + into a single bucket; for example + if `upper_bound` = 89, then all + values greater than 89 are replaced + with the value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified + value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time + to keep. Possible values: TIME_PART_UNSPECIFIED, + YEAR, MONTH, DAY_OF_MONTH, DAY_OF_WEEK, + WEEK_OF_YEAR, HOUR_OF_DAY' + type: string + type: object + type: object + required: + - primitiveTransformation + type: object + type: array + required: + - transformations + type: object + primitiveTransformation: + description: Apply the transformation to the entire + field. + properties: + bucketingConfig: + description: Bucketing + properties: + buckets: + description: Set of buckets. Ranges must be + non-overlapping. + items: + properties: + max: + description: Upper bound of the range, + exclusive; type must match min. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + min: + description: Lower bound of the range, + inclusive. Type should be the same as + max if used. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + replacementValue: + description: Required. Replacement value + for this bucket. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must + be from 1 to 31 and valid for + the year and month, or 0 to + specify a year by itself or + a year and month where the day + isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or 0 to + specify a year without a month + and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, or 0 + to specify a date without a + year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, THURSDAY, + FRIDAY, SATURDAY, SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 + hour format. Should be from + 0 to 23. An API may choose to + allow the value "24:00:00" for + scenarios like business closing + time. + format: int64 + type: integer + minutes: + description: Minutes of hour of + day. Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds + in nanoseconds. Must be from + 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally be + from 0 to 59. An API may allow + the value 60 if it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - replacementValue + type: object + type: array + type: object + characterMaskConfig: + description: Mask + properties: + charactersToIgnore: + description: When masking a string, items in + this list will be skipped when replacing characters. + For example, if the input string is `555-555-5555` + and you instruct Cloud DLP to skip `-` and + mask 5 characters with `*`, Cloud DLP returns + `***-**5-5555`. + items: + properties: + charactersToSkip: + description: Characters to not transform + when masking. + type: string + commonCharactersToIgnore: + description: 'Common characters to not + transform when masking. Useful to avoid + removing punctuation. Possible values: + COMMON_CHARS_TO_IGNORE_UNSPECIFIED, + NUMERIC, ALPHA_UPPER_CASE, ALPHA_LOWER_CASE, + PUNCTUATION, WHITESPACE' + type: string + type: object + type: array + maskingCharacter: + description: Character to use to mask the sensitive + values—for example, `*` for an alphabetic + string such as a name, or `0` for a numeric + string such as ZIP code or credit card number. + This string must have a length of 1. If not + supplied, this value defaults to `*` for strings, + and `0` for digits. + type: string + numberToMask: + description: Number of characters to mask. If + not set, all matching chars will be masked. + Skipped characters do not count towards this + tally. + format: int64 + type: integer + reverseOrder: + description: Mask characters in reverse order. + For example, if `masking_character` is `0`, + `number_to_mask` is `14`, and `reverse_order` + is `false`, then the input string `1234-5678-9012-3456` + is masked as `00000000000000-3456`. If `masking_character` + is `*`, `number_to_mask` is `3`, and `reverse_order` + is `true`, then the string `12345` is masked + as `12***`. + type: boolean + type: object + cryptoDeterministicConfig: + description: Deterministic Crypto + properties: + context: + description: 'A context may be used for higher + security and maintaining referential integrity + such that the same identifier in two different + contexts will be given a distinct surrogate. + The context is appended to plaintext value + being encrypted. On decryption the provided + context is validated against the value used + during encryption. If a context was provided + during encryption, same context must be provided + during decryption as well. If the context + is not set, plaintext would be used as is + for encryption. If the context is set but: + 1. there is no record present when transforming + a given value or 2. the field is not present + when transforming a given value, plaintext + would be used as is for encryption. Note that + case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s.' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: The key used by the encryption + function. For deterministic encryption using + AES-SIV, the provided key is internally expanded + to 64 bytes prior to use. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + surrogateInfoType: + description: 'The custom info type to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom info type followed + by the number of characters comprising the + surrogate. The following scheme defines the + format: {info type name}({surrogate character + count}):{surrogate} For example, if the name + of custom info type is ''MY_TOKEN_INFO_TYPE'' + and the surrogate is ''abc'', the full replacement + value will be: ''MY_TOKEN_INFO_TYPE(3):abc'' + This annotation identifies the surrogate when + inspecting content using the custom info type + ''Surrogate''. This facilitates reversal of + the surrogate when it occurs in free text. + Note: For record transformations where the + entire cell in a table is being transformed, + surrogates are not mandatory. Surrogates are + used to denote the location of the token and + are necessary for re-identification in free + form text. In order for inspection to work + properly, the name of this info type must + not occur naturally anywhere in your data; + otherwise, inspection may either - reverse + a surrogate that does not correspond to an + actual identifier - be unable to parse the + surrogate and result in an error Therefore, + choose your custom info type name carefully + after considering what your data looks like. + One way to select a name that has a high chance + of yielding reliable detection is to include + one or more unicode characters that are highly + improbable to exist in your data. For example, + assuming your data is entered from a regular + ASCII keyboard, the symbol with the hex code + point 29DD might be used like so: ⧝MY_TOKEN_TYPE.' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + type: object + cryptoHashConfig: + description: Crypto + properties: + cryptoKey: + description: The key used by the hash function. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + type: object + cryptoReplaceFfxFpeConfig: + description: Ffx-Fpe + properties: + commonAlphabet: + description: 'Common alphabets. Possible values: + FFX_COMMON_NATIVE_ALPHABET_UNSPECIFIED, NUMERIC, + HEXADECIMAL, UPPER_CASE_ALPHA_NUMERIC, ALPHA_NUMERIC' + type: string + context: + description: 'The ''tweak'', a context may be + used for higher security since the same identifier + in two different contexts won''t be given + the same surrogate. If the context is not + set, a default tweak will be used. If the + context is set but: 1. there is no record + present when transforming a given value or + 1. the field is not present when transforming + a given value, a default tweak will be used. + Note that case (1) is expected when an `InfoTypeTransformation` + is applied to both structured and non-structured + `ContentItem`s. Currently, the referenced + field may be of value type integer or string. + The tweak is constructed as a sequence of + bytes in big endian byte order such that: + - a 64 bit integer is encoded followed by + a single byte of value 1 - a string is encoded + in UTF-8 format followed by a single byte + of value 2' + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Required. The key used by the encryption + algorithm. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + customAlphabet: + description: 'This is supported by mapping these + to the alphanumeric characters that the FFX + mode natively supports. This happens before/after + encryption/decryption. Each character listed + must appear only once. Number of characters + must be in the range [2, 95]. This must be + encoded as ASCII. The order of characters + does not matter. The full list of allowed + characters is: ``0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz + ~`!@#$%^&*()_-+={[}]|:;"''<,>.?/``' + type: string + radix: + description: The native way to select the alphabet. + Must be in the range [2, 95]. + format: int64 + type: integer + surrogateInfoType: + description: 'The custom infoType to annotate + the surrogate with. This annotation will be + applied to the surrogate by prefixing it with + the name of the custom infoType followed by + the number of characters comprising the surrogate. + The following scheme defines the format: info_type_name(surrogate_character_count):surrogate + For example, if the name of custom infoType + is ''MY_TOKEN_INFO_TYPE'' and the surrogate + is ''abc'', the full replacement value will + be: ''MY_TOKEN_INFO_TYPE(3):abc'' This annotation + identifies the surrogate when inspecting content + using the custom infoType [`SurrogateType`](https://cloud.google.com/dlp/docs/reference/rest/v2/InspectConfig#surrogatetype). + This facilitates reversal of the surrogate + when it occurs in free text. In order for + inspection to work properly, the name of this + infoType must not occur naturally anywhere + in your data; otherwise, inspection may find + a surrogate that does not correspond to an + actual identifier. Therefore, choose your + custom infoType name carefully after considering + what your data looks like. One way to select + a name that has a high chance of yielding + reliable detection is to include one or more + unicode characters that are highly improbable + to exist in your data. For example, assuming + your data is entered from a regular ASCII + keyboard, the symbol with the hex code point + 29DD might be used like so: ⧝MY_TOKEN_TYPE' + properties: + name: + description: Name of the information type. + Either a name of your choosing when creating + a CustomInfoType, or one of the names + listed at https://cloud.google.com/dlp/docs/infotypes-reference + when specifying a built-in type. When + sending Cloud DLP results to Data Catalog, + infoType names should conform to the pattern + `[A-Za-z0-9$-_]{1,64}`. + type: string + type: object + required: + - cryptoKey + type: object + dateShiftConfig: + description: Date Shift + properties: + context: + description: Points to the field that contains + the context, for example, an entity id. If + set, must also set cryptoKey. If set, shift + will be consistent for the given context. + properties: + name: + description: Name describing the field. + type: string + type: object + cryptoKey: + description: Causes the shift to be computed + based on this key and the context. This results + in the same shift for the same context and + crypto_key. If set, must also set context. + Can only be applied to table items. + properties: + kmsWrapped: + description: Key wrapped using Cloud KMS + properties: + cryptoKeyRef: + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: |- + Required. The resource name of the KMS CryptoKey to use for unwrapping. + + Allowed value: The Google Cloud resource name of a `KMSCryptoKey` resource (format: `{{selfLink}}`). + type: string + name: + description: 'Name of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. + More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + wrappedKey: + description: Required. The wrapped data + crypto key. + type: string + required: + - cryptoKeyRef + - wrappedKey + type: object + transient: + description: Transient crypto key + properties: + name: + description: 'Required. Name of the + key. This is an arbitrary string used + to differentiate different keys. A + unique key is generated per name: + two separate `TransientCryptoKey` + protos share the same generated key + if their names are the same. When + the data crypto key is generated, + this name is not used in any way (repeating + the api call will result in a different + key being generated).' + type: string + required: + - name + type: object + unwrapped: + description: Unwrapped crypto key + properties: + key: + description: Required. A 128/192/256 + bit key. + type: string + required: + - key + type: object + type: object + lowerBoundDays: + description: Required. For example, -5 means + shift date to at most 5 days back in the past. + format: int64 + type: integer + upperBoundDays: + description: Required. Range of shift in days. + Actual shift will be selected at random within + this range (inclusive ends). Negative means + shift to earlier in time. Must not be more + than 365250 days (1000 years) each direction. + For example, 3 means shift date to at most + 3 days into the future. + format: int64 + type: integer + required: + - lowerBoundDays + - upperBoundDays + type: object + fixedSizeBucketingConfig: + description: Fixed size bucketing + properties: + bucketSize: + description: 'Required. Size of each bucket + (except for minimum and maximum buckets). + So if `lower_bound` = 10, `upper_bound` = + 89, and `bucket_size` = 10, then the following + buckets would be used: -10, 10-20, 20-30, + 30-40, 40-50, 50-60, 60-70, 70-80, 80-89, + 89+. Precision up to 2 decimals works.' + format: double + type: number + lowerBound: + description: Required. Lower bound value of + buckets. All values less than `lower_bound` + are grouped together into a single bucket; + for example if `lower_bound` = 10, then all + values less than 10 are replaced with the + value "-10". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + upperBound: + description: Required. Upper bound value of + buckets. All values greater than upper_bound + are grouped together into a single bucket; + for example if `upper_bound` = 89, then all + values greater than 89 are replaced with the + value "89+". + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - bucketSize + - lowerBound + - upperBound + type: object + redactConfig: + description: Redact + type: object + x-kubernetes-preserve-unknown-fields: true + replaceConfig: + description: Replace with a specified value. + properties: + newValue: + description: Value to replace it with. + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. Must be + from 1 to 31 and valid for the year + and month, or 0 to specify a year + by itself or a year and month where + the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. Must be + from 1 to 12, or 0 to specify a year + without a month and day. + format: int64 + type: integer + year: + description: Year of the date. Must + be from 1 to 9999, or 0 to specify + a date without a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible values: + DAY_OF_WEEK_UNSPECIFIED, MONDAY, TUESDAY, + WEDNESDAY, THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day in 24 hour + format. Should be from 0 to 23. An + API may choose to allow the value + "24:00:00" for scenarios like business + closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour of day. + Must be from 0 to 59. + format: int64 + type: integer + nanos: + description: Fractions of seconds in + nanoseconds. Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes of the + time. Must normally be from 0 to 59. + An API may allow the value 60 if it + allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + type: object + replaceWithInfoTypeConfig: + description: Replace with infotype + type: object + x-kubernetes-preserve-unknown-fields: true + timePartConfig: + description: Time extraction + properties: + partToExtract: + description: 'The part of the time to keep. + Possible values: TIME_PART_UNSPECIFIED, YEAR, + MONTH, DAY_OF_MONTH, DAY_OF_WEEK, WEEK_OF_YEAR, + HOUR_OF_DAY' + type: string + type: object + type: object + required: + - fields + type: object + type: array + recordSuppressions: + description: Configuration defining which records get suppressed + entirely. Records that match any suppression rule are omitted + from the output. + items: + properties: + condition: + description: A condition that when it evaluates to true + will result in the record being evaluated to be suppressed + from the transformed content. + properties: + expressions: + description: An expression. + properties: + conditions: + description: Conditions to apply to the expression. + properties: + conditions: + description: A collection of conditions. + items: + properties: + field: + description: Required. Field within + the record this condition is evaluated + against. + properties: + name: + description: Name describing the + field. + type: string + type: object + operator: + description: 'Required. Operator used + to compare the field or infoType + to the value. Possible values: LOGICAL_OPERATOR_UNSPECIFIED, + AND' + type: string + value: + description: Value to compare against. + [Mandatory, except for `EXISTS` + tests.] + properties: + booleanValue: + description: boolean + type: boolean + dateValue: + description: date + properties: + day: + description: Day of a month. + Must be from 1 to 31 and + valid for the year and month, + or 0 to specify a year by + itself or a year and month + where the day isn't significant. + format: int64 + type: integer + month: + description: Month of a year. + Must be from 1 to 12, or + 0 to specify a year without + a month and day. + format: int64 + type: integer + year: + description: Year of the date. + Must be from 1 to 9999, + or 0 to specify a date without + a year. + format: int64 + type: integer + type: object + dayOfWeekValue: + description: 'day of week Possible + values: DAY_OF_WEEK_UNSPECIFIED, + MONDAY, TUESDAY, WEDNESDAY, + THURSDAY, FRIDAY, SATURDAY, + SUNDAY' + type: string + floatValue: + description: float + format: double + type: number + integerValue: + description: integer + format: int64 + type: integer + stringValue: + description: string + type: string + timeValue: + description: time of day + properties: + hours: + description: Hours of day + in 24 hour format. Should + be from 0 to 23. An API + may choose to allow the + value "24:00:00" for scenarios + like business closing time. + format: int64 + type: integer + minutes: + description: Minutes of hour + of day. Must be from 0 to + 59. + format: int64 + type: integer + nanos: + description: Fractions of + seconds in nanoseconds. + Must be from 0 to 999,999,999. + format: int64 + type: integer + seconds: + description: Seconds of minutes + of the time. Must normally + be from 0 to 59. An API + may allow the value 60 if + it allows leap-seconds. + format: int64 + type: integer + type: object + timestampValue: + description: timestamp + format: date-time + type: string + type: object + required: + - field + - operator + type: object + type: array + type: object + logicalOperator: + description: 'The operator to apply to the result + of conditions. Default and currently only + supported value is `AND`. Possible values: + LOGICAL_OPERATOR_UNSPECIFIED, AND' + type: string + type: object + type: object + type: object + type: array + type: object + transformationErrorHandling: + description: Mode for handling transformation errors. If left + unspecified, the default mode is `TransformationErrorHandling.ThrowError`. + properties: + leaveUntransformed: + description: Ignore errors + type: object + x-kubernetes-preserve-unknown-fields: true + throwError: + description: Throw an error + type: object + x-kubernetes-preserve-unknown-fields: true + type: object + type: object + description: + description: Short description (max 256 chars). + type: string + displayName: + description: Display name (max 256 chars). + type: string + location: + description: Immutable. The location of the resource + type: string + organizationRef: + description: Immutable. The Organization that this resource belongs + to. Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a Google Cloud Organization (format: `organizations/{{name}}`).' + type: string + name: + description: |- + [WARNING] Organization not yet supported in Config Connector, use 'external' field to reference existing resources. + Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + projectRef: + description: Immutable. The Project that this resource belongs to. + Only one of [organizationRef, projectRef] may be specified. + oneOf: + - not: + required: + - external + required: + - name + - not: + anyOf: + - required: + - name + - required: + - namespace + required: + - external + properties: + external: + description: 'Allowed value: The Google Cloud resource name of + a `Project` resource (format: `projects/{{name}}`).' + type: string + name: + description: 'Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names' + type: string + namespace: + description: 'Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/' + type: string + type: object + resourceID: + description: Immutable. Optional. The service-generated name of the + resource. Used for acquisition only. Leave unset to create a new + resource. + type: string + type: object + status: + properties: + conditions: + description: Conditions represent the latest available observation + of the resource's current state. + items: + properties: + lastTransitionTime: + description: Last time the condition transitioned from one status + to another. + type: string + message: + description: Human-readable message indicating details about + last transition. + type: string + reason: + description: Unique, one-word, CamelCase reason for the condition's + last transition. + type: string + status: + description: Status is the status of the condition. Can be True, + False, Unknown. + type: string + type: + description: Type is the type of the condition. + type: string + type: object + type: array + createTime: + description: Output only. The creation timestamp of an inspectTemplate. + format: date-time + type: string + locationId: + description: Output only. The geographic location where this resource + is stored. + type: string + observedGeneration: + description: ObservedGeneration is the generation of the resource + that was most recently observed by the Config Connector controller. + If this is equal to metadata.generation, then that means that the + current reported status reflects the most recent desired state of + the resource. + type: integer + updateTime: + description: Output only. The last update timestamp of an inspectTemplate. + format: date-time + type: string + type: object + type: object + served: true + storage: true + subresources: + status: {} +status: + acceptedNames: + kind: "" + plural: "" + conditions: [] + storedVersions: [] +--- +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + annotations: + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -34518,7 +38694,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -34854,7 +39030,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35050,7 +39226,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -35248,7 +39424,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35699,7 +39875,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -35921,7 +40097,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -36250,7 +40426,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36404,7 +40580,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -36617,7 +40793,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -36755,7 +40931,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37124,7 +41300,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37364,7 +41540,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -37729,7 +41905,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -37890,7 +42066,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38030,7 +42206,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38341,7 +42517,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38569,7 +42745,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38796,7 +42972,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -38975,7 +43151,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -39112,7 +43288,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39364,7 +43540,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39545,7 +43721,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -39841,7 +44017,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40008,7 +44184,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40134,7 +44310,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40288,7 +44464,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -40980,7 +45156,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41163,7 +45339,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41380,7 +45556,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -41533,7 +45709,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41725,7 +45901,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -41851,7 +46027,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42135,7 +46311,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42410,7 +46586,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -42831,7 +47007,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -43235,7 +47411,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -43539,7 +47715,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -43876,7 +48052,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -44691,7 +48867,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51573,7 +55749,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -51764,7 +55940,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52059,7 +56235,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -52186,7 +56362,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -52479,7 +56655,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53050,7 +57226,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53209,7 +57385,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53588,7 +57764,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -53770,7 +57946,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54115,7 +58291,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54373,7 +58549,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54602,7 +58778,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -54846,7 +59022,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55167,7 +59343,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55428,7 +59604,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -55901,7 +60077,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56641,7 +60817,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -56823,7 +60999,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57159,7 +61335,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -57480,7 +61656,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -58249,7 +62425,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59247,7 +63423,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -59743,7 +63919,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -60741,7 +64917,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -61652,7 +65828,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -62068,7 +66244,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62293,7 +66469,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62449,7 +66625,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -62870,7 +67046,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63087,7 +67263,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -63323,7 +67499,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63772,7 +67948,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -63950,7 +68126,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -64231,7 +68407,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" @@ -65113,7 +69289,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65375,7 +69551,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65575,7 +69751,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65795,7 +69971,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -65952,7 +70128,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66104,7 +70280,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66282,7 +70458,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66423,7 +70599,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66622,7 +70798,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66829,7 +71005,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -66969,7 +71145,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67133,7 +71309,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67788,7 +71964,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -67964,7 +72140,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68171,7 +72347,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68341,7 +72517,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68686,7 +72862,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -68872,7 +73048,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -69075,7 +73251,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/managed-by-kcc: "true" @@ -69633,7 +73809,7 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: annotations: - cnrm.cloud.google.com/version: 1.94.0 + cnrm.cloud.google.com/version: 1.95.0 creationTimestamp: null labels: cnrm.cloud.google.com/dcl2crd: "true" diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computebackendservice.yaml new file mode 100644 index 0000000000..d83187b16d --- /dev/null +++ b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computebackendservice.yaml @@ -0,0 +1,26 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeBackendService +metadata: + name: computeregionnetworkendpointgroup-dep-psc + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + location: us-west3 + networkRef: + name: computeregionnetworkendpointgroup-dep-psc + loadBalancingScheme: INTERNAL diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeforwardingrule.yaml new file mode 100644 index 0000000000..ba83046504 --- /dev/null +++ b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeforwardingrule.yaml @@ -0,0 +1,32 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeForwardingRule +metadata: + name: computeregionnetworkendpointgroup-dep-psc + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + location: us-west3 + networkRef: + name: computeregionnetworkendpointgroup-dep-psc + subnetworkRef: + name: computeregionnetworkendpointgroup-dep2-psc + loadBalancingScheme: INTERNAL + backendServiceRef: + name: computeregionnetworkendpointgroup-dep-psc + networkTier: PREMIUM + allPorts: true diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computenetwork.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computenetwork.yaml new file mode 100644 index 0000000000..fb03bee321 --- /dev/null +++ b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computenetwork.yaml @@ -0,0 +1,24 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeNetwork +metadata: + name: computeregionnetworkendpointgroup-dep-psc + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + routingMode: REGIONAL + autoCreateSubnetworks: false diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml new file mode 100644 index 0000000000..0603b86937 --- /dev/null +++ b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml @@ -0,0 +1,29 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeRegionNetworkEndpointGroup +metadata: + name: computeregionnetworkendpointgroup-sample-psc + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + region: us-west3 + networkEndpointType: PRIVATE_SERVICE_CONNECT + pscTargetService: https://www.googleapis.com/compute/v1/projects/${PROJECT_ID?}/regions/us-west3/serviceAttachments/computeregionnetworkendpointgroup-dep-psc + networkRef: + name: computeregionnetworkendpointgroup-dep-psc + subnetworkRef: + name: computeregionnetworkendpointgroup-dep2-psc diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeserviceattachment.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeserviceattachment.yaml new file mode 100644 index 0000000000..7ef8d5e4e9 --- /dev/null +++ b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeserviceattachment.yaml @@ -0,0 +1,30 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeServiceAttachment +metadata: + name: computeregionnetworkendpointgroup-dep-psc +spec: + projectRef: + # Replace ${PROJECT_ID?} with your project ID + external: "projects/${PROJECT_ID?}" + location: us-west3 + description: A sample service attachment + targetServiceRef: + name: computeregionnetworkendpointgroup-dep-psc + connectionPreference: ACCEPT_AUTOMATIC + natSubnets: + - name: computeregionnetworkendpointgroup-dep1-psc + enableProxyProtocol: false diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computesubnetwork.yaml new file mode 100644 index 0000000000..ab6f735c1e --- /dev/null +++ b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computesubnetwork.yaml @@ -0,0 +1,40 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeSubnetwork +metadata: + name: computeregionnetworkendpointgroup-dep1-psc + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + region: us-west3 + ipCidrRange: 10.2.0.0/16 + networkRef: + name: computeregionnetworkendpointgroup-dep-psc + purpose: PRIVATE_SERVICE_CONNECT +--- +apiVersion: compute.cnrm.cloud.google.com/v1beta1 +kind: ComputeSubnetwork +metadata: + name: computeregionnetworkendpointgroup-dep2-psc + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + ipCidrRange: 10.180.0.0/20 + region: us-west3 + networkRef: + name: computeregionnetworkendpointgroup-dep-psc diff --git a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml new file mode 100644 index 0000000000..69989e32e4 --- /dev/null +++ b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml @@ -0,0 +1,179 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: dlp.cnrm.cloud.google.com/v1beta1 +kind: DLPDeidentifyTemplate +metadata: + name: dlpdeidentifytemplate-sample-infotypedeidentifytemplate +spec: + projectRef: + # Replace "${PROJECT_ID?}" with your project ID + external: "projects/${PROJECT_ID?}" + displayName: "sample-template" + description: "A sample deidentify template" + deidentifyConfig: + infoTypeTransformations: + transformations: + - infoTypes: + - name: "PHONE_NUMBER" + - name: "AGE" + primitiveTransformation: + replaceConfig: + newValue: + integerValue: 9 + - infoTypes: + - name: "SALARY" + primitiveTransformation: + replaceConfig: + newValue: + floatValue: 192168.01 + - infoTypes: + - name: "HOME_PAGE" + primitiveTransformation: + replaceConfig: + newValue: + stringValue: "https://www.example.com/" + - infoTypes: + - name: "RETIRED" + primitiveTransformation: + replaceConfig: + newValue: + booleanValue: true + - infoTypes: + - name: "LAST_LOGIN" + primitiveTransformation: + replaceConfig: + newValue: + timestampValue: "2014-10-02T15:01:23Z" + - infoTypes: + - name: "START_TIME" + primitiveTransformation: + replaceConfig: + newValue: + timeValue: + hours: 9 + minutes: 30 + seconds: 0 + nanos: 0 + - infoTypes: + - name: "DATE_OF_BIRTH" + primitiveTransformation: + replaceConfig: + newValue: + dateValue: + year: 2020 + month: 1 + day: 1 + - infoTypes: + - name: "PAYDAY" + primitiveTransformation: + replaceConfig: + newValue: + dayOfWeekValue: "FRIDAY" + - infoTypes: + - name: "HEIGHT" + primitiveTransformation: + redactConfig: {} + - infoTypes: + - name: "EMAIL_ADDRESS" + - name: "LAST_NAME" + primitiveTransformation: + characterMaskConfig: + maskingCharacter: "X" + numberToMask: 4 + reverseOrder: true + charactersToIgnore: + - charactersToSkip: "#" + - commonCharactersToIgnore: "PUNCTUATION" + - infoTypes: + - name: "HOME_ADDRESS" + primitiveTransformation: + cryptoReplaceFfxFpeConfig: + context: + name: "sometweak" + cryptoKey: + transient: + name: "beep" + surrogateInfoType: + name: "abc" + commonAlphabet: "NUMERIC" + - infoTypes: + - name: "BANK_ACCOUNT_NUMBER" + primitiveTransformation: + cryptoReplaceFfxFpeConfig: + cryptoKey: + unwrapped: + key: "vJZQm1FyV4BdF99nlcUYNA==" + customAlphabet: "~`!@#$%^&*()_-+={[}]|:;\"'<,>.?/" + - infoTypes: + - name: "BILLING_ADDRESS" + primitiveTransformation: + cryptoReplaceFfxFpeConfig: + cryptoKey: + kmsWrapped: + wrappedKey: "vJZQm1FyV4BdF99nlcUYNA==" + cryptoKeyRef: + name: "dlpdeidentifytemplate-dep-infotypedeidentifytemplate" + radix: 4 + - infoTypes: + - name: "FIRST_NAME" + primitiveTransformation: + fixedSizeBucketingConfig: + lowerBound: + integerValue: 7 + upperBound: + integerValue: 9 + bucketSize: 2.5 + - infoTypes: + - name: "MIDDLE_NAME" + primitiveTransformation: + bucketingConfig: + buckets: + - min: + integerValue: 7 + max: + integerValue: 9 + replacementValue: + integerValue: 6 + - infoTypes: + - name: "EYE_COLOR" + primitiveTransformation: + replaceWithInfoTypeConfig: {} + - infoTypes: + - name: "START_DATE" + primitiveTransformation: + timePartConfig: + partToExtract: "YEAR" + - infoTypes: + - name: "CREDIT_CARD_NUMBER" + primitiveTransformation: + cryptoDeterministicConfig: + context: + name: "sometweak" + cryptoKey: + transient: + name: "beep" + surrogateInfoType: + name: "abc" + - infoTypes: + - name: "LAST_VACATION" + primitiveTransformation: + dateShiftConfig: + upperBoundDays: 3 + lowerBoundDays: 2 + context: + name: "def" + cryptoKey: + transient: + name: "beep" diff --git a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmscryptokey.yaml b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmscryptokey.yaml new file mode 100644 index 0000000000..2f3e54e674 --- /dev/null +++ b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmscryptokey.yaml @@ -0,0 +1,23 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: kms.cnrm.cloud.google.com/v1beta1 +kind: KMSCryptoKey +metadata: + name: dlpdeidentifytemplate-dep-infotypedeidentifytemplate +spec: + location: "global" + keyRingRef: + name: "dlpdeidentifytemplate-dep-infotypedeidentifytemplate" + purpose: "ENCRYPT_DECRYPT" diff --git a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmskeyring.yaml b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmskeyring.yaml new file mode 100644 index 0000000000..2de034a6a7 --- /dev/null +++ b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmskeyring.yaml @@ -0,0 +1,20 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: kms.cnrm.cloud.google.com/v1beta1 +kind: KMSKeyRing +metadata: + name: dlpdeidentifytemplate-dep-infotypedeidentifytemplate +spec: + location: "global" diff --git a/samples/resources/dlpdeidentifytemplate/record-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml b/samples/resources/dlpdeidentifytemplate/record-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml new file mode 100644 index 0000000000..c754034c24 --- /dev/null +++ b/samples/resources/dlpdeidentifytemplate/record-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml @@ -0,0 +1,42 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: dlp.cnrm.cloud.google.com/v1beta1 +kind: DLPDeidentifyTemplate +metadata: + name: dlpdeidentifytemplate-sample-recorddeidentifytemplate +spec: + organizationRef: + # Replace "${ORG_ID?}" with the numeric ID for your organization + external: "organizations/${ORG_ID?}" + location: "us-west2" + displayName: "sample-template" + description: "A sample deidentify template" + deidentifyConfig: + recordTransformations: + fieldTransformations: + - fields: + - name: "SPECIES" + condition: + expressions: + logicalOperator: "AND" + conditions: + conditions: + - field: + name: "BREED" + operator: "NOT_EQUAL_TO" + value: + stringValue: "PUG" + primitiveTransformation: + redactConfig: {} diff --git a/samples/resources/gkehubfeaturemembership/gkehub_v1beta1_gkehubfeaturemembership.yaml b/samples/resources/gkehubfeaturemembership/gkehub_v1beta1_gkehubfeaturemembership.yaml index d02d4c6bb5..1b9cd12220 100644 --- a/samples/resources/gkehubfeaturemembership/gkehub_v1beta1_gkehubfeaturemembership.yaml +++ b/samples/resources/gkehubfeaturemembership/gkehub_v1beta1_gkehubfeaturemembership.yaml @@ -33,6 +33,7 @@ spec: policyDir: "config-connector" syncWaitSecs: "20" syncRev: "HEAD" + secretType: "none" policyController: enabled: true exemptableNamespaces: diff --git a/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml b/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml new file mode 100644 index 0000000000..e94de8bfab --- /dev/null +++ b/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml @@ -0,0 +1,29 @@ +# Copyright 2020 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 +kind: PubSubSubscription +metadata: + labels: + label-one: "value-one" + name: pubsubsubscription-sample-basic +spec: + ackDeadlineSeconds: 15 + messageRetentionDuration: 86400s + retainAckedMessages: false + topicRef: + name: pubsubsubscription-dep1-basic + deadLetterPolicy: + deadLetterTopicRef: + name: pubsubsubscription-dep2-basic diff --git a/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml new file mode 100644 index 0000000000..e517f6e8b2 --- /dev/null +++ b/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml @@ -0,0 +1,23 @@ +# Copyright 2020 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 +kind: PubSubTopic +metadata: + name: pubsubsubscription-dep1-basic +--- +apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 +kind: PubSubTopic +metadata: + name: pubsubsubscription-dep2-basic diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerydataset.yaml new file mode 100644 index 0000000000..6bcdebf190 --- /dev/null +++ b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerydataset.yaml @@ -0,0 +1,24 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +# Replace ${PROJECT_ID?} below with your desired project ID. +apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 +kind: BigQueryDataset +metadata: + name: pubsubsubscription-dep-bigquery + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + resourceID: pubsubsubscriptiondepbigquery diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerytable.yaml new file mode 100644 index 0000000000..1ad3198deb --- /dev/null +++ b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerytable.yaml @@ -0,0 +1,36 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +# Replace ${PROJECT_ID?} below with your desired project ID. +apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 +kind: BigQueryTable +metadata: + name: pubsubsubscription-dep-bigquery + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + resourceID: pubsubsubscriptiondepbigquery + friendlyName: pubsubsubscription-dep-bigquery + datasetRef: + name: pubsubsubscription-dep-bigquery + schema: > + [ + { + "name": "data", + "type": "STRING", + "mode": "NULLABLE", + "description": "The data" + } + ] diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/iam_v1beta1_iampolicymember.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/iam_v1beta1_iampolicymember.yaml new file mode 100644 index 0000000000..11d9e09859 --- /dev/null +++ b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/iam_v1beta1_iampolicymember.yaml @@ -0,0 +1,39 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +# Replace ${PROJECT_ID?} and ${PROJECT_NUMBER?} below with your desired project +# ID and project number. +apiVersion: iam.cnrm.cloud.google.com/v1beta1 +kind: IAMPolicyMember +metadata: + name: pubsubsubscription-dep1-bigquery +spec: + member: serviceAccount:service-${PROJECT_NUMBER?}@gcp-sa-pubsub.iam.gserviceaccount.com + role: roles/bigquery.metadataViewer + resourceRef: + apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 + kind: Project + external: projects/${PROJECT_ID?} +--- +apiVersion: iam.cnrm.cloud.google.com/v1beta1 +kind: IAMPolicyMember +metadata: + name: pubsubsubscription-dep2-bigquery +spec: + member: serviceAccount:service-${PROJECT_NUMBER?}@gcp-sa-pubsub.iam.gserviceaccount.com + role: roles/bigquery.dataEditor + resourceRef: + apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 + kind: Project + external: projects/${PROJECT_ID?} diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml new file mode 100644 index 0000000000..978affe656 --- /dev/null +++ b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml @@ -0,0 +1,28 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +# Replace ${PROJECT_ID?} below with your desired project ID. +apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 +kind: PubSubSubscription +metadata: + name: pubsubsubscription-sample-bigquery + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + bigqueryConfig: + tableRef: + name: pubsubsubscription-dep-bigquery + topicRef: + name: pubsubsubscription-dep-bigquery diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml new file mode 100644 index 0000000000..6224ff40e3 --- /dev/null +++ b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml @@ -0,0 +1,22 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +# Replace ${PROJECT_ID?} below with your desired project ID. +apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 +kind: PubSubTopic +metadata: + name: pubsubsubscription-dep-bigquery + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} diff --git a/samples/resources/sqlinstance/sql-server-instance/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/sql-server-instance/sql_v1beta1_sqlinstance.yaml new file mode 100644 index 0000000000..352f3c4119 --- /dev/null +++ b/samples/resources/sqlinstance/sql-server-instance/sql_v1beta1_sqlinstance.yaml @@ -0,0 +1,31 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: sql.cnrm.cloud.google.com/v1beta1 +kind: SQLInstance +metadata: + name: sqlinstance-sample-sqlserver + annotations: + # Replace ${PROJECT_ID?} with your project ID + cnrm.cloud.google.com/project-id: ${PROJECT_ID?} +spec: + region: us-central1 + databaseVersion: SQLSERVER_2017_EXPRESS + settings: + tier: db-custom-1-3840 + sqlServerAuditConfig: + bucketRef: + name: ${PROJECT_ID?}-sqlinstance-dep-sqlserver + rootPassword: + value: "1234" diff --git a/samples/resources/sqlinstance/sql-server-instance/storage_v1beta1_storagebucket.yaml b/samples/resources/sqlinstance/sql-server-instance/storage_v1beta1_storagebucket.yaml new file mode 100644 index 0000000000..db1337edc9 --- /dev/null +++ b/samples/resources/sqlinstance/sql-server-instance/storage_v1beta1_storagebucket.yaml @@ -0,0 +1,21 @@ +# Copyright 2022 Google LLC +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. + +apiVersion: storage.cnrm.cloud.google.com/v1beta1 +kind: StorageBucket +metadata: + annotations: + cnrm.cloud.google.com/force-destroy: "false" + # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. + name: ${PROJECT_ID?}-sqlinstance-dep-sqlserver